metagRoot

F463104

General Info

Members	Datasets	Scaffolds	Average Seq Length
555	261	554	175

Family's Representative Sequence

Representative Sequence	3300013105\|Ga0157369_11226650\|Ga0157369_112266501
Length	172
Sequence	MRASVFVGTSLDGFLARPNGELDFLDAGGSEPHGYEEFMASVDAIVIGRNTFDVVLGFSSWPYRKPVFVLSTRTLPPVPAGAQVEQLSGEPRDIVRRLEARGFGHIYVDGGITVQRFLEAGLIQRLIITRVPVLIGTGIPLFGPLGRDVTVRHVATRDFRGGLVQSEYEVVS

Samples

	Sample ID	Description	Type	Environment
1	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
2	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
3	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
4	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
5	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
6	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
7	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
8	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
9	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
10	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
11	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
12	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
13	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
14	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
15	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
16	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
17	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
20	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
21	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
22	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
23	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
24	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
25	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
26	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
27	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
28	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
29	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
30	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
31	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
32	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
33	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
34	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
35	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
36	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
37	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
40	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
41	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
42	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
43	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
44	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
45	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
46	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
47	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
48	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
49	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
50	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
51	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
52	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
53	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
54	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
55	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
56	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
57	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
58	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
59	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
60	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
61	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
62	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
63	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
64	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
65	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
66	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
67	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
68	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
69	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
70	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
71	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
72	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
73	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
74	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
75	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
76	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
77	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
78	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
79	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
80	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
81	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
82	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
84	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
85	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
86	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
87	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
88	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
89	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
90	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
91	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
92	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
94	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
95	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
96	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
98	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
99	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
100	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
101	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
102	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
103	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
104	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
105	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
106	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
107	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
108	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
109	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
110	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
111	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
112	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
113	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
114	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
115	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
116	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
117	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
118	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
119	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
125	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
126	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
128	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
185	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
186	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
190	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
191	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
192	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
193	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
194	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
195	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
196	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
197	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
198	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
199	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
200	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
201	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
202	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
203	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
204	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
205	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
206	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
207	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
208	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
209	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
210	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
211	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
212	3300042000	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539	Metagenome	Rhizosphere
213	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
214	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
215	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
216	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
217	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
218	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
219	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
220	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
221	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
222	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
223	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
224	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
225	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
226	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
227	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
228	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
229	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
230	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
231	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
232	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
233	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
234	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
235	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
236	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
237	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
238	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
239	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
240	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
241	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
242	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
243	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
244	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049768	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought	Metagenome	Rhizosphere
246	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
247	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
248	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
249	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
250	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
251	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
252	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
253	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
254	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
255	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
256	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
257	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
258	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
259	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
260	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
261	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.28
Metatranscriptomes	0.54
Isolates	0.18

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.77
Nodule	0
Rhizoplane	0.9
Rhizosphere	91.17
Stem	0
Stem Tuber	0
Unclassified	2.16

