F463077

General Info

Members Datasets Scaffolds Average Seq Length
555 269 555 379

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100005849|Ga0070706_10000584910
Length 405
Sequence MSAAGPPQGANRAPSGGSAAAPAAPVTAGYLKFAGPLLDETTIAGVDDVLRSGHIASGPWVQKFEARLSAFCGGRPVRVLTSATAAVEVALQLCGIGPGDEVITSAQSFFTVLNMIVKVGATPVFVDCDLVTRNIDLRQIEAAITPRTRAIIPTHYSGALVDMDALFALAQRHRLRVIEDAALVIGSRWKGRNVGAFGDLTTFSFHPNKNITSIEGGALVVNDDAEAKRVEALRFHGITYLPDRTRDVAFPGGKFNLPDVNARIGHDQLERLPQFLTRRRALVGRYFAKLATDPPCVLPPQPKDGDDDGHSWNMFCVLLPLDRLTISRKQFRDALEARGIATGVSYEALHLTTLGRRYGGHDGQFPNAERVSRETVTLPLHAGMTEPDVDRVCAAVAAVIAAGRK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10023833 3300005327 Bacteria 4909
2 Ga0070676_10005737 3300005328 Bacteria 6617
3 Ga0070676_10009931 3300005328 Bacteria 5153
4 Ga0070683_100026675 3300005329 Bacteria 5205
5 Ga0070690_100018294 3300005330 Bacteria 4231
6 Ga0070690_100190043 3300005330 Bacteria 1423
7 Ga0070670_100029157 3300005331 Bacteria 4749
8 Ga0070670_100039569 3300005331 Bacteria 4054
9 Ga0070670_100140288 3300005331 Bacteria 2090
10 Ga0070670_100259454 3300005331 Bacteria 1515
11 Ga0070677_10000965 3300005333 Bacteria 9288
12 Ga0068869_100000388 3300005334 Bacteria 23946
13 Ga0068869_100008272 3300005334 Bacteria 6701
14 Ga0070666_10000887 3300005335 Bacteria 18198
15 Ga0070666_10007056 3300005335 Bacteria 6923
16 Ga0070666_10056165 3300005335 Bacteria 2658
17 Ga0070666_10179563 3300005335 Bacteria 1484
18 Ga0070680_100167271 3300005336 Bacteria 1849
19 Ga0070680_100180992 3300005336 Bacteria 1775
20 Ga0068868_100003424 3300005338 Bacteria 11040
21 Ga0068868_100008218 3300005338 Bacteria 7467
22 Ga0068868_100022058 3300005338 Bacteria 4801
23 Ga0068868_100052818 3300005338 Bacteria 3199
24 Ga0070660_100021172 3300005339 Bacteria 4791
25 Ga0070689_100005389 3300005340 Bacteria 8727
26 Ga0070689_100066377 3300005340 Bacteria 2811
27 Ga0070661_100007598 3300005344 Bacteria 7477
28 Ga0070661_100008547 3300005344 Bacteria 7080
29 Ga0070692_10019262 3300005345 Bacteria 3291
30 Ga0070668_100004358 3300005347 Bacteria 10499
31 Ga0070668_100013627 3300005347 Bacteria 6070
32 Ga0070668_100019525 3300005347 Bacteria 5101
33 Ga0070668_100068530 3300005347 Bacteria 2758
34 Ga0070668_100090992 3300005347 Bacteria 2404
35 Ga0070669_100002694 3300005353 Bacteria 12804
36 Ga0070669_100117884 3300005353 Bacteria 2021
37 Ga0070675_100000476 3300005354 Bacteria 27409
38 Ga0070675_100001764 3300005354 Bacteria 15948
39 Ga0070675_100013648 3300005354 Bacteria 6390
40 Ga0070675_100090301 3300005354 Bacteria 2566
41 Ga0070671_100002250 3300005355 Bacteria 14903
42 Ga0070671_100002660 3300005355 Bacteria 13841
43 Ga0070671_100011370 3300005355 Bacteria 7156
44 Ga0070671_100021544 3300005355 Bacteria 5264
45 Ga0070674_100000409 3300005356 Bacteria 21616
46 Ga0070674_100004979 3300005356 Bacteria 7618
47 Ga0070673_100000781 3300005364 Bacteria 17709
48 Ga0070673_100001204 3300005364 Bacteria 14918
49 Ga0070673_100007406 3300005364 Bacteria 7235
50 Ga0070673_100020203 3300005364 Bacteria 4800
51 Ga0070688_100002928 3300005365 Bacteria 8705
52 Ga0070659_100008939 3300005366 Bacteria 7343
53 Ga0070659_100170020 3300005366 Bacteria 1785
54 Ga0070667_100000550 3300005367 Bacteria 37298
55 Ga0070667_100006019 3300005367 Bacteria 10080
56 Ga0070667_100017448 3300005367 Bacteria 5949
57 Ga0070667_100090872 3300005367 Bacteria 2624
58 Ga0070667_100125814 3300005367 Bacteria 2233
59 Ga0070667_100201023 3300005367 Bacteria 1768
60 Ga0070667_100223800 3300005367 Bacteria 1675
61 Ga0070714_100007199 3300005435 Bacteria 8635
62 Ga0070713_100000182 3300005436 Bacteria 41753
63 Ga0070713_100003475 3300005436 Bacteria 10398
64 Ga0070710_10012581 3300005437 Bacteria 4207
65 Ga0070711_100011287 3300005439 Bacteria 5542
66 Ga0070711_100027989 3300005439 Bacteria 3705
67 Ga0070705_100099990 3300005440 Bacteria 1829
68 Ga0070700_100027897 3300005441 Bacteria 3353
69 Ga0070708_100000207 3300005445 Bacteria 43511
70 Ga0070663_100087431 3300005455 Bacteria 2304
71 Ga0070663_100219825 3300005455 Bacteria 1491
72 Ga0070678_100000200 3300005456 Bacteria 26391
73 Ga0070678_100000560 3300005456 Bacteria 18164
74 Ga0070678_100000872 3300005456 Bacteria 15445
75 Ga0070678_100009611 3300005456 Bacteria 5871
76 Ga0070662_100038470 3300005457 Bacteria 3398
77 Ga0070662_100103595 3300005457 Bacteria 2158
78 Ga0070681_10001277 3300005458 Bacteria 21960
79 Ga0068867_100001219 3300005459 Bacteria 17696
80 Ga0068867_100001865 3300005459 Bacteria 14641
81 Ga0068867_100016645 3300005459 Bacteria 5222
82 Ga0068867_100226490 3300005459 Bacteria 1509
83 Ga0070685_10004553 3300005466 Bacteria 7019
84 Ga0070685_10112884 3300005466 Bacteria 1677
85 Ga0070706_100005849 3300005467 Bacteria 11666
86 Ga0070698_100163402 3300005471 Bacteria 2170
87 Ga0070699_100039995 3300005518 Bacteria 4061
88 Ga0070699_100210529 3300005518 Bacteria 1730
89 Ga0070679_100020307 3300005530 Bacteria 6473
90 Ga0070679_100100348 3300005530 Bacteria 2881
91 Ga0070684_100158649 3300005535 Bacteria 2051
92 Ga0070697_100024935 3300005536 Bacteria 4765
93 Ga0068853_100011739 3300005539 Bacteria 7119
94 Ga0068853_100021304 3300005539 Bacteria 5403
95 Ga0068853_100026414 3300005539 Bacteria 4875
96 Ga0070672_100006366 3300005543 Bacteria 7927
97 Ga0070672_100008331 3300005543 Bacteria 7084
98 Ga0070672_100025038 3300005543 Bacteria 4420
99 Ga0070672_100051651 3300005543 Bacteria 3207
100 Ga0070696_100013351 3300005546 Bacteria 5511
101 Ga0070696_100064866 3300005546 Bacteria 2560
102 Ga0070693_100000167 3300005547 Bacteria 30641
103 Ga0070693_100006121 3300005547 Bacteria 5829
104 Ga0070693_100082558 3300005547 Bacteria 1919
105 Ga0070693_100108596 3300005547 Bacteria 1703
106 Ga0070665_100001447 3300005548 Bacteria 27820
107 Ga0070665_100005172 3300005548 Bacteria 13499
108 Ga0070665_100025304 3300005548 Bacteria 5980
109 Ga0070665_100055050 3300005548 Bacteria 3990
110 Ga0070665_100154584 3300005548 Bacteria 2296
111 Ga0070704_100113396 3300005549 Bacteria 2067
112 Ga0068855_100011856 3300005563 Bacteria 10538
113 Ga0068855_100012552 3300005563 Bacteria 10226
114 Ga0068855_100041106 3300005563 Bacteria 5482
115 Ga0068855_100048381 3300005563 Bacteria 5018
116 Ga0068855_100126978 3300005563 Bacteria 2915
117 Ga0068855_100154592 3300005563 Bacteria 2607
118 Ga0070664_100001452 3300005564 Bacteria 18888
119 Ga0070664_100012048 3300005564 Bacteria 7024
120 Ga0070664_100161412 3300005564 Bacteria 1983
121 Ga0068857_100001623 3300005577 Bacteria 18065
122 Ga0068857_100001739 3300005577 Bacteria 17512
123 Ga0068857_100114759 3300005577 Bacteria 2423
124 Ga0068857_100181611 3300005577 Bacteria 1915
125 Ga0068854_100002132 3300005578 Bacteria 12146
126 Ga0068854_100002439 3300005578 Bacteria 11499
127 Ga0068856_100001396 3300005614 Bacteria 25298
128 Ga0068856_100006138 3300005614 Bacteria 11793
129 Ga0068856_100043206 3300005614 Bacteria 4434
130 Ga0068856_100101918 3300005614 Bacteria 2864
131 Ga0068856_100113517 3300005614 Bacteria 2707
132 Ga0068852_100001471 3300005616 Bacteria 15936
133 Ga0068852_100006246 3300005616 Bacteria 8595
134 Ga0068859_100001484 3300005617 Bacteria 23877
135 Ga0068859_100038177 3300005617 Bacteria 4819
136 Ga0068859_100502821 3300005617 Bacteria 1307
137 Ga0068864_100002372 3300005618 Bacteria 15584
138 Ga0068864_100023093 3300005618 Bacteria 5222
139 Ga0068864_100026603 3300005618 Bacteria 4879
140 Ga0068864_100149498 3300005618 Bacteria 2114
141 Ga0068866_10000527 3300005718 Bacteria 17621
142 Ga0068866_10033784 3300005718 Bacteria 2485
143 Ga0068861_100000187 3300005719 Bacteria 33035
144 Ga0068861_100159606 3300005719 Bacteria 1859
145 Ga0068851_10000301 3300005834 Bacteria 22575
146 Ga0068851_10003419 3300005834 Bacteria 7068
147 Ga0068851_10003959 3300005834 Bacteria 6632
148 Ga0068851_10010426 3300005834 Bacteria 4340
149 Ga0068870_10088432 3300005840 Bacteria 1727
150 Ga0068863_100006037 3300005841 Bacteria 11882
151 Ga0068863_100013076 3300005841 Bacteria 8006
152 Ga0068863_100019995 3300005841 Bacteria 6404
153 Ga0068863_100028429 3300005841 Bacteria 5339
154 Ga0068858_100008319 3300005842 Bacteria 9979
155 Ga0068858_100017079 3300005842 Bacteria 6811
156 Ga0068858_100017145 3300005842 Bacteria 6796
157 Ga0068858_100018888 3300005842 Bacteria 6450
158 Ga0068858_100019815 3300005842 Bacteria 6288
159 Ga0068858_100238176 3300005842 Bacteria 1726
160 Ga0068860_100002049 3300005843 Bacteria 21245
161 Ga0068860_100003430 3300005843 Bacteria 16298
162 Ga0068860_100011724 3300005843 Bacteria 8639
163 Ga0068860_100027211 3300005843 Bacteria 5509
164 Ga0068860_100056842 3300005843 Bacteria 3718
165 Ga0068860_100268368 3300005843 Bacteria 1665
166 Ga0068860_100372331 3300005843 Bacteria 1409
167 Ga0081455_10078253 3300005937 Bacteria 2717
168 Ga0070715_10005192 3300006163 Bacteria 4327
169 Ga0070716_100056439 3300006173 Bacteria 2252
170 Ga0070712_100089073 3300006175 Bacteria 2256
171 Ga0097621_100000972 3300006237 Bacteria 20078
172 Ga0097621_100009045 3300006237 Bacteria 7215
173 Ga0097621_100024835 3300006237 Bacteria 4685
174 Ga0097621_100059281 3300006237 Bacteria 3133
175 Ga0097621_100066120 3300006237 Bacteria 2977
176 Ga0097621_100066895 3300006237 Bacteria 2960
177 Ga0068871_100009526 3300006358 Bacteria 7046
178 Ga0068871_100013937 3300006358 Bacteria 5977
179 Ga0068871_100017726 3300006358 Bacteria 5396
180 Ga0068871_100044019 3300006358 Bacteria 3588
181 Ga0068871_100093173 3300006358 Bacteria 2513
182 Ga0068871_100206605 3300006358 Bacteria 1697
183 Ga0075428_100061078 3300006844 Bacteria 4126
184 Ga0075433_10088783 3300006852 Bacteria 2732
185 Ga0068865_100094791 3300006881 Bacteria 2173
186 Ga0068865_100236260 3300006881 Bacteria 1436
187 Ga0075436_100001328 3300006914 Bacteria 16813
188 Ga0075436_100035416 3300006914 Bacteria 3444