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1028510	3300001977	Unclassified	770
2	JGI25162J39368_1001466	3300002737	Bacteria	12411
3	JGI25157J39369_1002051	3300002741	Bacteria	5763
4	JGI25164J39214_1000365	3300002772	Bacteria	27098
5	JGI25165J46597_1002492	3300003214	Bacteria	5840
6	rootH1_10367189	3300003323	Bacteria	1254
7	Ga0055527_1000033	3300003760	Bacteria	140664
8	Ga0055535_1000059	3300003761	Bacteria	124595
9	Ga0055535_1000277	3300003761	Bacteria	53770
10	Ga0055542_1000075	3300003762	Bacteria	140936
11	Ga0055542_1000086	3300003762	Bacteria	124594
12	Ga0055529_1000212	3300003763	Bacteria	76463
13	Ga0055529_1001044	3300003763	Bacteria	12989
14	Ga0055529_1002415	3300003763	Bacteria	3643
15	Ga0065712_10068087	3300005290	Bacteria	15101
16	Ga0065715_10008571	3300005293	Bacteria	3185
17	Ga0065715_10239429	3300005293	Bacteria	1204
18	Ga0065707_10019414	3300005295	Bacteria	2149
19	Ga0065707_10448130	3300005295	Bacteria	786
20	Ga0070676_10028997	3300005328	Bacteria	3145
21	Ga0070676_10253986	3300005328	Bacteria	1174
22	Ga0070683_100333711	3300005329	Bacteria	1444
23	Ga0070690_100088510	3300005330	Bacteria	2036
24	Ga0070670_100016005	3300005331	Bacteria	6437
25	Ga0070670_100070088	3300005331	Bacteria	3010
26	Ga0070670_100103144	3300005331	Bacteria	2457
27	Ga0070666_10036005	3300005335	Bacteria	3283
28	Ga0070666_10063932	3300005335	Bacteria	2495
29	Ga0070682_100008016	3300005337	Bacteria	5947
30	Ga0070689_100012107	3300005340	Bacteria	6202
31	Ga0070689_100215704	3300005340	Bacteria	1572
32	Ga0070689_100426031	3300005340	Unclassified	1125
33	Ga0070691_10461025	3300005341	Bacteria	727
34	Ga0070687_100008417	3300005343	Bacteria	4371
35	Ga0070687_100210505	3300005343	Unclassified	1184
36	Ga0070661_100168636	3300005344	Bacteria	1661
37	Ga0070661_100202695	3300005344	Bacteria	1516
38	Ga0070661_100205174	3300005344	Bacteria	1507
39	Ga0070692_10150131	3300005345	Bacteria	1327
40	Ga0070692_10179208	3300005345	Bacteria	1227
41	Ga0070668_100095005	3300005347	Bacteria	2354
42	Ga0070668_100786994	3300005347	Unclassified	844
43	Ga0070669_100114149	3300005353	Unclassified	2053
44	Ga0070669_100354378	3300005353	Bacteria	1192
45	Ga0070669_100470472	3300005353	Bacteria	1038
46	Ga0070675_100000520	3300005354	Bacteria	26280
47	Ga0070675_100038597	3300005354	Unclassified	3893
48	Ga0070675_100056634	3300005354	Bacteria	3231
49	Ga0070675_100385350	3300005354	Bacteria	1248
50	Ga0070675_100452231	3300005354	Bacteria	1152
51	Ga0070675_100731238	3300005354	Bacteria	902
52	Ga0070675_100954910	3300005354	Bacteria	786
53	Ga0070671_100133398	3300005355	Bacteria	2092
54	Ga0070674_100408167	3300005356	Unclassified	1111
55	Ga0070673_100038333	3300005364	Bacteria	3659
56	Ga0070673_100461225	3300005364	Unclassified	1144
57	Ga0070673_100601579	3300005364	Bacteria	1003
58	Ga0070673_100636734	3300005364	Bacteria	975
59	Ga0070688_100013160	3300005365	Bacteria	4659
60	Ga0070688_100043173	3300005365	Bacteria	2776
61	Ga0070659_100150010	3300005366	Bacteria	1901
62	Ga0070659_100230052	3300005366	Bacteria	1532
63	Ga0070659_100739200	3300005366	Bacteria	853
64	Ga0070659_100811870	3300005366	Bacteria	814
65	Ga0070713_100136811	3300005436	Unclassified	2166
66	Ga0070701_10078904	3300005438	Bacteria	1777
67	Ga0070701_10142676	3300005438	Bacteria	1372
68	Ga0070701_10170664	3300005438	Bacteria	1266
69	Ga0070701_10457437	3300005438	Unclassified	820
70	Ga0070711_100010323	3300005439	Bacteria	5778
71	Ga0070705_100026073	3300005440	Bacteria	3178
72	Ga0070705_100088514	3300005440	Bacteria	1922
73	Ga0070705_100713532	3300005440	Bacteria	789
74	Ga0070705_101113033	3300005440	Unclassified	647
75	Ga0070700_100436434	3300005441	Unclassified	993
76	Ga0070700_100469426	3300005441	Bacteria	962
77	Ga0070694_100250117	3300005444	Unclassified	1340
78	Ga0070694_100660911	3300005444	Unclassified	847
79	Ga0070708_100232617	3300005445	Unclassified	1729
80	Ga0070708_100529146	3300005445	Bacteria	1112
81	Ga0070708_101279105	3300005445	Unclassified	685
82	Ga0070663_100059933	3300005455	Bacteria	2736
83	Ga0070678_100223758	3300005456	Bacteria	1565
84	Ga0070678_100402251	3300005456	Bacteria	1190
85	Ga0070678_100518685	3300005456	Bacteria	1054
86	Ga0070662_100010573	3300005457	Bacteria	6065
87	Ga0070662_100092329	3300005457	Bacteria	2275
88	Ga0070662_100161406	3300005457	Bacteria	1753
89	Ga0070662_100432992	3300005457	Unclassified	1089
90	Ga0070662_100593575	3300005457	Bacteria	931
91	Ga0070681_10095126	3300005458	Unclassified	2928
92	Ga0070681_11051018	3300005458	Bacteria	735
93	Ga0068867_100296096	3300005459	Bacteria	1332
94	Ga0070685_10017535	3300005466	Bacteria	3834
95	Ga0070685_10028285	3300005466	Bacteria	3105
96	Ga0070706_101008566	3300005467	Bacteria	767
97	Ga0070707_100033159	3300005468	Bacteria	4923
98	Ga0070707_100050931	3300005468	Unclassified	3969
99	Ga0070707_100239215	3300005468	Bacteria	1767
100	Ga0070707_100781379	3300005468	Bacteria	918
101	Ga0070698_100000929	3300005471	Bacteria	32009
102	Ga0070698_100025554	3300005471	Bacteria	6156
103	Ga0070698_100586095	3300005471	Bacteria	1055
104	Ga0070698_101190590	3300005471	Bacteria	711
105	Ga0070699_100002294	3300005518	Bacteria	17216
106	Ga0070697_100212373	3300005536	Bacteria	1648
107	Ga0070697_100303010	3300005536	Bacteria	1374
108	Ga0070697_100396517	3300005536	Bacteria	1197
109	Ga0068853_100600564	3300005539	Unclassified	1045
110	Ga0068853_100994935	3300005539	Bacteria	807
111	Ga0070672_100059439	3300005543	Bacteria	3007
112	Ga0070672_100186726	3300005543	Bacteria	1729
113	Ga0070686_100001296	3300005544	Bacteria	14136
114	Ga0070686_100376530	3300005544	Bacteria	1073
115	Ga0070686_100570225	3300005544	Bacteria	888
116	Ga0070695_100047290	3300005545	Bacteria	2747
117	Ga0070695_100220556	3300005545	Unclassified	1366
118	Ga0070696_100018133	3300005546	Bacteria	4755
119	Ga0070696_100023093	3300005546	Unclassified	4228
120	Ga0070696_100076304	3300005546	Unclassified	2366
121	Ga0070696_100519811	3300005546	Bacteria	950
122	Ga0070696_100523043	3300005546	Bacteria	947
123	Ga0070693_100422069	3300005547	Bacteria	930
124	Ga0070665_100212571	3300005548	Bacteria	1935
125	Ga0070665_101246590	3300005548	Unclassified	754
126	Ga0070665_101522985	3300005548	Bacteria	677
127	Ga0070704_100018415	3300005549	Bacteria	4466
128	Ga0070704_100030050	3300005549	Bacteria	3636
129	Ga0070704_100105789	3300005549	Bacteria	2131
130	Ga0070704_100367394	3300005549	Bacteria	1219
131	Ga0068855_100777867	3300005563	Bacteria	1019
132	Ga0070664_100082162	3300005564	Bacteria	2778
133	Ga0070664_100091589	3300005564	Bacteria	2632
134	Ga0070664_100231469	3300005564	Bacteria	1656
135	Ga0070664_100251235	3300005564	Bacteria	1590
136	Ga0070664_101061279	3300005564	Unclassified	762
137	Ga0068857_100059343	3300005577	Bacteria	3398
138	Ga0068854_100274222	3300005578	Bacteria	1355
139	Ga0068854_100679042	3300005578	Bacteria	887
140	Ga0068856_101042260	3300005614	Bacteria	836
141	Ga0070702_100126339	3300005615	Bacteria	1609
142	Ga0070702_100460262	3300005615	Bacteria	925
143	Ga0070702_100681459	3300005615	Unclassified	781
144	Ga0068852_100538726	3300005616	Bacteria	1166
145	Ga0068859_100185573	3300005617	Bacteria	2163
146	Ga0068859_100281404	3300005617	Bacteria	1756
147	Ga0068859_100428310	3300005617	Bacteria	1419
148	Ga0068859_101289559	3300005617	Bacteria	805
149	Ga0068864_100113506	3300005618	Bacteria	2415
150	Ga0068864_100282846	3300005618	Bacteria	1549
151	Ga0068866_10445467	3300005718	Unclassified	845
152	Ga0068861_100165541	3300005719	Bacteria	1828
153	Ga0068861_100233336	3300005719	Unclassified	1562
154	Ga0068861_100284471	3300005719	Unclassified	1425
155	Ga0068861_100299108	3300005719	Bacteria	1393
156	Ga0068861_100908945	3300005719	Bacteria	834
157	Ga0068861_101251169	3300005719	Bacteria	720
158	Ga0068870_10000249	3300005840	Bacteria	19958
159	Ga0068870_10156684	3300005840	Bacteria	1347
160	Ga0068870_10344523	3300005840	Bacteria	954
161	Ga0068870_10477340	3300005840	Bacteria	827
162	Ga0068863_100632231	3300005841	Bacteria	1061
163	Ga0068863_100814008	3300005841	Bacteria	932
164	Ga0068858_100023389	3300005842	Bacteria	5756
165	Ga0068858_100498666	3300005842	Bacteria	1176
166	Ga0068860_100043521	3300005843	Unclassified	4283
167	Ga0068860_100886073	3300005843	Bacteria	908
168	Ga0068862_100075544	3300005844	Bacteria	2915
169	Ga0068862_100158400	3300005844	Bacteria	2019
170	Ga0068862_100177191	3300005844	Bacteria	1912
171	Ga0068862_100186058	3300005844	Unclassified	1866
172	Ga0068862_100297246	3300005844	Bacteria	1484
173	Ga0068862_100576664	3300005844	Unclassified	1077
174	Ga0068862_100576970	3300005844	Bacteria	1077
175	Ga0068862_101702815	3300005844	Unclassified	639
176	Ga0081455_10021754	3300005937	Bacteria	6007
177	Ga0070717_10564931	3300006028	Bacteria	1031
178	Ga0075432_10055145	3300006058	Bacteria	1408
179	Ga0075432_10236557	3300006058	Bacteria	736
180	Ga0070716_100294293	3300006173	Bacteria	1126
181	Ga0070712_100029406	3300006175	Bacteria	3682
182	Ga0075367_10000261	3300006178	Bacteria	18062
183	Ga0097621_100345924	3300006237	Bacteria	1321
184	Ga0068871_100571428	3300006358	Bacteria	1026
185	Ga0068871_100716324	3300006358	Unclassified	918
186	Ga0068871_100775340	3300006358	Bacteria	883
187	Ga0075428_100007143	3300006844	Bacteria	12372
188	Ga0075428_100042578	3300006844	Bacteria	4993
189	Ga0075428_100056927	3300006844	Bacteria	4281
190	Ga0075428_100099064	3300006844	Unclassified	3178
191	Ga0075428_100150158	3300006844	Bacteria	2531
192	Ga0075428_100207601	3300006844	Bacteria	2117
193	Ga0075428_100247478	3300006844	Bacteria	1922
194	Ga0075428_100702074	3300006844	Bacteria	1078
195	Ga0075430_100002372	3300006846	Bacteria	15644
196	Ga0075430_100014064	3300006846	Bacteria	6823
197	Ga0075430_100026441	3300006846	Bacteria	4937
198	Ga0075430_100064510	3300006846	Plasmid	3077
199	Ga0075431_100002523	3300006847	Bacteria	17658
200	Ga0075431_100011776	3300006847	Bacteria	8825
201	Ga0075431_100052911	3300006847	Unclassified	4186
202	Ga0075431_100383047	3300006847	Bacteria	1410
203	Ga0075433_10047222	3300006852	Bacteria	3745
204	Ga0075433_10179868	3300006852	Bacteria	1882
205	Ga0075433_10476870	3300006852	Unclassified	1099
206	Ga0075434_100076152	3300006871	Bacteria	3350