189 Ga0097620_100001484 3300006931 Bacteria 23877
190 Ga0097620_100038177 3300006931 Bacteria 4819
191 Ga0097620_100502857 3300006931 Bacteria 1307
192 Ga0075435_100114440 3300007076 Bacteria 2246
193 Ga0099795_10001771 3300007788 Bacteria 4837
194 Ga0105240_10017865 3300009093 Bacteria 9542
195 Ga0105240_10039354 3300009093 Bacteria 6056
196 Ga0105240_10104866 3300009093 Bacteria 3432
197 Ga0105240_10302062 3300009093 Bacteria 1831
198 Ga0111539_10081454 3300009094 Bacteria 3807
199 Ga0105245_10008983 3300009098 Bacteria 8716
200 Ga0105245_10012549 3300009098 Bacteria 7374
201 Ga0105245_10017694 3300009098 Bacteria 6222
202 Ga0105245_10040997 3300009098 Bacteria 4126
203 Ga0114129_10303683 3300009147 Bacteria 2126
204 Ga0105243_10154794 3300009148 Bacteria 1970
205 Ga0105241_10029877 3300009174 Bacteria 4069
206 Ga0105241_10045265 3300009174 Bacteria 3338
207 Ga0105242_10004238 3300009176 Bacteria 11181
208 Ga0105242_10056040 3300009176 Bacteria 3225
209 Ga0105242_10063186 3300009176 Bacteria 3049
210 Ga0105248_10001701 3300009177 Bacteria 24486
211 Ga0105248_10031986 3300009177 Bacteria 5878
212 Ga0105248_10203890 3300009177 Bacteria 2228
213 Ga0105237_10039323 3300009545 Bacteria 4775
214 Ga0105237_10356366 3300009545 Bacteria 1467
215 Ga0105238_10007592 3300009551 Bacteria 10864
216 Ga0105238_10008362 3300009551 Bacteria 10352
217 Ga0105238_10016683 3300009551 Bacteria 7440
218 Ga0105249_10121542 3300009553 Bacteria 2482
219 Ga0105249_10122847 3300009553 Bacteria 2470
220 Ga0105239_10178514 3300010375 Bacteria 2375
221 Ga0157373_10002952 3300013100 Bacteria 12886
222 Ga0157373_10055370 3300013100 Bacteria 2818
223 Ga0157370_10003331 3300013104 Bacteria 18930
224 Ga0157370_10005403 3300013104 Bacteria 14332
225 Ga0157370_10008356 3300013104 Bacteria 11165
226 Ga0157370_10022979 3300013104 Bacteria 6197
227 Ga0157370_10120075 3300013104 Bacteria 2454
228 Ga0157369_10014458 3300013105 Bacteria 8911
229 Ga0157369_10303685 3300013105 Bacteria 1660
230 Ga0157369_10344852 3300013105 Bacteria 1547
231 Ga0157369_10469388 3300013105 Bacteria 1303
232 Ga0157374_10008557 3300013296 Bacteria 8753
233 Ga0157374_10018979 3300013296 Bacteria 6082
234 Ga0157374_10053370 3300013296 Bacteria 3768
235 Ga0157378_10008577 3300013297 Bacteria 8897
236 Ga0157378_10029958 3300013297 Bacteria 4806
237 Ga0157378_10033393 3300013297 Bacteria 4548
238 Ga0157378_10037383 3300013297 Bacteria 4299
239 Ga0157378_10061140 3300013297 Bacteria 3360
240 Ga0163162_10002232 3300013306 Bacteria 18196
241 Ga0163162_10011501 3300013306 Bacteria 8631
242 Ga0163162_10126154 3300013306 Bacteria 2665
243 Ga0157372_10037903 3300013307 Bacteria 5319
244 Ga0157372_10045554 3300013307 Bacteria 4867
245 Ga0157372_10046153 3300013307 Bacteria 4836
246 Ga0157372_10365208 3300013307 Bacteria 1682
247 Ga0157375_10007037 3300013308 Bacteria 9826
248 Ga0157375_10009095 3300013308 Bacteria 8701
249 Ga0157375_10018722 3300013308 Bacteria 6284
250 Ga0157375_10044200 3300013308 Bacteria 4326
251 Ga0157375_10080101 3300013308 Bacteria 3303
252 Ga0157375_10221684 3300013308 Bacteria 2049
253 Ga0157375_10254707 3300013308 Bacteria 1916
254 Ga0163163_10006684 3300014325 Bacteria 10104
255 Ga0163163_10029291 3300014325 Bacteria 5296
256 Ga0157380_10021787 3300014326 Bacteria 4812
257 Ga0157380_10200639 3300014326 Bacteria 1769
258 Ga0182008_10048811 3300014497 Bacteria 2102
259 Ga0157377_10019759 3300014745 Bacteria 3522
260 Ga0157377_10040348 3300014745 Bacteria 2584
261 Ga0157379_10001106 3300014968 Bacteria 22048
262 Ga0157379_10002047 3300014968 Bacteria 16745
263 Ga0157379_10004185 3300014968 Bacteria 12322
264 Ga0157379_10041867 3300014968 Bacteria 4088
265 Ga0157376_10010457 3300014969 Bacteria 6788
266 Ga0157376_10036655 3300014969 Bacteria 3974
267 Ga0157376_10410644 3300014969 Bacteria 1311
268 Ga0163161_10130079 3300017792 Bacteria 1898
269 Ga0206354_10079593 3300020081 Bacteria 1784
270 Ga0207656_10019308 3300025321 Bacteria 2696
271 Ga0207682_10005728 3300025893 Bacteria 5039
272 Ga0207692_10062141 3300025898 Bacteria 1938
273 Ga0207642_10058381 3300025899 Bacteria 1780
274 Ga0207710_10105189 3300025900 Bacteria 1335
275 Ga0207680_10004153 3300025903 Bacteria 6857
276 Ga0207680_10006648 3300025903 Bacteria 5610
277 Ga0207680_10045643 3300025903 Bacteria 2585
278 Ga0207699_10023483 3300025906 Bacteria 3356
279 Ga0207645_10001058 3300025907 Bacteria 22793
280 Ga0207645_10004486 3300025907 Bacteria 10330
281 Ga0207643_10025251 3300025908 Bacteria 3283
282 Ga0207643_10088218 3300025908 Bacteria 1805
283 Ga0207643_10090492 3300025908 Bacteria 1784
284 Ga0207684_10017929 3300025910 Bacteria 6069
285 Ga0207654_10037034 3300025911 Bacteria 2729
286 Ga0207654_10071894 3300025911 Bacteria 2058
287 Ga0207707_10008732 3300025912 Bacteria 8793
288 Ga0207695_10012077 3300025913 Bacteria 10382
289 Ga0207695_10025748 3300025913 Bacteria 6578