207	Ga0075434_100582086	3300006871	Unclassified	1138
208	Ga0075434_100664792	3300006871	Bacteria	1060
209	Ga0075434_100749841	3300006871	Unclassified	993
210	Ga0075434_101129013	3300006871	Unclassified	797
211	Ga0075429_100013119	3300006880	Bacteria	7188
212	Ga0075429_100018704	3300006880	Bacteria	5998
213	Ga0075429_100119717	3300006880	Bacteria	2301
214	Ga0075429_100324381	3300006880	Bacteria	1348
215	Ga0075429_100428793	3300006880	Bacteria	1158
216	Ga0075429_100649661	3300006880	Unclassified	924
217	Ga0068865_100065439	3300006881	Bacteria	2561
218	Ga0068865_100133231	3300006881	Unclassified	1864
219	Ga0075436_100000197	3300006914	Bacteria	37393
220	Ga0075436_100004897	3300006914	Bacteria	9203
221	Ga0097620_100185573	3300006931	Bacteria	2163
222	Ga0097620_100281398	3300006931	Bacteria	1756
223	Ga0097620_100428300	3300006931	Bacteria	1419
224	Ga0097620_101289768	3300006931	Bacteria	805
225	Ga0075435_100020782	3300007076	Bacteria	5038
226	Ga0075435_100053297	3300007076	Bacteria	3262
227	Ga0111539_10000233	3300009094	Bacteria	66233
228	Ga0111539_10017187	3300009094	Bacteria	8953
229	Ga0111539_10046765	3300009094	Bacteria	5175
230	Ga0111539_10385041	3300009094	Unclassified	1633
231	Ga0111539_10468389	3300009094	Unclassified	1467
232	Ga0111539_10911123	3300009094	Unclassified	1022
233	Ga0111539_10972197	3300009094	Bacteria	987
234	Ga0105245_10519429	3300009098	Bacteria	1209
235	Ga0114129_10027666	3300009147	Bacteria	8028
236	Ga0114129_10030273	3300009147	Bacteria	7662
237	Ga0114129_10032815	3300009147	Bacteria	7336
238	Ga0114129_10071559	3300009147	Bacteria	4836
239	Ga0114129_10095292	3300009147	Bacteria	4122
240	Ga0114129_10273217	3300009147	Bacteria	2261
241	Ga0114129_10350743	3300009147	Unclassified	1955
242	Ga0114129_10379823	3300009147	Unclassified	1866
243	Ga0114129_10704010	3300009147	Bacteria	1298
244	Ga0114129_11444065	3300009147	Bacteria	847
245	Ga0105243_10173443	3300009148	Unclassified	1870
246	Ga0105243_11078165	3300009148	Bacteria	810
247	Ga0105241_10064885	3300009174	Bacteria	2820
248	Ga0105241_10472338	3300009174	Unclassified	1113
249	Ga0105242_11259207	3300009176	Unclassified	761
250	Ga0105248_10018181	3300009177	Bacteria	7763
251	Ga0105248_10025679	3300009177	Bacteria	6552
252	Ga0105248_10105277	3300009177	Bacteria	3180
253	Ga0105248_10167459	3300009177	Bacteria	2477
254	Ga0105248_11000140	3300009177	Bacteria	945
255	Ga0105248_11100739	3300009177	Unclassified	898
256	Ga0105248_11889403	3300009177	Bacteria	678
257	Ga0105248_11983812	3300009177	Bacteria	661
258	Ga0105238_10217306	3300009551	Bacteria	1887
259	Ga0105249_10228269	3300009553	Bacteria	1835
260	Ga0105249_10441489	3300009553	Unclassified	1339
261	Ga0105249_11595613	3300009553	Unclassified	725
262	Ga0105239_10000201	3300010375	Bacteria	87658
263	Ga0105239_10171889	3300010375	Bacteria	2423
264	Ga0105239_11825839	3300010375	Bacteria	704
265	Ga0105246_10381974	3300011119	Bacteria	1164
266	Ga0105246_11498252	3300011119	Bacteria	633
267	Ga0157373_10174344	3300013100	Bacteria	1513
268	Ga0157370_10189379	3300013104	Bacteria	1910
269	Ga0157369_11226650	3300013105	Unclassified	765
270	Ga0157378_10015334	3300013297	Bacteria	6711
271	Ga0157378_10058796	3300013297	Bacteria	3429
272	Ga0163162_10044077	3300013306	Bacteria	4467
273	Ga0163162_10211481	3300013306	Unclassified	2069
274	Ga0163162_10222570	3300013306	Bacteria	2017
275	Ga0163162_10291222	3300013306	Bacteria	1765
276	Ga0163162_12428982	3300013306	Unclassified	603
277	Ga0157375_10256122	3300013308	Bacteria	1911
278	Ga0157375_10281388	3300013308	Unclassified	1826
279	Ga0157375_10290749	3300013308	Bacteria	1797
280	Ga0157375_10970699	3300013308	Bacteria	991
281	Ga0157375_11135158	3300013308	Bacteria	915
282	Ga0157375_11190666	3300013308	Unclassified	894
283	Ga0157375_12380388	3300013308	Unclassified	632
284	Ga0163163_10003283	3300014325	Bacteria	13716
285	Ga0163163_10102023	3300014325	Bacteria	2892
286	Ga0163163_10312836	3300014325	Bacteria	1624
287	Ga0163163_10449745	3300014325	Bacteria	1348
288	Ga0157380_10085480	3300014326	Bacteria	2589
289	Ga0157380_10150190	3300014326	Bacteria	2013
290	Ga0157380_10191082	3300014326	Bacteria	1808
291	Ga0157380_10242800	3300014326	Unclassified	1625
292	Ga0157380_11518049	3300014326	Bacteria	723
293	Ga0182008_10101864	3300014497	Bacteria	1420
294	Ga0157377_10060476	3300014745	Bacteria	2163
295	Ga0157377_10093324	3300014745	Bacteria	1781
296	Ga0157379_10089904	3300014968	Bacteria	2755
297	Ga0157379_10188084	3300014968	Bacteria	1866
298	Ga0157376_10079146	3300014969	Bacteria	2817
299	Ga0157376_10292093	3300014969	Bacteria	1539
300	Ga0182006_1072229	3300015261	Bacteria	1277
301	Ga0182007_10079757	3300015262	Bacteria	1074
302	Ga0209672_100004	3300025228	Bacteria	1467504
303	Ga0209672_100074	3300025228	Bacteria	159792
304	Ga0209563_100028	3300025230	Bacteria	509539
305	Ga0207427_100147	3300025231	Bacteria	80584
306	Ga0209437_100005	3300025233	Bacteria	1071596
307	Ga0209258_100003	3300025242	Bacteria	1467504
308	Ga0209258_100004	3300025242	Bacteria	1376422
309	Ga0209258_100008	3300025242	Bacteria	1009355
310	Ga0209646_1002701	3300025246	Bacteria	3791
311	Ga0209026_1000181	3300025250	Bacteria	92632
312	Ga0209026_1002498	3300025250	Bacteria	6834
313	Ga0209148_1000016	3300025254	Bacteria	804369
314	Ga0209148_1000041	3300025254	Bacteria	469323
315	Ga0209759_1002424	3300025256	Bacteria	8187
316	Ga0209233_1000011	3300025261	Bacteria	1071611
317	Ga0209455_1000004	3300025272	Bacteria	1467504
318	Ga0209455_1000007	3300025272	Bacteria	1157983
319	Ga0209455_1000216	3300025272	Bacteria	81066
320	Ga0207697_10070683	3300025315	Unclassified	1462
321	Ga0207653_10065547	3300025885	Bacteria	1233
322	Ga0207682_10041005	3300025893	Bacteria	1888
323	Ga0207642_10630431	3300025899	Unclassified	670
324	Ga0207710_10385516	3300025900	Bacteria	718
325	Ga0207680_10008576	3300025903	Bacteria	5028
326	Ga0207647_10072138	3300025904	Bacteria	2083
327	Ga0207699_10537480	3300025906	Bacteria	847
328	Ga0207645_10137634	3300025907	Bacteria	1590
329	Ga0207643_10005422	3300025908	Bacteria	6822
330	Ga0207643_10145108	3300025908	Unclassified	1420
331	Ga0207705_10120413	3300025909	Bacteria	1947
332	Ga0207684_10480124	3300025910	Bacteria	1066
333	Ga0207654_10490589	3300025911	Bacteria	866
334	Ga0207654_10645698	3300025911	Unclassified	758
335	Ga0207693_10002012	3300025915	Bacteria	17841
336	Ga0207663_10032306	3300025916	Plasmid	3106
337	Ga0207662_10011574	3300025918	Bacteria	4899
338	Ga0207662_10128328	3300025918	Unclassified	1596
339	Ga0207649_10744044	3300025920	Bacteria	762
340	Ga0207646_10008700	3300025922	Bacteria	10130
341	Ga0207646_10016030	3300025922	Bacteria	7044
342	Ga0207681_10021792	3300025923	Bacteria	4078
343	Ga0207681_10059782	3300025923	Unclassified	2614
344	Ga0207681_10300250	3300025923	Bacteria	1270
345	Ga0207681_10979626	3300025923	Bacteria	709
346	Ga0207694_10793838	3300025924	Bacteria	800
347	Ga0207650_10048788	3300025925	Bacteria	3124
348	Ga0207650_10103252	3300025925	Bacteria	2198
349	Ga0207650_10209159	3300025925	Bacteria	1566
350	Ga0207659_10004681	3300025926	Bacteria	8291
351	Ga0207659_10043328	3300025926	Unclassified	3160
352	Ga0207659_10286303	3300025926	Bacteria	1349
353	Ga0207659_10643510	3300025926	Bacteria	906
354	Ga0207700_10399405	3300025928	Unclassified	1204
355	Ga0207700_11057111	3300025928	Bacteria	726
356	Ga0207644_10107229	3300025931	Bacteria	2107
357	Ga0207690_10342179	3300025932	Bacteria	1181
358	Ga0207706_10055624	3300025933	Bacteria	3489
359	Ga0207706_10055838	3300025933	Bacteria	3482
360	Ga0207706_10221138	3300025933	Bacteria	1658
361	Ga0207706_10375772	3300025933	Bacteria	1234
362	Ga0207706_10413165	3300025933	Bacteria	1169
363	Ga0207706_10584361	3300025933	Bacteria	960
364	Ga0207686_10695907	3300025934	Bacteria	808
365	Ga0207709_10107275	3300025935	Unclassified	1859
366	Ga0207670_10147875	3300025936	Bacteria	1740
367	Ga0207670_10240973	3300025936	Bacteria	1393
368	Ga0207670_10314050	3300025936	Bacteria	1231
369	Ga0207704_10321626	3300025938	Bacteria	1193
370	Ga0207691_10264559	3300025940	Unclassified	1482
371	Ga0207691_10273473	3300025940	Bacteria	1454
372	Ga0207691_10397650	3300025940	Bacteria	1175
373	Ga0207711_10008993	3300025941	Bacteria	8350
374	Ga0207711_10091990	3300025941	Bacteria	2669
375	Ga0207711_10126152	3300025941	Bacteria	2290
376	Ga0207711_10330047	3300025941	Unclassified	1411
377	Ga0207711_10700086	3300025941	Bacteria	945
378	Ga0207689_10004330	3300025942	Bacteria	12928
379	Ga0207689_10164958	3300025942	Bacteria	1825
380	Ga0207689_10215290	3300025942	Bacteria	1587
381	Ga0207679_10961311	3300025945	Unclassified	782
382	Ga0207667_10468096	3300025949	Bacteria	1280
383	Ga0207651_10213043	3300025960	Bacteria	1556
384	Ga0207651_10320944	3300025960	Bacteria	1295
385	Ga0207651_10402631	3300025960	Unclassified	1164
386	Ga0207651_10504797	3300025960	Bacteria	1046
387	Ga0207651_11492639	3300025960	Unclassified	609
388	Ga0207712_10100188	3300025961	Bacteria	2152
389	Ga0207712_10414288	3300025961	Bacteria	1135
390	Ga0207712_10415900	3300025961	Bacteria	1133
391	Ga0207668_10246683	3300025972	Bacteria	1448
392	Ga0207640_10057229	3300025981	Bacteria	2563
393	Ga0207640_10377896	3300025981	Bacteria	1147
394	Ga0207658_11308286	3300025986	Bacteria	663
395	Ga0207677_11305711	3300026023	Bacteria	666
396	Ga0207703_10128059	3300026035	Bacteria	2188
397	Ga0207703_10464256	3300026035	Bacteria	1184
398	Ga0207639_10597802	3300026041	Bacteria	1017
399	Ga0207639_11110097	3300026041	Unclassified	742
400	Ga0207678_10017862	3300026067	Bacteria	6230
401	Ga0207708_10075294	3300026075	Bacteria	2588
402	Ga0207708_10145475	3300026075	Bacteria	1862
403	Ga0207708_10232444	3300026075	Bacteria	1480
404	Ga0207708_10303443	3300026075	Bacteria	1299
405	Ga0207708_10467794	3300026075	Bacteria	1052
406	Ga0207702_10007263	3300026078	Bacteria	9474
407	Ga0207702_10855297	3300026078	Bacteria	900
408	Ga0207702_11364508	3300026078	Unclassified	703
409	Ga0207641_10606930	3300026088	Bacteria	1072
410	Ga0207648_10049521	3300026089	Bacteria	3676
411	Ga0207648_10091908	3300026089	Bacteria	2653
412	Ga0207648_10289119	3300026089	Bacteria	1467
413	Ga0207676_10154580	3300026095	Bacteria	1980
414	Ga0207676_10604782	3300026095	Bacteria	1053