290 Ga0207671_10063215 3300025914 Bacteria 2750
291 Ga0207693_10002176 3300025915 Bacteria 17081
292 Ga0207663_10148325 3300025916 Bacteria 1642
293 Ga0207660_10013344 3300025917 Bacteria 5384
294 Ga0207657_10002834 3300025919 Bacteria 18618
295 Ga0207657_10016447 3300025919 Bacteria 7135
296 Ga0207649_10073119 3300025920 Bacteria 2195
297 Ga0207652_10014079 3300025921 Bacteria 6475
298 Ga0207681_10056838 3300025923 Bacteria 2670
299 Ga0207694_10007179 3300025924 Bacteria 8458
300 Ga0207694_10010860 3300025924 Bacteria 6875
301 Ga0207694_10085630 3300025924 Bacteria 2481
302 Ga0207694_10128502 3300025924 Bacteria 2029
303 Ga0207650_10006284 3300025925 Bacteria 8094
304 Ga0207650_10012006 3300025925 Bacteria 5970
305 Ga0207650_10026221 3300025925 Bacteria 4155
306 Ga0207650_10048116 3300025925 Bacteria 3144
307 Ga0207659_10002925 3300025926 Bacteria 10176
308 Ga0207659_10002989 3300025926 Bacteria 10076
309 Ga0207659_10004132 3300025926 Bacteria 8763
310 Ga0207659_10129714 3300025926 Bacteria 1944
311 Ga0207687_10001668 3300025927 Bacteria 15313
312 Ga0207687_10094146 3300025927 Bacteria 2192
313 Ga0207700_10000031 3300025928 Bacteria 130086
314 Ga0207664_10059393 3300025929 Bacteria 3045
315 Ga0207664_10085794 3300025929 Bacteria 2571
316 Ga0207644_10005084 3300025931 Bacteria 8591
317 Ga0207644_10010927 3300025931 Bacteria 5998
318 Ga0207644_10014773 3300025931 Bacteria 5231
319 Ga0207690_10139459 3300025932 Bacteria 1785
320 Ga0207706_10051087 3300025933 Bacteria 3651
321 Ga0207686_10000198 3300025934 Bacteria 46402
322 Ga0207686_10024636 3300025934 Bacteria 3489
323 Ga0207670_10035455 3300025936 Bacteria 3235
324 Ga0207670_10050308 3300025936 Bacteria 2792
325 Ga0207670_10076655 3300025936 Bacteria 2327
326 Ga0207669_10006638 3300025937 Bacteria 5304
327 Ga0207669_10010632 3300025937 Bacteria 4438
328 Ga0207669_10026395 3300025937 Bacteria 3158
329 Ga0207669_10065400 3300025937 Bacteria 2256
330 Ga0207704_10008017 3300025938 Bacteria 5024
331 Ga0207704_10083397 3300025938 Bacteria 2074
332 Ga0207665_10005065 3300025939 Bacteria 8797
333 Ga0207665_10061852 3300025939 Bacteria 2539
334 Ga0207691_10000006 3300025940 Bacteria 161922
335 Ga0207691_10000041 3300025940 Bacteria 106275
336 Ga0207691_10004308 3300025940 Bacteria 13821
337 Ga0207691_10007049 3300025940 Bacteria 10844
338 Ga0207691_10009490 3300025940 Bacteria 9343
339 Ga0207711_10001347 3300025941 Bacteria 23185
340 Ga0207711_10003428 3300025941 Bacteria 13714
341 Ga0207711_10221282 3300025941 Bacteria 1731
342 Ga0207689_10000042 3300025942 Bacteria 93077
343 Ga0207689_10012114 3300025942 Bacteria 7382
344 Ga0207689_10250190 3300025942 Bacteria 1465
345 Ga0207661_10100295 3300025944 Bacteria 2430
346 Ga0207679_10156752 3300025945 Bacteria 1860
347 Ga0207679_10190648 3300025945 Bacteria 1704
348 Ga0207667_10009435 3300025949 Bacteria 11491
349 Ga0207667_10014732 3300025949 Bacteria 8898
350 Ga0207667_10033313 3300025949 Bacteria 5541
351 Ga0207667_10048117 3300025949 Bacteria 4510
352 Ga0207667_10068736 3300025949 Bacteria 3687
353 Ga0207667_10130246 3300025949 Bacteria 2591
354 Ga0207651_10000821 3300025960 Bacteria 13431
355 Ga0207651_10001393 3300025960 Bacteria 10955
356 Ga0207651_10003097 3300025960 Bacteria 8086
357 Ga0207651_10007836 3300025960 Bacteria 5717
358 Ga0207712_10122671 3300025961 Bacteria 1968
359 Ga0207668_10001997 3300025972 Bacteria 11916
360 Ga0207668_10063947 3300025972 Bacteria 2598
361 Ga0207658_10006384 3300025986 Bacteria 8050
362 Ga0207658_10006722 3300025986 Bacteria 7830
363 Ga0207658_10010407 3300025986 Bacteria 6318
364 Ga0207658_10044284 3300025986 Bacteria 3240
365 Ga0207658_10155158 3300025986 Bacteria 1870
366 Ga0207677_10000799 3300026023 Bacteria 18068
367 Ga0207677_10017124 3300026023 Bacteria 4312
368 Ga0207677_10021263 3300026023 Bacteria 3960
369 Ga0207677_10031777 3300026023 Bacteria 3384
370 Ga0207677_10079362 3300026023 Bacteria 2347
371 Ga0207703_10000143 3300026035 Bacteria 84508
372 Ga0207703_10001515 3300026035 Bacteria 21165
373 Ga0207703_10005123 3300026035 Bacteria 10606
374 Ga0207703_10009453 3300026035 Bacteria 7655
375 Ga0207703_10014450 3300026035 Bacteria 6157
376 Ga0207703_10015029 3300026035 Bacteria 6043
377 Ga0207703_10223532 3300026035 Bacteria 1685
378 Ga0207703_10239777 3300026035 Bacteria 1630
379 Ga0207639_10073257 3300026041 Bacteria 2684
380 Ga0207639_10141048 3300026041 Bacteria 2008
381 Ga0207678_10003847 3300026067 Bacteria 13501
382 Ga0207678_10112885 3300026067 Bacteria 2318
383 Ga0207678_10273275 3300026067 Bacteria 1449
384 Ga0207708_10019739 3300026075 Bacteria 5082
385 Ga0207708_10104076 3300026075 Bacteria 2199
386 Ga0207702_10044512 3300026078 Bacteria 3731
387 Ga0207641_10008173 3300026088 Bacteria 8657
388 Ga0207641_10009450 3300026088 Bacteria 8034
389 Ga0207641_10028656 3300026088 Bacteria 4602
390 Ga0207641_10030138 3300026088 Bacteria 4493
391 Ga0207641_10030311 3300026088 Bacteria 4481
392 Ga0207641_10080760 3300026088 Bacteria 2822
393 Ga0207641_10131588 3300026088 Bacteria 2247
394 Ga0207648_10000601 3300026089 Bacteria 40481
395 Ga0207648_10002730 3300026089 Bacteria 18749
396 Ga0207648_10005057 3300026089 Bacteria 13371
397 Ga0207648_10304792 3300026089 Bacteria 1429
398 Ga0207676_10000837 3300026095 Bacteria 23871
399 Ga0207676_10004178 3300026095 Bacteria 10207
400 Ga0207676_10012832 3300026095 Bacteria 6015
401 Ga0207676_10390525 3300026095 Bacteria 1298
402 Ga0207674_10000049 3300026116 Bacteria 118784
403 Ga0207674_10001272 3300026116 Bacteria 32948
404 Ga0207674_10003466 3300026116 Bacteria 19294
405 Ga0207674_10041729 3300026116 Bacteria 4744
406 Ga0207675_100000517 3300026118 Bacteria 37526
407 Ga0207675_100034799 3300026118 Bacteria 4698
408 Ga0207675_100274420 3300026118 Bacteria 1637
409 Ga0207683_10000011 3300026121 Bacteria 140261
410 Ga0207683_10002753 3300026121 Bacteria 15353
411 Ga0207683_10006764 3300026121 Bacteria 9811
412 Ga0207683_10010698 3300026121 Bacteria 7819
413 Ga0207698_10000922 3300026142 Bacteria 17101
414 Ga0207698_10006726 3300026142 Bacteria 7184
415 Ga0207698_10019689 3300026142 Bacteria 4626
416 Ga0207698_10282944 3300026142 Bacteria 1535
417 Ga0209588_1016821 3300027671 Bacteria 2262
418 Ga0268266_10002385 3300028379 Bacteria 20297
419 Ga0268266_10025406 3300028379 Bacteria 5039
420 Ga0268266_10037041 3300028379 Bacteria 4156
421 Ga0268266_10071429 3300028379 Bacteria 3008
422 Ga0268264_10000641 3300028381 Bacteria 41364
423 Ga0268264_10003919 3300028381 Bacteria 12743
424 Ga0268264_10039987 3300028381 Bacteria 3874
425 Ga0265330_10006553 3300031235 Bacteria 5754
426 Ga0265325_10042004 3300031241 Bacteria 2393
427 Ga0265331_10000310 3300031250 Bacteria 53265
428 Ga0265327_10002920 3300031251 Bacteria 17116
429 Ga0265316_10015797 3300031344 Bacteria 6581
430 Ga0307408_100179700 3300031548 Bacteria 1696
431 Ga0316579_10003538 3300031691 Bacteria 6113
432 Ga0316579_10063156 3300031691 Bacteria 1745
433 Ga0265314_10003412 3300031711 Bacteria 15382
434 Ga0265342_10011276 3300031712 Bacteria 6129
435 Ga0265342_10082861 3300031712 Bacteria 1850
436 Ga0316576_10007693 3300031727 Bacteria 6797
437 Ga0316578_10001353 3300031728 Bacteria 9875
438 Ga0307411_10134290 3300032005 Bacteria 1814
439 Ga0316585_10000825 3300032137 Bacteria 7836
440 Ga0373954_0002126 3300035118 Bacteria 8225
441 Ga0373956_0014030 3300035119 Bacteria 3342
442 Ga0373943_0015419 3300035170 Bacteria 3470
443 Ga0373943_0228088 3300035170 Bacteria 1039
444 Ga0373946_0081085 3300035171 Bacteria 1421
445 Ga0373955_0008031 3300035172 Bacteria 4878
446 Ga0373955_0073608 3300035172 Bacteria 1915
447 Ga0316574_0000657 3300035398 Bacteria 14546
448 Ga0316574_0020235 3300035398 Bacteria 3938
449 Ga0316574_0038325 3300035398 Bacteria 2942
450 Ga0373924_0016252 3300035410 Bacteria 2839
451 Ga0373935_0021847 3300035692 Bacteria 3918
452 Ga0373933_0003333 3300035724 Bacteria 8957
453 Ga0373947_0020754 3300035725 Bacteria 3796
454 Ga0373947_0025241 3300035725 Bacteria 3465
455 Ga0373937_0026978 3300036401 Bacteria 5193
456 Ga0373937_0034394 3300036401 Bacteria 4610
457 Ga0373937_0125447 3300036401 Bacteria 2394
458 Ga0373937_0218694 3300036401 Bacteria 1793
459 Ga0316582_0001314 3300036647 Bacteria 10750
460 Ga0316582_0022447 3300036647 Bacteria 3747
461 Ga0316584_0005109 3300036712 Bacteria 8755
462 Ga0316584_0018869 3300036712 Unclassified 4980
463 Ga0373925_0009503 3300037068 Bacteria 7079
464 Ga0373925_0013381 3300037068 Bacteria 5937
465 Ga0373925_0078847 3300037068 Bacteria 2501
466 Ga0395900_0112752 3300037418 Bacteria 2792
467 Ga0395900_0155145 3300037418 Bacteria 2339
468 Ga0395905_0022658 3300037471 Bacteria 5938
469 Ga0395901_0018353 3300038443 Bacteria 7142
470 Ga0436365_0565898 3300039437 Bacteria 4978
471 Ga0451577_0000040 3300042876 Bacteria 346755
472 Ga0453684_0000179 3300044712 Bacteria 280195
473 Ga0466957_0313610 3300044842 Bacteria 1057
474 Ga0466958_0125547 3300045836 Bacteria 1609
475 Ga0495590_0000011 3300046457 Bacteria 307470
476 Ga0495629_0008490 3300046459 Bacteria 7563
477 Ga0495638_0000058 3300046460 Bacteria 192656
478 Ga0495651_0010132 3300046462 Bacteria 7240
479 Ga0495653_0053985 3300046463 Bacteria 3072
480 Ga0495650_0003025 3300046471 Bacteria 12689
481 Ga0495580_0020023 3300046472 Bacteria 4959
482 Ga0495580_0119519 3300046472 Bacteria 1830
483 Ga0495582_0005046 3300046473 Bacteria 7397
484 Ga0495639_0020731 3300046475 Bacteria 2872
485 Ga0495662_0040418 3300046476 Bacteria 2252
486 Ga0495664_0120213 3300046477 Bacteria 1589
487 Ga0495594_0016481 3300046499 Bacteria 3893
488 Ga0495583_0000751 3300046506 Bacteria 41181
489 Ga0495606_0001241 3300046507 Bacteria 35622
490 Ga0495628_0028581 3300046516 Bacteria 4528
491 Ga0495630_0052254 3300046517 Bacteria 3059
492 Ga0495643_0000230 3300046522 Bacteria 84299