415	Ga0207674_10031211	3300026116	Bacteria	5599
416	Ga0207674_10268692	3300026116	Unclassified	1653
417	Ga0207675_100066239	3300026118	Bacteria	3376
418	Ga0207675_100241190	3300026118	Bacteria	1747
419	Ga0207675_100343900	3300026118	Bacteria	1461
420	Ga0207675_100954521	3300026118	Bacteria	875
421	Ga0207683_10606173	3300026121	Bacteria	1014
422	Ga0207683_10751427	3300026121	Bacteria	905
423	Ga0209971_1005020	3300027682	Bacteria	3143
424	Ga0209998_10106130	3300027717	Bacteria	699
425	Ga0207428_10021179	3300027907	Bacteria	5506
426	Ga0207428_10122627	3300027907	Bacteria	1992
427	Ga0207428_10564835	3300027907	Bacteria	822
428	Ga0265354_1000979	3300028016	Bacteria	4493
429	Ga0268266_10894045	3300028379	Bacteria	859
430	Ga0268266_11372816	3300028379	Bacteria	682
431	Ga0268265_10183725	3300028380	Bacteria	1799
432	Ga0268265_10207606	3300028380	Bacteria	1704
433	Ga0268265_10407726	3300028380	Bacteria	1258
434	Ga0268265_10408630	3300028380	Unclassified	1257
435	Ga0268265_10422241	3300028380	Bacteria	1238
436	Ga0268265_10989556	3300028380	Unclassified	830
437	Ga0268265_11100980	3300028380	Bacteria	789
438	Ga0268264_10246529	3300028381	Unclassified	1657
439	Ga0265770_1001203	3300030878	Bacteria	3589
440	Ga0265760_10000123	3300031090	Bacteria	19733
441	Ga0265760_10070554	3300031090	Unclassified	1071
442	Ga0307408_100065970	3300031548	Bacteria	2657
443	Ga0307408_100375875	3300031548	Bacteria	1213
444	Ga0307405_10530883	3300031731	Bacteria	949
445	Ga0307410_10189962	3300031852	Bacteria	1561
446	Ga0307406_10389195	3300031901	Bacteria	1102
447	Ga0307412_10206112	3300031911	Bacteria	1497
448	Ga0307412_10240560	3300031911	Bacteria	1400
449	Ga0307409_100239936	3300031995	Bacteria	1649
450	Ga0307416_100549933	3300032002	Bacteria	1227
451	Ga0307411_10366037	3300032005	Bacteria	1181
452	Ga0373934_0030347	3300035086	Bacteria	2114
453	Ga0373953_0058423	3300035117	Bacteria	1572
454	Ga0373954_0328716	3300035118	Bacteria	755
455	Ga0373960_0021531	3300035121	Bacteria	1716
456	Ga0373955_0040972	3300035172	Bacteria	2480
457	Ga0373961_0148361	3300035241	Unclassified	797
458	Ga0373931_0079450	3300035691	Bacteria	1807
459	Ga0373931_0177708	3300035691	Bacteria	1258
460	Ga0373935_0134049	3300035692	Bacteria	1667
461	Ga0373933_0050634	3300035724	Bacteria	2480
462	Ga0373937_0134589	3300036401	Bacteria	2310
463	Ga0373937_0291576	3300036401	Bacteria	1541
464	Ga0373937_0300547	3300036401	Unclassified	1517
465	Ga0373937_0682757	3300036401	Bacteria	973
466	Ga0373925_0733205	3300037068	Bacteria	815
467	Ga0395901_0370725	3300038443	Bacteria	1475
468	Ga0451847_0404847	3300041503	Bacteria	766
469	Ga0439437_004156	3300042000	Bacteria	1576
470	Ga0439434_0099534	3300042435	Unclassified	936
471	Ga0466963_0068669	3300044694	Bacteria	2381
472	Ga0451576_0253976	3300045051	Bacteria	1837
473	Ga0451576_0312229	3300045051	Bacteria	1645
474	Ga0466958_0012323	3300045836	Bacteria	4842
475	Ga0466967_0066505	3300045976	Bacteria	3212
476	Ga0495653_0195441	3300046463	Unclassified	1377
477	Ga0495653_0219224	3300046463	Bacteria	1280
478	Ga0495580_0574533	3300046472	Unclassified	747
479	Ga0495639_0037087	3300046475	Unclassified	2185
480	Ga0495608_0015827	3300046511	Bacteria	5219
481	Ga0495628_0044139	3300046516	Bacteria	3547
482	Ga0495628_0073555	3300046516	Bacteria	2663
483	Ga0495587_0325519	3300046536	Bacteria	858
484	Ga0495598_0009450	3300046537	Bacteria	2305
485	Ga0495598_0046108	3300046537	Bacteria	1294
486	Ga0495667_0134743	3300046559	Bacteria	1592
487	Ga0495635_0556271	3300046663	Bacteria	752
488	Ga0495657_0020173	3300046675	Bacteria	4794
489	Ga0495657_0163097	3300046675	Unclassified	1378
490	Ga0495599_0370501	3300046678	Bacteria	856
491	Ga0495581_0010420	3300047315	Bacteria	5376
492	Ga0495636_0255306	3300047318	Bacteria	812
493	Ga0495674_0104871	3300047319	Bacteria	2403
494	Ga0495680_0049649	3300047322	Bacteria	3285
495	Ga0495675_0005380	3300047444	Bacteria	7800
496	Ga0495684_0481781	3300047471	Bacteria	856
497	Ga0496102_0055287	3300048905	Bacteria	3620
498	Ga0496105_0000794	3300048908	Bacteria	21397
499	Ga0496106_0606757	3300048909	Bacteria	876
500	Ga0496108_0057469	3300048911	Bacteria	3269
501	Ga0496114_1018265	3300048917	Unclassified	712
502	Ga0496117_0039708	3300048920	Bacteria	3469
503	Ga0496118_0001721	3300048921	Bacteria	31914
504	Ga0496119_0000844	3300048922	Bacteria	40558
505	Ga0496120_0000110	3300048923	Bacteria	137494
506	Ga0501067_0089581	3300049583	Bacteria	1707
507	Ga0501271_023865	3300049768	Unclassified	723
508	nmdc:mga0k408_297689_c1	3300050493	Bacteria	963
509	nmdc:mga06z11_89460_c1	3300050494	Bacteria	1669
510	nmdc:mga05p37_13046_c1	3300050507	Bacteria	9944
511	nmdc:mga05p37_238713_c1	3300050507	Unclassified	2187
512	nmdc:mga05p37_41132_c1	3300050507	Bacteria	5676
513	nmdc:mga05p37_440717_c1	3300050507	Unclassified	1511
514	nmdc:mga05p37_853868_c1	3300050507	Bacteria	988
515	nmdc:mga05p37_956243_c1	3300050507	Bacteria	916
516	nmdc:mga09592_16759_c1	3300050508	Bacteria	5997
517	nmdc:mga09592_450554_c1	3300050508	Bacteria	1110
518	nmdc:mga09592_499680_c1	3300050508	Bacteria	1047
519	nmdc:mga09592_537708_c1	3300050508	Unclassified	1004
520	nmdc:mga09592_55136_c1	3300050508	Bacteria	3359
521	nmdc:mga0qj67_33580_c1	3300050509	Unclassified	4004
522	nmdc:mga0qj67_67648_c1	3300050509	Bacteria	2846
523	nmdc:mga0qj67_7450_c1	3300050509	Bacteria	8083
524	nmdc:mga06r32_42508_c1	3300050510	Bacteria	4321
525	nmdc:mga06r32_5211_c1	3300050510	Bacteria	11683
526	nmdc:mga06r32_532205_c1	3300050510	Bacteria	1150
527	nmdc:mga06r32_72598_c1	3300050510	Unclassified	3332
528	nmdc:mga06r32_76428_c1	3300050510	Bacteria	3252
529	nmdc:mga08y16_1696503_c1	3300050511	Bacteria	587
530	nmdc:mga08y16_18995_c1	3300050511	Bacteria	7239
531	nmdc:mga08y16_526986_c1	3300050511	Bacteria	1198
532	nmdc:mga08y16_74460_c1	3300050511	Unclassified	3538
533	nmdc:mga08y16_87630_c1	3300050511	Bacteria	3244
534	nmdc:mga08y16_98713_c1	3300050511	Bacteria	3041
535	nmdc:mga0n895_168480_c1	3300050512	Unclassified	2222
536	nmdc:mga0n895_483544_c1	3300050512	Bacteria	1248
537	nmdc:mga0n895_5742_c1	3300050512	Bacteria	10415
538	nmdc:mga0n895_722777_c1	3300050512	Bacteria	990
539	nmdc:mga0rr50_142545_c1	3300050513	Bacteria	1929
540	nmdc:mga0rr50_151400_c1	3300050513	Bacteria	1875
541	nmdc:mga0rr50_282175_c1	3300050513	Unclassified	1386
542	nmdc:mga08x19_11_c1	3300050514	Bacteria	403007
543	nmdc:mga08x19_2683_c1	3300050514	Bacteria	10748
544	nmdc:mga0a205_133020_c1	3300050515	Bacteria	2387
545	nmdc:mga0a205_214924_c1	3300050515	Bacteria	1810
546	nmdc:mga0a205_382709_c1	3300050515	Bacteria	1272
547	nmdc:mga0a205_5155_c1	3300050515	Bacteria	4113
548	nmdc:mga0a205_97613_c1	3300050515	Unclassified	2837
549	Ga0495601_0074028	3300053077	Bacteria	2179
550	Ga0500583_0153151	3300053092	Bacteria	1148
551	Ga0500555_005796	3300053103	Bacteria	3505
552	Ga0500555_013701	3300053103	Bacteria	2339
553	Ga0500645_027726	3300053730	Bacteria	1716
554	Ga0501084_0012876	3300054114	Bacteria	6930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009551	Ga0105238_10217306	Ga0105238_102173062	167
2	iso_pu_bacteria	2643221552	2643778318	169
3	3300005353	Ga0070669_100354378	Ga0070669_1003543781	171
4	3300050510	nmdc:mga06r32_5211_c1	nmdc:mga06r32_5211_c1_8253_8771	171
5	3300005331	Ga0070670_100016005	Ga0070670_1000160054	172
6	3300005344	Ga0070661_100205174	Ga0070661_1002051743	172
7	3300005347	Ga0070668_100786994	Ga0070668_1007869941	172
8	3300005364	Ga0070673_100461225	Ga0070673_1004612252	172
9	3300005536	Ga0070697_100396517	Ga0070697_1003965172	172
10	3300005545	Ga0070695_100047290	Ga0070695_1000472904	172
11	3300005546	Ga0070696_100018133	Ga0070696_1000181332	172
12	3300005548	Ga0070665_101522985	Ga0070665_1015229851	172
13	3300005549	Ga0070704_100030050	Ga0070704_1000300502	172
14	3300005564	Ga0070664_101061279	Ga0070664_1010612791	172
15	3300005577	Ga0068857_100059343	Ga0068857_1000593435	172
16	3300005618	Ga0068864_100113506	Ga0068864_1001135062	172
17	3300005844	Ga0068862_100158400	Ga0068862_1001584003	172
18	3300005937	Ga0081455_10021754	Ga0081455_100217544	172
19	3300006058	Ga0075432_10236557	Ga0075432_102365572	172
20	3300006358	Ga0068871_100571428	Ga0068871_1005714282	172
21	3300006844	Ga0075428_100056927	Ga0075428_1000569273	172
22	3300006846	Ga0075430_100026441	Ga0075430_1000264413	172
23	3300006847	Ga0075431_100011776	Ga0075431_1000117766	172
24	3300006847	Ga0075431_100052911	Ga0075431_1000529112	172
25	3300006852	Ga0075433_10047222	Ga0075433_100472223	172
26	3300006871	Ga0075434_100582086	Ga0075434_1005820862	172
27	3300006871	Ga0075434_100749841	Ga0075434_1007498412	172
28	3300006880	Ga0075429_100649661	Ga0075429_1006496612	172
29	3300007076	Ga0075435_100053297	Ga0075435_1000532974	172
30	3300009094	Ga0111539_10911123	Ga0111539_109111232	172
31	3300009147	Ga0114129_10032815	Ga0114129_100328155	172
32	3300009147	Ga0114129_10350743	Ga0114129_103507433	172
33	3300009147	Ga0114129_10704010	Ga0114129_107040101	172
34	3300009147	Ga0114129_11444065	Ga0114129_114440651	172
35	3300010375	Ga0105239_10000201	Ga0105239_1000020142	172
36	3300013105	Ga0157369_11226650	Ga0157369_112266501	172
37	3300014969	Ga0157376_10292093	Ga0157376_102920931	172
38	3300025925	Ga0207650_10103252	Ga0207650_101032523	172
39	3300025934	Ga0207686_10695907	Ga0207686_106959071	172
40	3300025960	Ga0207651_10402631	Ga0207651_104026312	172
41	3300025961	Ga0207712_10415900	Ga0207712_104159002	172
42	3300025986	Ga0207658_11308286	Ga0207658_113082861	172
43	3300026078	Ga0207702_10855297	Ga0207702_108552972	172
44	3300026095	Ga0207676_10604782	Ga0207676_106047821	172
45	3300026116	Ga0207674_10031211	Ga0207674_100312112	172
46	3300026118	Ga0207675_100241190	Ga0207675_1002411902	172
47	3300027907	Ga0207428_10564835	Ga0207428_105648352	172
48	3300028016	Ga0265354_1000979	Ga0265354_10009794	172
49	3300028379	Ga0268266_11372816	Ga0268266_113728161	172
50	3300028380	Ga0268265_10422241	Ga0268265_104222412	172
51	3300030878	Ga0265770_1001203	Ga0265770_10012033	172
52	3300031090	Ga0265760_10000123	Ga0265760_1000012326	172
53	3300035117	Ga0373953_0058423	Ga0373953_0058423_980_1498	172
54	3300035118	Ga0373954_0328716	Ga0373954_0328716_221_739	172
55	3300035172	Ga0373955_0040972	Ga0373955_0040972_743_1261	172