493 Ga0495644_0042987 3300046523 Bacteria 1701
494 Ga0495648_0000082 3300046524 Bacteria 123682
495 Ga0495640_0016426 3300046533 Bacteria 5536
496 Ga0495587_0003983 3300046536 Bacteria 9791
497 Ga0495621_0013853 3300046539 Bacteria 2542
498 Ga0495597_0000341 3300046542 Bacteria 41785
499 Ga0495645_0003028 3300046543 Bacteria 11372
500 Ga0495622_0001811 3300046557 Bacteria 10527
501 Ga0495633_0000459 3300046558 Bacteria 41806
502 Ga0495667_0047399 3300046559 Bacteria 2840
503 Ga0495668_0000266 3300046616 Bacteria 73736
504 Ga0495625_0000843 3300046660 Bacteria 41880
505 Ga0495635_0010528 3300046663 Bacteria 6473
506 Ga0495635_0095460 3300046663 Bacteria 2033
507 Ga0495657_0095298 3300046675 Bacteria 1902
508 Ga0495599_0045241 3300046678 Bacteria 2760
509 Ga0495623_0012139 3300046679 Bacteria 5582
510 Ga0495613_0007994 3300046689 Bacteria 7866
511 Ga0495670_0049307 3300046691 Bacteria 2107
512 Ga0495600_0109080 3300046809 Bacteria 1802
513 Ga0495660_0016819 3300046810 Bacteria 4214
514 Ga0495581_0001341 3300047315 Bacteria 13603
515 Ga0495636_0017782 3300047318 Bacteria 2848
516 Ga0495672_0062345 3300047320 Bacteria 2145
517 Ga0495680_0030368 3300047322 Bacteria 4412
518 Ga0495687_000317 3300047443 Bacteria 62824
519 Ga0495687_001429 3300047443 Bacteria 21978
520 Ga0495675_0059610 3300047444 Bacteria 2420
521 Ga0495684_0056914 3300047471 Bacteria 2980
522 Ga0495684_0082967 3300047471 Bacteria 2431
523 Ga0495614_0008895 3300048089 Bacteria 4456
524 Ga0496101_0022598 3300048904 Bacteria 4332
525 Ga0496104_0008261 3300048907 Bacteria 9243
526 Ga0496105_0137078 3300048908 Bacteria 2015
527 Ga0496107_0010009 3300048910 Bacteria 6577
528 Ga0496109_0032033 3300048912 Bacteria 4723
529 Ga0496109_0155744 3300048912 Bacteria 2140
530 Ga0496110_0143498 3300048913 Bacteria 2159
531 Ga0496115_0042441 3300048918 Bacteria 3623
532 Ga0496115_0076359 3300048918 Bacteria 2723
533 Ga0495678_013802 3300049459 Bacteria 3781
534 Ga0495678_016661 3300049459 Bacteria 3352
535 Ga0501047_0005610 3300049581 Bacteria 11820
536 Ga0501069_0011001 3300049585 Bacteria 4799
537 Ga0501069_0044296 3300049585 Bacteria 2463
538 Ga0501070_0001279 3300049586 Bacteria 22589
539 Ga0501070_0109039 3300049586 Bacteria 2287
540 Ga0501073_0000882 3300049589 Bacteria 21503
541 Ga0501074_0000689 3300049590 Bacteria 21108
542 Ga0501074_0182120 3300049590 Bacteria 1498
543 Ga0501079_0006365 3300049741 Bacteria 8864
544 Ga0501080_0029194 3300049742 Bacteria 5134
545 Ga0501083_0017478 3300049744 Bacteria 5000
546 nmdc:mga08y16_119884_c1 3300050511 Bacteria 2738
547 nmdc:mga0n895_102030_c1 3300050512 Bacteria 2879
548 nmdc:mga0rr50_162288_c1 3300050513 Bacteria 1815
549 nmdc:mga08x19_10942_c1 3300050514 Bacteria 5457
550 nmdc:mga08x19_46651_c1 3300050514 Bacteria 2772
551 nmdc:mga0a205_123815_c1 3300050515 Bacteria 1800
552 nmdc:mga0a205_90977_c1 3300050515 Bacteria 2948
553 Ga0495601_0002762 3300053077 Bacteria 9969
554 Ga0495619_0023365 3300053085 Bacteria 3963
555 Ga0501082_0080868 3300060353 Bacteria 2804

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0001279 Ga0501070_0001279_12210_13181 315
2 3300060353 Ga0501082_0080868 Ga0501082_0080868_1804_2775 315
3 3300049590 Ga0501074_0182120 Ga0501074_0182120_495_1472 321
4 3300035170 Ga0373943_0228088 Ga0373943_0228088_40_1020 322
5 3300044842 Ga0466957_0313610 Ga0466957_0313610_27_1007 324
6 3300005340 Ga0070689_100066377 Ga0070689_1000663773 353
7 3300005547 Ga0070693_100006121 Ga0070693_1000061213 353
8 3300006358 Ga0068871_100017726 Ga0068871_1000177266 353
9 3300009098 Ga0105245_10040997 Ga0105245_100409974 353
10 3300013297 Ga0157378_10029958 Ga0157378_100299582 353
11 3300027671 Ga0209588_1016821 Ga0209588_10168212 353
12 3300042876 Ga0451577_0000040 Ga0451577_0000040_136807_137934 353
13 3300044712 Ga0453684_0000179 Ga0453684_0000179_208796_209923 353
14 3300025929 Ga0207664_10059393 Ga0207664_100593933 354
15 3300013104 Ga0157370_10005403 Ga0157370_100054035 357
16 3300046523 Ga0495644_0042987 Ga0495644_0042987_463_1590 360
17 3300005539 Ga0068853_100021304 Ga0068853_1000213045 366
18 3300005563 Ga0068855_100041106 Ga0068855_1000411064 366
19 3300005563 Ga0068855_100126978 Ga0068855_1001269783 366
20 3300005614 Ga0068856_100113517 Ga0068856_1001135172 366
21 3300009093 Ga0105240_10039354 Ga0105240_100393542 366
22 3300009174 Ga0105241_10045265 Ga0105241_100452653 366
23 3300009551 Ga0105238_10008362 Ga0105238_100083624 366
24 3300013105 Ga0157369_10469388 Ga0157369_104693882 366
25 3300025911 Ga0207654_10037034 Ga0207654_100370342 366
26 3300025924 Ga0207694_10010860 Ga0207694_100108606 366
27 3300025949 Ga0207667_10068736 Ga0207667_100687363 366
28 3300025949 Ga0207667_10130246 Ga0207667_101302462 366
29 3300005354 Ga0070675_100001764 Ga0070675_10000176416 367
30 3300005354 Ga0070675_100090301 Ga0070675_1000903012 367
31 3300005439 Ga0070711_100027989 Ga0070711_1000279893 367