56	3300035692	Ga0373935_0134049	Ga0373935_0134049_851_1384	172
57	3300036401	Ga0373937_0291576	Ga0373937_0291576_399_917	172
58	3300036401	Ga0373937_0682757	Ga0373937_0682757_253_816	172
59	3300041503	Ga0451847_0404847	Ga0451847_0404847_158_676	172
60	3300046463	Ga0495653_0219224	Ga0495653_0219224_421_939	172
61	3300046475	Ga0495639_0037087	Ga0495639_0037087_1270_1788	172
62	3300046511	Ga0495608_0015827	Ga0495608_0015827_4262_4780	172
63	3300046516	Ga0495628_0044139	Ga0495628_0044139_2232_2750	172
64	3300046516	Ga0495628_0073555	Ga0495628_0073555_1929_2447	172
65	3300046536	Ga0495587_0325519	Ga0495587_0325519_278_796	172
66	3300046537	Ga0495598_0009450	Ga0495598_0009450_1318_1860	172
67	3300046559	Ga0495667_0134743	Ga0495667_0134743_440_958	172
68	3300046675	Ga0495657_0020173	Ga0495657_0020173_2090_2608	172
69	3300046678	Ga0495599_0370501	Ga0495599_0370501_244_762	172
70	3300047315	Ga0495581_0010420	Ga0495581_0010420_2311_2874	172
71	3300047322	Ga0495680_0049649	Ga0495680_0049649_2403_2921	172
72	3300047444	Ga0495675_0005380	Ga0495675_0005380_2459_2977	172
73	3300048908	Ga0496105_0000794	Ga0496105_0000794_4973_5491	172
74	3300048920	Ga0496117_0039708	Ga0496117_0039708_1489_2007	172
75	3300048921	Ga0496118_0001721	Ga0496118_0001721_25937_26455	172
76	3300048922	Ga0496119_0000844	Ga0496119_0000844_29350_29868	172
77	3300048923	Ga0496120_0000110	Ga0496120_0000110_135268_135786	172
78	3300050507	nmdc:mga05p37_13046_c1	nmdc:mga05p37_13046_c1_8989_9588	172
79	3300050507	nmdc:mga05p37_238713_c1	nmdc:mga05p37_238713_c1_1555_2073	172
80	3300050507	nmdc:mga05p37_956243_c1	nmdc:mga05p37_956243_c1_327_869	172
81	3300050508	nmdc:mga09592_537708_c1	nmdc:mga09592_537708_c1_304_822	172
82	3300050509	nmdc:mga0qj67_7450_c1	nmdc:mga0qj67_7450_c1_2927_3445	172
83	3300050510	nmdc:mga06r32_42508_c1	nmdc:mga06r32_42508_c1_1910_2428	172
84	3300050510	nmdc:mga06r32_76428_c1	nmdc:mga06r32_76428_c1_941_1483	172
85	3300050513	nmdc:mga0rr50_151400_c1	nmdc:mga0rr50_151400_c1_836_1354	172
86	3300050515	nmdc:mga0a205_133020_c1	nmdc:mga0a205_133020_c1_295_813	172
87	3300050515	nmdc:mga0a205_5155_c1	nmdc:mga0a205_5155_c1_3109_3708	172
88	3300050515	nmdc:mga0a205_97613_c1	nmdc:mga0a205_97613_c1_1418_1960	172
89	3300053077	Ga0495601_0074028	Ga0495601_0074028_579_1097	172
90	3300001977	JGI24746J21847_1028510	JGI24746J21847_10285102	173
91	3300002737	JGI25162J39368_1001466	JGI25162J39368_10014669	173
92	3300002741	JGI25157J39369_1002051	JGI25157J39369_10020515	173
93	3300002772	JGI25164J39214_1000365	JGI25164J39214_100036512	173
94	3300003214	JGI25165J46597_1002492	JGI25165J46597_10024923	173
95	3300003323	rootH1_10367189	rootH1_103671892	173
96	3300003760	Ga0055527_1000033	Ga0055527_100003328	173
97	3300003761	Ga0055535_1000059	Ga0055535_100005982	173
98	3300003761	Ga0055535_1000277	Ga0055535_100027739	173
99	3300003762	Ga0055542_1000075	Ga0055542_100007570	173
100	3300003762	Ga0055542_1000086	Ga0055542_100008614	173
101	3300003763	Ga0055529_1000212	Ga0055529_100021214	173
102	3300003763	Ga0055529_1001044	Ga0055529_100104410	173
103	3300003763	Ga0055529_1002415	Ga0055529_10024152	173
104	3300005290	Ga0065712_10068087	Ga0065712_100680879	173
105	3300005293	Ga0065715_10008571	Ga0065715_100085715	173
106	3300005293	Ga0065715_10239429	Ga0065715_102394292	173
107	3300005295	Ga0065707_10019414	Ga0065707_100194143	173
108	3300005295	Ga0065707_10448130	Ga0065707_104481302	173
109	3300005328	Ga0070676_10028997	Ga0070676_100289975	173
110	3300005328	Ga0070676_10253986	Ga0070676_102539861	173
111	3300005329	Ga0070683_100333711	Ga0070683_1003337111	173
112	3300005330	Ga0070690_100088510	Ga0070690_1000885103	173
113	3300005331	Ga0070670_100070088	Ga0070670_1000700882	173
114	3300005331	Ga0070670_100103144	Ga0070670_1001031443	173
115	3300005335	Ga0070666_10036005	Ga0070666_100360055	173
116	3300005335	Ga0070666_10063932	Ga0070666_100639323	173
117	3300005337	Ga0070682_100008016	Ga0070682_1000080162	173
118	3300005340	Ga0070689_100012107	Ga0070689_10001210710	173
119	3300005340	Ga0070689_100215704	Ga0070689_1002157043	173
120	3300005340	Ga0070689_100426031	Ga0070689_1004260312	173
121	3300005341	Ga0070691_10461025	Ga0070691_104610251	173
122	3300005343	Ga0070687_100008417	Ga0070687_1000084173	173
123	3300005343	Ga0070687_100210505	Ga0070687_1002105051	173
124	3300005344	Ga0070661_100168636	Ga0070661_1001686362	173
125	3300005344	Ga0070661_100202695	Ga0070661_1002026952	173
126	3300005345	Ga0070692_10150131	Ga0070692_101501312	173
127	3300005345	Ga0070692_10179208	Ga0070692_101792082	173
128	3300005347	Ga0070668_100095005	Ga0070668_1000950051	173
129	3300005353	Ga0070669_100114149	Ga0070669_1001141493	173
130	3300005353	Ga0070669_100470472	Ga0070669_1004704722	173
131	3300005354	Ga0070675_100000520	Ga0070675_10000052023	173
132	3300005354	Ga0070675_100038597	Ga0070675_1000385975	173
133	3300005354	Ga0070675_100056634	Ga0070675_1000566341	173
134	3300005354	Ga0070675_100385350	Ga0070675_1003853502	173
135	3300005354	Ga0070675_100452231	Ga0070675_1004522312	173
136	3300005354	Ga0070675_100731238	Ga0070675_1007312382	173
137	3300005354	Ga0070675_100954910	Ga0070675_1009549101	173
138	3300005355	Ga0070671_100133398	Ga0070671_1001333982	173
139	3300005356	Ga0070674_100408167	Ga0070674_1004081672	173
140	3300005364	Ga0070673_100038333	Ga0070673_1000383332	173
141	3300005364	Ga0070673_100601579	Ga0070673_1006015792	173
142	3300005364	Ga0070673_100636734	Ga0070673_1006367342	173
143	3300005365	Ga0070688_100013160	Ga0070688_1000131603	173
144	3300005365	Ga0070688_100043173	Ga0070688_1000431733	173
145	3300005366	Ga0070659_100150010	Ga0070659_1001500103	173
146	3300005366	Ga0070659_100230052	Ga0070659_1002300522	173
147	3300005366	Ga0070659_100739200	Ga0070659_1007392001	173
148	3300005366	Ga0070659_100811870	Ga0070659_1008118701	173
149	3300005436	Ga0070713_100136811	Ga0070713_1001368112	173
150	3300005438	Ga0070701_10078904	Ga0070701_100789042	173
151	3300005438	Ga0070701_10142676	Ga0070701_101426761	173
152	3300005438	Ga0070701_10170664	Ga0070701_101706641	173
153	3300005438	Ga0070701_10457437	Ga0070701_104574372	173
154	3300005439	Ga0070711_100010323	Ga0070711_1000103232	173
155	3300005440	Ga0070705_100026073	Ga0070705_1000260732	173
156	3300005440	Ga0070705_100088514	Ga0070705_1000885142	173
157	3300005440	Ga0070705_100713532	Ga0070705_1007135321	173
158	3300005440	Ga0070705_101113033	Ga0070705_1011130331	173
159	3300005441	Ga0070700_100436434	Ga0070700_1004364342	173
160	3300005441	Ga0070700_100469426	Ga0070700_1004694262	173
161	3300005444	Ga0070694_100250117	Ga0070694_1002501172	173
162	3300005444	Ga0070694_100660911	Ga0070694_1006609111	173
163	3300005445	Ga0070708_100232617	Ga0070708_1002326172	173
164	3300005445	Ga0070708_100529146	Ga0070708_1005291461	173
165	3300005445	Ga0070708_101279105	Ga0070708_1012791051	173
166	3300005455	Ga0070663_100059933	Ga0070663_1000599332	173
167	3300005456	Ga0070678_100223758	Ga0070678_1002237582	173
168	3300005456	Ga0070678_100402251	Ga0070678_1004022512	173
169	3300005456	Ga0070678_100518685	Ga0070678_1005186851	173
170	3300005457	Ga0070662_100010573	Ga0070662_1000105739	173
171	3300005457	Ga0070662_100092329	Ga0070662_1000923294	173
172	3300005457	Ga0070662_100161406	Ga0070662_1001614062	173
173	3300005457	Ga0070662_100432992	Ga0070662_1004329922	173
174	3300005457	Ga0070662_100593575	Ga0070662_1005935752	173
175	3300005458	Ga0070681_10095126	Ga0070681_100951262	173
176	3300005458	Ga0070681_11051018	Ga0070681_110510182	173
177	3300005459	Ga0068867_100296096	Ga0068867_1002960962	173
178	3300005466	Ga0070685_10017535	Ga0070685_100175352	173
179	3300005466	Ga0070685_10028285	Ga0070685_100282855	173
180	3300005467	Ga0070706_101008566	Ga0070706_1010085661	173
181	3300005468	Ga0070707_100033159	Ga0070707_1000331596	173
182	3300005468	Ga0070707_100050931	Ga0070707_1000509313	173
183	3300005468	Ga0070707_100239215	Ga0070707_1002392153	173
184	3300005468	Ga0070707_100781379	Ga0070707_1007813791	173
185	3300005471	Ga0070698_100000929	Ga0070698_10000092919	173
186	3300005471	Ga0070698_100025554	Ga0070698_1000255543	173
187	3300005471	Ga0070698_100586095	Ga0070698_1005860952	173
188	3300005471	Ga0070698_101190590	Ga0070698_1011905901	173
189	3300005518	Ga0070699_100002294	Ga0070699_10000229410	173
190	3300005536	Ga0070697_100212373	Ga0070697_1002123732	173
191	3300005536	Ga0070697_100303010	Ga0070697_1003030102	173
192	3300005539	Ga0068853_100600564	Ga0068853_1006005641	173
193	3300005539	Ga0068853_100994935	Ga0068853_1009949351	173
194	3300005543	Ga0070672_100059439	Ga0070672_1000594392	173
195	3300005543	Ga0070672_100186726	Ga0070672_1001867261	173
196	3300005544	Ga0070686_100001296	Ga0070686_10000129610	173
197	3300005544	Ga0070686_100376530	Ga0070686_1003765302	173
198	3300005544	Ga0070686_100570225	Ga0070686_1005702252	173
199	3300005545	Ga0070695_100220556	Ga0070695_1002205561	173
200	3300005546	Ga0070696_100023093	Ga0070696_1000230933	173
201	3300005546	Ga0070696_100076304	Ga0070696_1000763042	173
202	3300005546	Ga0070696_100519811	Ga0070696_1005198112	173
203	3300005546	Ga0070696_100523043	Ga0070696_1005230432	173
204	3300005547	Ga0070693_100422069	Ga0070693_1004220691	173
205	3300005548	Ga0070665_100212571	Ga0070665_1002125713	173
206	3300005548	Ga0070665_101246590	Ga0070665_1012465901	173
207	3300005549	Ga0070704_100018415	Ga0070704_1000184154	173
208	3300005549	Ga0070704_100105789	Ga0070704_1001057892	173
209	3300005549	Ga0070704_100367394	Ga0070704_1003673942	173
210	3300005563	Ga0068855_100777867	Ga0068855_1007778672	173
211	3300005564	Ga0070664_100082162	Ga0070664_1000821622	173
212	3300005564	Ga0070664_100091589	Ga0070664_1000915893	173
213	3300005564	Ga0070664_100231469	Ga0070664_1002314692	173
214	3300005564	Ga0070664_100251235	Ga0070664_1002512352	173
215	3300005578	Ga0068854_100274222	Ga0068854_1002742222	173
216	3300005578	Ga0068854_100679042	Ga0068854_1006790422	173
217	3300005614	Ga0068856_101042260	Ga0068856_1010422601	173
218	3300005615	Ga0070702_100126339	Ga0070702_1001263392	173
219	3300005615	Ga0070702_100460262	Ga0070702_1004602622	173
220	3300005615	Ga0070702_100681459	Ga0070702_1006814591	173