32 3300005466 Ga0070685_10112884 Ga0070685_101128841 367
33 3300005518 Ga0070699_100039995 Ga0070699_1000399952 367
34 3300005535 Ga0070684_100158649 Ga0070684_1001586493 367
35 3300005546 Ga0070696_100013351 Ga0070696_1000133512 367
36 3300005563 Ga0068855_100011856 Ga0068855_1000118567 367
37 3300005577 Ga0068857_100114759 Ga0068857_1001147592 367
38 3300005616 Ga0068852_100006246 Ga0068852_1000062468 367
39 3300005617 Ga0068859_100502821 Ga0068859_1005028212 367
40 3300005834 Ga0068851_10003419 Ga0068851_100034192 367
41 3300005842 Ga0068858_100017145 Ga0068858_1000171454 367
42 3300005843 Ga0068860_100268368 Ga0068860_1002683682 367
43 3300006237 Ga0097621_100024835 Ga0097621_1000248353 367
44 3300006237 Ga0097621_100066895 Ga0097621_1000668952 367
45 3300006358 Ga0068871_100044019 Ga0068871_1000440193 367
46 3300006358 Ga0068871_100093173 Ga0068871_1000931732 367
47 3300006914 Ga0075436_100001328 Ga0075436_10000132817 367
48 3300006914 Ga0075436_100035416 Ga0075436_1000354162 367
49 3300006931 Ga0097620_100502857 Ga0097620_1005028572 367
50 3300007076 Ga0075435_100114440 Ga0075435_1001144402 367
51 3300007788 Ga0099795_10001771 Ga0099795_100017715 367
52 3300009098 Ga0105245_10008983 Ga0105245_100089836 367
53 3300009148 Ga0105243_10154794 Ga0105243_101547942 367
54 3300009176 Ga0105242_10056040 Ga0105242_100560402 367
55 3300009176 Ga0105242_10063186 Ga0105242_100631862 367
56 3300009553 Ga0105249_10121542 Ga0105249_101215421 367
57 3300013105 Ga0157369_10344852 Ga0157369_103448521 367
58 3300013296 Ga0157374_10018979 Ga0157374_100189795 367
59 3300013296 Ga0157374_10053370 Ga0157374_100533703 367
60 3300013307 Ga0157372_10037903 Ga0157372_100379035 367
61 3300013308 Ga0157375_10044200 Ga0157375_100442002 367
62 3300014745 Ga0157377_10019759 Ga0157377_100197593 367
63 3300025321 Ga0207656_10019308 Ga0207656_100193083 367
64 3300025906 Ga0207699_10023483 Ga0207699_100234833 367
65 3300025916 Ga0207663_10148325 Ga0207663_101483252 367
66 3300025924 Ga0207694_10085630 Ga0207694_100856302 367
67 3300025934 Ga0207686_10024636 Ga0207686_100246363 367
68 3300025936 Ga0207670_10050308 Ga0207670_100503082 367
69 3300025936 Ga0207670_10076655 Ga0207670_100766552 367
70 3300025937 Ga0207669_10065400 Ga0207669_100654002 367
71 3300025939 Ga0207665_10005065 Ga0207665_100050654 367
72 3300025940 Ga0207691_10007049 Ga0207691_100070498 367
73 3300025949 Ga0207667_10048117 Ga0207667_100481173 367
74 3300026075 Ga0207708_10104076 Ga0207708_101040762 367
75 3300026116 Ga0207674_10041729 Ga0207674_100417295 367
76 3300026142 Ga0207698_10000922 Ga0207698_100009225 367
77 3300031548 Ga0307408_100179700 Ga0307408_1001797002 367
78 3300031691 Ga0316579_10063156 Ga0316579_100631562 367
79 3300032005 Ga0307411_10134290 Ga0307411_101342903 367
80 3300036401 Ga0373937_0034394 Ga0373937_0034394_2989_4119 367
81 3300039437 Ga0436365_0565898 Ga0436365_0565898_3546_4676 367
82 3300046462 Ga0495651_0010132 Ga0495651_0010132_3586_4716 367
83 3300046463 Ga0495653_0053985 Ga0495653_0053985_321_1451 367
84 3300046477 Ga0495664_0120213 Ga0495664_0120213_96_1226 367
85 3300046522 Ga0495643_0000230 Ga0495643_0000230_44858_45967 367
86 3300046536 Ga0495587_0003983 Ga0495587_0003983_6522_7652 367
87 3300046542 Ga0495597_0000341 Ga0495597_0000341_3683_4792 367
88 3300046543 Ga0495645_0003028 Ga0495645_0003028_7381_8511 367
89 3300046663 Ga0495635_0095460 Ga0495635_0095460_586_1716 367
90 3300046675 Ga0495657_0095298 Ga0495657_0095298_375_1505 367
91 3300046678 Ga0495599_0045241 Ga0495599_0045241_723_1853 367
92 3300046679 Ga0495623_0012139 Ga0495623_0012139_2619_3749 367
93 3300046810 Ga0495660_0016819 Ga0495660_0016819_1217_2326 367
94 3300047318 Ga0495636_0017782 Ga0495636_0017782_1624_2754 367
95 3300047443 Ga0495687_000317 Ga0495687_000317_36001_37110 367
96 3300047443 Ga0495687_001429 Ga0495687_001429_13322_14431 367
97 3300047471 Ga0495684_0082967 Ga0495684_0082967_526_1656 367
98 3300049581 Ga0501047_0005610 Ga0501047_0005610_7054_8214 367
99 3300049585 Ga0501069_0011001 Ga0501069_0011001_1801_2961 367
100 3300049589 Ga0501073_0000882 Ga0501073_0000882_13975_15135 367
101 3300049590 Ga0501074_0000689 Ga0501074_0000689_6324_7484 367
102 3300049741 Ga0501079_0006365 Ga0501079_0006365_5891_7051 367
103 3300049744 Ga0501083_0017478 Ga0501083_0017478_1547_2707 367
104 3300050512 nmdc:mga0n895_102030_c1 nmdc:mga0n895_102030_c1_633_1763 367
105 3300050514 nmdc:mga08x19_10942_c1 nmdc:mga08x19_10942_c1_1502_2632 367
106 3300050514 nmdc:mga08x19_46651_c1 nmdc:mga08x19_46651_c1_1181_2311 367
107 3300050515 nmdc:mga0a205_123815_c1 nmdc:mga0a205_123815_c1_259_1389 367
108 3300053077 Ga0495601_0002762 Ga0495601_0002762_7175_8305 367
109 3300014326 Ga0157380_10021787 Ga0157380_100217872 368
110 3300046457 Ga0495590_0000011 Ga0495590_0000011_47647_48759 368
111 3300046460 Ga0495638_0000058 Ga0495638_0000058_141081_142193 368
112 3300046471 Ga0495650_0003025 Ga0495650_0003025_2178_3290 368