221	3300005616	Ga0068852_100538726	Ga0068852_1005387262	173
222	3300005617	Ga0068859_100185573	Ga0068859_1001855734	173
223	3300005617	Ga0068859_100281404	Ga0068859_1002814041	173
224	3300005617	Ga0068859_100428310	Ga0068859_1004283101	173
225	3300005617	Ga0068859_101289559	Ga0068859_1012895591	173
226	3300005618	Ga0068864_100282846	Ga0068864_1002828463	173
227	3300005718	Ga0068866_10445467	Ga0068866_104454671	173
228	3300005719	Ga0068861_100165541	Ga0068861_1001655413	173
229	3300005719	Ga0068861_100233336	Ga0068861_1002333363	173
230	3300005719	Ga0068861_100284471	Ga0068861_1002844711	173
231	3300005719	Ga0068861_100299108	Ga0068861_1002991082	173
232	3300005719	Ga0068861_100908945	Ga0068861_1009089452	173
233	3300005719	Ga0068861_101251169	Ga0068861_1012511692	173
234	3300005840	Ga0068870_10000249	Ga0068870_100002495	173
235	3300005840	Ga0068870_10156684	Ga0068870_101566842	173
236	3300005840	Ga0068870_10344523	Ga0068870_103445232	173
237	3300005840	Ga0068870_10477340	Ga0068870_104773402	173
238	3300005841	Ga0068863_100632231	Ga0068863_1006322312	173
239	3300005841	Ga0068863_100814008	Ga0068863_1008140083	173
240	3300005842	Ga0068858_100023389	Ga0068858_1000233897	173
241	3300005842	Ga0068858_100498666	Ga0068858_1004986662	173
242	3300005843	Ga0068860_100043521	Ga0068860_1000435216	173
243	3300005843	Ga0068860_100886073	Ga0068860_1008860732	173
244	3300005844	Ga0068862_100075544	Ga0068862_1000755443	173
245	3300005844	Ga0068862_100177191	Ga0068862_1001771912	173
246	3300005844	Ga0068862_100186058	Ga0068862_1001860581	173
247	3300005844	Ga0068862_100297246	Ga0068862_1002972461	173
248	3300005844	Ga0068862_100576664	Ga0068862_1005766642	173
249	3300005844	Ga0068862_100576970	Ga0068862_1005769702	173
250	3300005844	Ga0068862_101702815	Ga0068862_1017028151	173
251	3300006028	Ga0070717_10564931	Ga0070717_105649312	173
252	3300006058	Ga0075432_10055145	Ga0075432_100551453	173
253	3300006173	Ga0070716_100294293	Ga0070716_1002942931	173
254	3300006175	Ga0070712_100029406	Ga0070712_1000294062	173
255	3300006178	Ga0075367_10000261	Ga0075367_100002612	173
256	3300006237	Ga0097621_100345924	Ga0097621_1003459242	173
257	3300006358	Ga0068871_100716324	Ga0068871_1007163242	173
258	3300006358	Ga0068871_100775340	Ga0068871_1007753401	173
259	3300006844	Ga0075428_100007143	Ga0075428_1000071433	173
260	3300006844	Ga0075428_100042578	Ga0075428_1000425788	173
261	3300006844	Ga0075428_100099064	Ga0075428_1000990642	173
262	3300006844	Ga0075428_100150158	Ga0075428_1001501583	173
263	3300006844	Ga0075428_100207601	Ga0075428_1002076013	173
264	3300006844	Ga0075428_100247478	Ga0075428_1002474782	173
265	3300006844	Ga0075428_100702074	Ga0075428_1007020742	173
266	3300006846	Ga0075430_100002372	Ga0075430_1000023726	173
267	3300006846	Ga0075430_100014064	Ga0075430_1000140649	173
268	3300006846	Ga0075430_100064510	Ga0075430_1000645102	173
269	3300006847	Ga0075431_100002523	Ga0075431_1000025235	173
270	3300006847	Ga0075431_100383047	Ga0075431_1003830472	173
271	3300006852	Ga0075433_10179868	Ga0075433_101798682	173
272	3300006852	Ga0075433_10476870	Ga0075433_104768701	173
273	3300006871	Ga0075434_100076152	Ga0075434_1000761526	173
274	3300006871	Ga0075434_100664792	Ga0075434_1006647922	173
275	3300006871	Ga0075434_101129013	Ga0075434_1011290131	173
276	3300006880	Ga0075429_100013119	Ga0075429_1000131196	173
277	3300006880	Ga0075429_100018704	Ga0075429_1000187045	173
278	3300006880	Ga0075429_100119717	Ga0075429_1001197174	173
279	3300006880	Ga0075429_100324381	Ga0075429_1003243812	173
280	3300006880	Ga0075429_100428793	Ga0075429_1004287932	173
281	3300006881	Ga0068865_100065439	Ga0068865_1000654392	173
282	3300006881	Ga0068865_100133231	Ga0068865_1001332311	173
283	3300006914	Ga0075436_100000197	Ga0075436_10000019713	173
284	3300006914	Ga0075436_100004897	Ga0075436_10000489713	173
285	3300006931	Ga0097620_100185573	Ga0097620_1001855732	173
286	3300006931	Ga0097620_100281398	Ga0097620_1002813984	173
287	3300006931	Ga0097620_100428300	Ga0097620_1004283001	173
288	3300006931	Ga0097620_101289768	Ga0097620_1012897681	173
289	3300007076	Ga0075435_100020782	Ga0075435_1000207826	173
290	3300009094	Ga0111539_10000233	Ga0111539_1000023358	173
291	3300009094	Ga0111539_10017187	Ga0111539_100171875	173
292	3300009094	Ga0111539_10046765	Ga0111539_100467653	173
293	3300009094	Ga0111539_10385041	Ga0111539_103850412	173
294	3300009094	Ga0111539_10468389	Ga0111539_104683893	173
295	3300009094	Ga0111539_10972197	Ga0111539_109721971	173
296	3300009098	Ga0105245_10519429	Ga0105245_105194293	173
297	3300009147	Ga0114129_10027666	Ga0114129_100276665	173
298	3300009147	Ga0114129_10030273	Ga0114129_100302734	173
299	3300009147	Ga0114129_10071559	Ga0114129_100715598	173
300	3300009147	Ga0114129_10095292	Ga0114129_100952923	173
301	3300009147	Ga0114129_10273217	Ga0114129_102732175	173
302	3300009147	Ga0114129_10379823	Ga0114129_103798231	173
303	3300009148	Ga0105243_10173443	Ga0105243_101734432	173
304	3300009148	Ga0105243_11078165	Ga0105243_110781651	173
305	3300009174	Ga0105241_10064885	Ga0105241_100648855	173
306	3300009174	Ga0105241_10472338	Ga0105241_104723382	173
307	3300009176	Ga0105242_11259207	Ga0105242_112592071	173
308	3300009177	Ga0105248_10018181	Ga0105248_100181816	173
309	3300009177	Ga0105248_10025679	Ga0105248_100256796	173
310	3300009177	Ga0105248_10105277	Ga0105248_101052775	173
311	3300009177	Ga0105248_10167459	Ga0105248_101674592	173
312	3300009177	Ga0105248_11000140	Ga0105248_110001401	173
313	3300009177	Ga0105248_11100739	Ga0105248_111007392	173
314	3300009177	Ga0105248_11889403	Ga0105248_118894031	173
315	3300009177	Ga0105248_11983812	Ga0105248_119838121	173
316	3300009553	Ga0105249_10228269	Ga0105249_102282691	173
317	3300009553	Ga0105249_10441489	Ga0105249_104414892	173
318	3300009553	Ga0105249_11595613	Ga0105249_115956131	173
319	3300010375	Ga0105239_10171889	Ga0105239_101718894	173
320	3300010375	Ga0105239_11825839	Ga0105239_118258391	173
321	3300011119	Ga0105246_10381974	Ga0105246_103819742	173
322	3300011119	Ga0105246_11498252	Ga0105246_114982521	173
323	3300013100	Ga0157373_10174344	Ga0157373_101743442	173
324	3300013104	Ga0157370_10189379	Ga0157370_101893793	173
325	3300013297	Ga0157378_10015334	Ga0157378_100153344	173
326	3300013297	Ga0157378_10058796	Ga0157378_100587963	173
327	3300013306	Ga0163162_10044077	Ga0163162_100440772	173
328	3300013306	Ga0163162_10211481	Ga0163162_102114813	173
329	3300013306	Ga0163162_10222570	Ga0163162_102225704	173
330	3300013306	Ga0163162_10291222	Ga0163162_102912223	173
331	3300013306	Ga0163162_12428982	Ga0163162_124289821	173
332	3300013308	Ga0157375_10256122	Ga0157375_102561222	173
333	3300013308	Ga0157375_10281388	Ga0157375_102813882	173
334	3300013308	Ga0157375_10290749	Ga0157375_102907492	173
335	3300013308	Ga0157375_10970699	Ga0157375_109706992	173
336	3300013308	Ga0157375_11135158	Ga0157375_111351581	173
337	3300013308	Ga0157375_11190666	Ga0157375_111906662	173
338	3300013308	Ga0157375_12380388	Ga0157375_123803881	173
339	3300014325	Ga0163163_10003283	Ga0163163_100032833	173
340	3300014325	Ga0163163_10102023	Ga0163163_101020232	173
341	3300014325	Ga0163163_10312836	Ga0163163_103128362	173
342	3300014325	Ga0163163_10449745	Ga0163163_104497451	173
343	3300014326	Ga0157380_10085480	Ga0157380_100854802	173
344	3300014326	Ga0157380_10150190	Ga0157380_101501903	173
345	3300014326	Ga0157380_10191082	Ga0157380_101910822	173
346	3300014326	Ga0157380_10242800	Ga0157380_102428001	173
347	3300014326	Ga0157380_11518049	Ga0157380_115180491	173
348	3300014497	Ga0182008_10101864	Ga0182008_101018643	173
349	3300014745	Ga0157377_10060476	Ga0157377_100604764	173
350	3300014745	Ga0157377_10093324	Ga0157377_100933244	173
351	3300014968	Ga0157379_10089904	Ga0157379_100899042	173
352	3300014968	Ga0157379_10188084	Ga0157379_101880842	173
353	3300014969	Ga0157376_10079146	Ga0157376_100791462	173
354	3300015261	Ga0182006_1072229	Ga0182006_10722292	173
355	3300015262	Ga0182007_10079757	Ga0182007_100797572	173
356	3300025228	Ga0209672_100004	Ga0209672_10000470	173
357	3300025228	Ga0209672_100074	Ga0209672_10007414	173
358	3300025230	Ga0209563_100028	Ga0209563_100028129	173
359	3300025231	Ga0207427_100147	Ga0207427_10014712	173
360	3300025233	Ga0209437_100005	Ga0209437_100005810	173
361	3300025242	Ga0209258_100003	Ga0209258_10000370	173
362	3300025242	Ga0209258_100004	Ga0209258_1000041154	173
363	3300025242	Ga0209258_100008	Ga0209258_100008779	173
364	3300025246	Ga0209646_1002701	Ga0209646_10027012	173
365	3300025250	Ga0209026_1000181	Ga0209026_100018181	173
366	3300025250	Ga0209026_1002498	Ga0209026_10024986	173
367	3300025254	Ga0209148_1000016	Ga0209148_100001670	173
368	3300025254	Ga0209148_1000041	Ga0209148_1000041281	173
369	3300025256	Ga0209759_1002424	Ga0209759_10024247	173
370	3300025261	Ga0209233_1000011	Ga0209233_1000011132	173
371	3300025272	Ga0209455_1000004	Ga0209455_100000470	173
372	3300025272	Ga0209455_1000007	Ga0209455_1000007899	173
373	3300025272	Ga0209455_1000216	Ga0209455_100021637	173
374	3300025315	Ga0207697_10070683	Ga0207697_100706833	173
375	3300025885	Ga0207653_10065547	Ga0207653_100655472	173
376	3300025893	Ga0207682_10041005	Ga0207682_100410052	173
377	3300025899	Ga0207642_10630431	Ga0207642_106304312	173
378	3300025900	Ga0207710_10385516	Ga0207710_103855161	173
379	3300025903	Ga0207680_10008576	Ga0207680_100085765	173
380	3300025904	Ga0207647_10072138	Ga0207647_100721381	173
381	3300025906	Ga0207699_10537480	Ga0207699_105374801	173
382	3300025907	Ga0207645_10137634	Ga0207645_101376342	173
383	3300025908	Ga0207643_10005422	Ga0207643_100054226	173
384	3300025908	Ga0207643_10145108	Ga0207643_101451082	173
385	3300025909	Ga0207705_10120413	Ga0207705_101204133	173
386	3300025910	Ga0207684_10480124	Ga0207684_104801241	173
387	3300025911	Ga0207654_10490589	Ga0207654_104905892	173
388	3300025911	Ga0207654_10645698	Ga0207654_106456981	173
389	3300025915	Ga0207693_10002012	Ga0207693_100020122	173
390	3300025916	Ga0207663_10032306	Ga0207663_100323062	173
391	3300025918	Ga0207662_10011574	Ga0207662_100115746	173
392	3300025918	Ga0207662_10128328	Ga0207662_101283282	173
393	3300025920	Ga0207649_10744044	Ga0207649_107440441	173
394	3300025922	Ga0207646_10008700	Ga0207646_1000870017	173
395	3300025922	Ga0207646_10016030	Ga0207646_100160308	173
396	3300025923	Ga0207681_10021792	Ga0207681_100217925	173
397	3300025923	Ga0207681_10059782	Ga0207681_100597823	173
398	3300025923	Ga0207681_10300250	Ga0207681_103002502	173
399	3300025923	Ga0207681_10979626	Ga0207681_109796261	173
400	3300025924	Ga0207694_10793838	Ga0207694_107938382	173
401	3300025925	Ga0207650_10048788	Ga0207650_100487882	173
402	3300025925	Ga0207650_10209159	Ga0207650_102091592	173
403	3300025926	Ga0207659_10004681	Ga0207659_100046816	173
404	3300025926	Ga0207659_10043328	Ga0207659_100433285	173
405	3300025926	Ga0207659_10286303	Ga0207659_102863032	173
406	3300025926	Ga0207659_10643510	Ga0207659_106435101	173
407	3300025928	Ga0207700_10399405	Ga0207700_103994052	173
408	3300025928	Ga0207700_11057111	Ga0207700_110571112	173
409	3300025931	Ga0207644_10107229	Ga0207644_101072292	173
410	3300025932	Ga0207690_10342179	Ga0207690_103421792	173
411	3300025933	Ga0207706_10055624	Ga0207706_100556242	173
412	3300025933	Ga0207706_10055838	Ga0207706_100558383	173
413	3300025933	Ga0207706_10221138	Ga0207706_102211383	173
414	3300025933	Ga0207706_10375772	Ga0207706_103757722	173
415	3300025933	Ga0207706_10413165	Ga0207706_104131651	173
416	3300025933	Ga0207706_10584361	Ga0207706_105843612	173
417	3300025935	Ga0207709_10107275	Ga0207709_101072752	173
418	3300025936	Ga0207670_10147875	Ga0207670_101478752	173
419	3300025936	Ga0207670_10240973	Ga0207670_102409731	173
420	3300025936	Ga0207670_10314050	Ga0207670_103140502	173
421	3300025938	Ga0207704_10321626	Ga0207704_103216262	173
422	3300025940	Ga0207691_10264559	Ga0207691_102645592	173
423	3300025940	Ga0207691_10273473	Ga0207691_102734733	173
424	3300025940	Ga0207691_10397650	Ga0207691_103976501	173
425	3300025941	Ga0207711_10008993	Ga0207711_100089935	173
426	3300025941	Ga0207711_10091990	Ga0207711_100919903	173
427	3300025941	Ga0207711_10126152	Ga0207711_101261523	173
428	3300025941	Ga0207711_10330047	Ga0207711_103300473	173
429	3300025941	Ga0207711_10700086	Ga0207711_107000862	173
430	3300025942	Ga0207689_10004330	Ga0207689_100043305	173
431	3300025942	Ga0207689_10164958	Ga0207689_101649582	173
432	3300025942	Ga0207689_10215290	Ga0207689_102152902	173
433	3300025945	Ga0207679_10961311	Ga0207679_109613111	173
434	3300025949	Ga0207667_10468096	Ga0207667_104680962	173
435	3300025960	Ga0207651_10213043	Ga0207651_102130432	173
436	3300025960	Ga0207651_10320944	Ga0207651_103209442	173
437	3300025960	Ga0207651_10504797	Ga0207651_105047972	173
438	3300025960	Ga0207651_11492639	Ga0207651_114926391	173
439	3300025961	Ga0207712_10100188	Ga0207712_101001882	173
440	3300025961	Ga0207712_10414288	Ga0207712_104142882	173
441	3300025972	Ga0207668_10246683	Ga0207668_102466833	173
442	3300025981	Ga0207640_10057229	Ga0207640_100572292	173
443	3300025981	Ga0207640_10377896	Ga0207640_103778962	173
444	3300026023	Ga0207677_11305711	Ga0207677_113057111	173
445	3300026035	Ga0207703_10128059	Ga0207703_101280592	173
446	3300026035	Ga0207703_10464256	Ga0207703_104642562	173
447	3300026041	Ga0207639_10597802	Ga0207639_105978021	173
448	3300026041	Ga0207639_11110097	Ga0207639_111100971	173
449	3300026067	Ga0207678_10017862	Ga0207678_100178622	173
450	3300026075	Ga0207708_10075294	Ga0207708_100752943	173
451	3300026075	Ga0207708_10145475	Ga0207708_101454752	173
452	3300026075	Ga0207708_10232444	Ga0207708_102324442	173
453	3300026075	Ga0207708_10303443	Ga0207708_103034432	173
454	3300026075	Ga0207708_10467794	Ga0207708_104677942	173
455	3300026078	Ga0207702_10007263	Ga0207702_100072638	173
456	3300026078	Ga0207702_11364508	Ga0207702_113645082	173
457	3300026088	Ga0207641_10606930	Ga0207641_106069302	173
458	3300026089	Ga0207648_10049521	Ga0207648_100495215	173
459	3300026089	Ga0207648_10091908	Ga0207648_100919085	173
460	3300026089	Ga0207648_10289119	Ga0207648_102891192	173
461	3300026095	Ga0207676_10154580	Ga0207676_101545802	173
462	3300026116	Ga0207674_10268692	Ga0207674_102686923	173
463	3300026118	Ga0207675_100066239	Ga0207675_1000662395	173
464	3300026118	Ga0207675_100343900	Ga0207675_1003439001	173
465	3300026118	Ga0207675_100954521	Ga0207675_1009545212	173
466	3300026121	Ga0207683_10606173	Ga0207683_106061732	173
467	3300026121	Ga0207683_10751427	Ga0207683_107514272	173
468	3300027682	Ga0209971_1005020	Ga0209971_10050206	173
469	3300027717	Ga0209998_10106130	Ga0209998_101061301	173
470	3300027907	Ga0207428_10021179	Ga0207428_100211795	173
471	3300027907	Ga0207428_10122627	Ga0207428_101226272	173
472	3300028379	Ga0268266_10894045	Ga0268266_108940451	173
473	3300028380	Ga0268265_10183725	Ga0268265_101837252	173
474	3300028380	Ga0268265_10207606	Ga0268265_102076062	173
475	3300028380	Ga0268265_10407726	Ga0268265_104077261	173
476	3300028380	Ga0268265_10408630	Ga0268265_104086302	173
477	3300028380	Ga0268265_10989556	Ga0268265_109895561	173
478	3300028380	Ga0268265_11100980	Ga0268265_111009802	173
479	3300028381	Ga0268264_10246529	Ga0268264_102465292	173
480	3300031090	Ga0265760_10070554	Ga0265760_100705542	173
481	3300031548	Ga0307408_100065970	Ga0307408_1000659702	173
482	3300031548	Ga0307408_100375875	Ga0307408_1003758752	173
483	3300031731	Ga0307405_10530883	Ga0307405_105308832	173
484	3300031852	Ga0307410_10189962	Ga0307410_101899623	173
485	3300031901	Ga0307406_10389195	Ga0307406_103891952	173
486	3300031911	Ga0307412_10206112	Ga0307412_102061122	173
487	3300031911	Ga0307412_10240560	Ga0307412_102405603	173
488	3300031995	Ga0307409_100239936	Ga0307409_1002399362	173
489	3300032002	Ga0307416_100549933	Ga0307416_1005499332	173
490	3300032005	Ga0307411_10366037	Ga0307411_103660372	173
491	3300035086	Ga0373934_0030347	Ga0373934_0030347_1355_1879	173
492	3300035121	Ga0373960_0021531	Ga0373960_0021531_1154_1675	173
493	3300035241	Ga0373961_0148361	Ga0373961_0148361_189_710	173
494	3300035691	Ga0373931_0079450	Ga0373931_0079450_1265_1786	173
495	3300035691	Ga0373931_0177708	Ga0373931_0177708_337_858	173
496	3300035724	Ga0373933_0050634	Ga0373933_0050634_1785_2309	173
497	3300036401	Ga0373937_0134589	Ga0373937_0134589_912_1436	173
498	3300036401	Ga0373937_0300547	Ga0373937_0300547_508_1029	173
499	3300037068	Ga0373925_0733205	Ga0373925_0733205_19_540	173
500	3300038443	Ga0395901_0370725	Ga0395901_0370725_106_666	173
501	3300042000	Ga0439437_004156	Ga0439437_004156_935_1498	173
502	3300042435	Ga0439434_0099534	Ga0439434_0099534_182_703	173
503	3300044694	Ga0466963_0068669	Ga0466963_0068669_984_1505	173
504	3300045051	Ga0451576_0253976	Ga0451576_0253976_359_880	173
505	3300045051	Ga0451576_0312229	Ga0451576_0312229_726_1247	173
506	3300045836	Ga0466958_0012323	Ga0466958_0012323_2103_2624	173
507	3300045976	Ga0466967_0066505	Ga0466967_0066505_325_846	173
508	3300046463	Ga0495653_0195441	Ga0495653_0195441_538_1062	173
509	3300046472	Ga0495580_0574533	Ga0495580_0574533_78_599	173
510	3300046537	Ga0495598_0046108	Ga0495598_0046108_604_1143	173
511	3300046663	Ga0495635_0556271	Ga0495635_0556271_155_676	173
512	3300046675	Ga0495657_0163097	Ga0495657_0163097_709_1230	173
513	3300047318	Ga0495636_0255306	Ga0495636_0255306_160_720	173
514	3300047319	Ga0495674_0104871	Ga0495674_0104871_1332_1853	173
515	3300047471	Ga0495684_0481781	Ga0495684_0481781_225_746	173
516	3300048905	Ga0496102_0055287	Ga0496102_0055287_682_1221	173
517	3300048909	Ga0496106_0606757	Ga0496106_0606757_53_574	173
518	3300048911	Ga0496108_0057469	Ga0496108_0057469_2212_2733	173
519	3300048917	Ga0496114_1018265	Ga0496114_1018265_163_684	173
520	3300049583	Ga0501067_0089581	Ga0501067_0089581_90_611	173
521	3300049768	Ga0501271_023865	Ga0501271_023865_115_636	173
522	3300050493	nmdc:mga0k408_297689_c1	nmdc:mga0k408_297689_c1_77_664	173
523	3300050494	nmdc:mga06z11_89460_c1	nmdc:mga06z11_89460_c1_374_895	173
524	3300050507	nmdc:mga05p37_41132_c1	nmdc:mga05p37_41132_c1_90_611	173
525	3300050507	nmdc:mga05p37_440717_c1	nmdc:mga05p37_440717_c1_429_950	173
526	3300050507	nmdc:mga05p37_853868_c1	nmdc:mga05p37_853868_c1_205_726	173
527	3300050508	nmdc:mga09592_16759_c1	nmdc:mga09592_16759_c1_171_692	173
528	3300050508	nmdc:mga09592_450554_c1	nmdc:mga09592_450554_c1_101_637	173
529	3300050508	nmdc:mga09592_499680_c1	nmdc:mga09592_499680_c1_205_726	173
530	3300050508	nmdc:mga09592_55136_c1	nmdc:mga09592_55136_c1_1077_1598	173
531	3300050509	nmdc:mga0qj67_33580_c1	nmdc:mga0qj67_33580_c1_2635_3156	173
532	3300050509	nmdc:mga0qj67_67648_c1	nmdc:mga0qj67_67648_c1_712_1269	173
533	3300050510	nmdc:mga06r32_532205_c1	nmdc:mga06r32_532205_c1_300_857	173
534	3300050510	nmdc:mga06r32_72598_c1	nmdc:mga06r32_72598_c1_2366_2887	173
535	3300050511	nmdc:mga08y16_1696503_c1	nmdc:mga08y16_1696503_c1_18_539	173
536	3300050511	nmdc:mga08y16_18995_c1	nmdc:mga08y16_18995_c1_395_967	173
537	3300050511	nmdc:mga08y16_526986_c1	nmdc:mga08y16_526986_c1_143_715	173
538	3300050511	nmdc:mga08y16_74460_c1	nmdc:mga08y16_74460_c1_1390_1911	173
539	3300050511	nmdc:mga08y16_87630_c1	nmdc:mga08y16_87630_c1_2030_2551	173
540	3300050511	nmdc:mga08y16_98713_c1	nmdc:mga08y16_98713_c1_2025_2546	173
541	3300050512	nmdc:mga0n895_168480_c1	nmdc:mga0n895_168480_c1_972_1544	173
542	3300050512	nmdc:mga0n895_483544_c1	nmdc:mga0n895_483544_c1_311_832	173
543	3300050512	nmdc:mga0n895_5742_c1	nmdc:mga0n895_5742_c1_611_1132	173
544	3300050512	nmdc:mga0n895_722777_c1	nmdc:mga0n895_722777_c1_244_765	173
545	3300050513	nmdc:mga0rr50_142545_c1	nmdc:mga0rr50_142545_c1_565_1086	173
546	3300050513	nmdc:mga0rr50_282175_c1	nmdc:mga0rr50_282175_c1_178_711	173
547	3300050514	nmdc:mga08x19_11_c1	nmdc:mga08x19_11_c1_192167_192688	173
548	3300050514	nmdc:mga08x19_2683_c1	nmdc:mga08x19_2683_c1_7427_7948	173
549	3300050515	nmdc:mga0a205_214924_c1	nmdc:mga0a205_214924_c1_654_1175	173
550	3300050515	nmdc:mga0a205_382709_c1	nmdc:mga0a205_382709_c1_479_1000	173
551	3300053092	Ga0500583_0153151	Ga0500583_0153151_353_874	173
552	3300053103	Ga0500555_005796	Ga0500555_005796_47_574	173
553	3300053103	Ga0500555_013701	Ga0500555_013701_593_1138	173
554	3300053730	Ga0500645_027726	Ga0500645_027726_818_1345	173
555	3300054114	Ga0501084_0012876	Ga0501084_0012876_822_1367	173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

4

165

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3ky8-assembly1.cif.gz_B	crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution	0.8386	1	173
3ky8-assembly1.cif.gz_B	crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution	0.8341	1	173
7xh2-assembly1.cif.gz_A	dihydrofolate reductase-like protein sach in safracin biosynthesis	0.7914	2	170
3jtw-assembly2.cif.gz_B-3	crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution	0.7822	2	172
1d1g-assembly1.cif.gz_B	dihydrofolate reductase from thermotoga maritima	0.7737	1	172

ID	Description	Score	Start	End	Superfamily
af_P24719_156_494_1.10.510.10	Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1	0.8404	152	169	1.10.510.10
af_Q86C56_1_188_3.90.1520.10	Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain	0.8315	149	171	3.90.1520.10
3ky8B01	Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A	0.8295	3	170	3.40.430.10
3ky8B01	Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A	0.816	3	170	3.40.430.10
af_Q59P53_422_536_3.30.70.240	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.8131	152	171	3.30.70.240

ID	Description	Score	Start	End	GO Terms
AF-A0A2V9A4V6-F1-model_v4	Deaminase	0.9375	40	173	GO:0008703 GO:0009231
AF-A0A4R8JUX7-F1-model_v4	deleted	0.9322	90	173
AF-A0A379ZM62-F1-model_v4	Dihydrofolate reductase (EC 1.5.1.3)	0.911	33	173	GO:0004146 GO:0008703 GO:0009231
AF-A0A2V7EJ54-F1-model_v4	Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein	0.9107	93	173	GO:0008703 GO:0009231
AF-A0A557SWI2-F1-model_v4	Bifunctional deaminase-reductase domain protein	0.9094	48	173	GO:0008703 GO:0009231

Feature Viewer

pLDDT	pTM	Quality
84.88	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F463104

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01872

RibD_C

RibD C-terminal domain

4

165

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map