113 3300046506 Ga0495583_0000751 Ga0495583_0000751_37889_39001 368
114 3300046507 Ga0495606_0001241 Ga0495606_0001241_22827_23939 368
115 3300046524 Ga0495648_0000082 Ga0495648_0000082_72771_73883 368
116 3300046557 Ga0495622_0001811 Ga0495622_0001811_7196_8308 368
117 3300046558 Ga0495633_0000459 Ga0495633_0000459_35111_36223 368
118 3300046616 Ga0495668_0000266 Ga0495668_0000266_25916_27028 368
119 3300046660 Ga0495625_0000843 Ga0495625_0000843_37303_38415 368
120 3300046691 Ga0495670_0049307 Ga0495670_0049307_420_1541 368
121 3300049459 Ga0495678_013802 Ga0495678_013802_99_1211 368
122 3300049459 Ga0495678_016661 Ga0495678_016661_2142_3254 368
123 3300049742 Ga0501080_0029194 Ga0501080_0029194_791_1945 368
124 3300026035 Ga0207703_10005123 Ga0207703_100051239 369
125 3300047320 Ga0495672_0062345 Ga0495672_0062345_195_1331 369
126 3300005367 Ga0070667_100201023 Ga0070667_1002010232 370
127 3300005539 Ga0068853_100026414 Ga0068853_1000264142 370
128 3300009093 Ga0105240_10302062 Ga0105240_103020622 370
129 3300025925 Ga0207650_10006284 Ga0207650_100062846 370
130 3300026041 Ga0207639_10073257 Ga0207639_100732571 370
131 3300031691 Ga0316579_10003538 Ga0316579_100035386 370
132 3300031712 Ga0265342_10082861 Ga0265342_100828611 370
133 3300031727 Ga0316576_10007693 Ga0316576_100076932 370
134 3300031728 Ga0316578_10001353 Ga0316578_100013536 370
135 3300032137 Ga0316585_10000825 Ga0316585_100008254 370
136 3300035398 Ga0316574_0000657 Ga0316574_0000657_5388_6509 370
137 3300035398 Ga0316574_0020235 Ga0316574_0020235_2605_3729 370
138 3300035398 Ga0316574_0038325 Ga0316574_0038325_1406_2527 370
139 3300036647 Ga0316582_0001314 Ga0316582_0001314_3803_4927 370
140 3300036647 Ga0316582_0022447 Ga0316582_0022447_1722_2843 370
141 3300036712 Ga0316584_0005109 Ga0316584_0005109_1311_2435 370
142 3300036712 Ga0316584_0018869 Ga0316584_0018869_300_1421 370
143 3300005329 Ga0070683_100026675 Ga0070683_1000266753 371
144 3300005336 Ga0070680_100167271 Ga0070680_1001672712 371
145 3300005339 Ga0070660_100021172 Ga0070660_1000211723 371
146 3300005344 Ga0070661_100007598 Ga0070661_1000075987 371
147 3300005366 Ga0070659_100170020 Ga0070659_1001700202 371
148 3300005435 Ga0070714_100007199 Ga0070714_1000071997 371
149 3300005458 Ga0070681_10001277 Ga0070681_1000127721 371
150 3300005530 Ga0070679_100020307 Ga0070679_1000203073 371
151 3300005547 Ga0070693_100108596 Ga0070693_1001085961 371
152 3300005563 Ga0068855_100012552 Ga0068855_1000125523 371
153 3300005564 Ga0070664_100001452 Ga0070664_10000145210 371
154 3300005577 Ga0068857_100001739 Ga0068857_1000017393 371
155 3300005614 Ga0068856_100006138 Ga0068856_1000061385 371
156 3300005616 Ga0068852_100001471 Ga0068852_10000147112 371
157 3300005834 Ga0068851_10003959 Ga0068851_100039595 371
158 3300009093 Ga0105240_10017865 Ga0105240_100178653 371
159 3300009545 Ga0105237_10356366 Ga0105237_103563662 371
160 3300009551 Ga0105238_10007592 Ga0105238_100075924 371
161 3300013100 Ga0157373_10055370 Ga0157373_100553703 371
162 3300013104 Ga0157370_10008356 Ga0157370_1000835611 371
163 3300013104 Ga0157370_10120075 Ga0157370_101200752 371
164 3300013105 Ga0157369_10014458 Ga0157369_100144586 371
165 3300013105 Ga0157369_10303685 Ga0157369_103036851 371
166 3300013307 Ga0157372_10045554 Ga0157372_100455545 371
167 3300014497 Ga0182008_10048811 Ga0182008_100488112 371
168 3300025913 Ga0207695_10025748 Ga0207695_100257483 371
169 3300025919 Ga0207657_10016447 Ga0207657_100164479 371
170 3300025920 Ga0207649_10073119 Ga0207649_100731192 371
171 3300025921 Ga0207652_10014079 Ga0207652_100140795 371
172 3300025924 Ga0207694_10007179 Ga0207694_100071796 371
173 3300025932 Ga0207690_10139459 Ga0207690_101394593 371
174 3300025944 Ga0207661_10100295 Ga0207661_101002952 371
175 3300025949 Ga0207667_10009435 Ga0207667_100094357 371
176 3300026116 Ga0207674_10000049 Ga0207674_1000004925 371
177 3300026142 Ga0207698_10019689 Ga0207698_100196893 371
178 3300026067 Ga0207678_10273275 Ga0207678_102732752 372
179 3300005345 Ga0070692_10019262 Ga0070692_100192623 373
180 3300005347 Ga0070668_100090992 Ga0070668_1000909923 373
181 3300005441 Ga0070700_100027897 Ga0070700_1000278973 373
182 3300005455 Ga0070663_100219825 Ga0070663_1002198252 373
183 3300005614 Ga0068856_100001396 Ga0068856_1000013967 373
184 3300005937 Ga0081455_10078253 Ga0081455_100782532 373
185 3300006881 Ga0068865_100094791 Ga0068865_1000947913 373
186 3300013307 Ga0157372_10046153 Ga0157372_100461532 373
187 3300025898 Ga0207692_10062141 Ga0207692_100621412 373
188 3300025938 Ga0207704_10083397 Ga0207704_100833972 373
189 3300026075 Ga0207708_10019739 Ga0207708_100197393 373
190 3300037418 Ga0395900_0112752 Ga0395900_0112752_1541_2671 373
191 3300038443 Ga0395901_0018353 Ga0395901_0018353_2160_3290 373
192 3300045836 Ga0466958_0125547 Ga0466958_0125547_23_1153 373
193 3300049585 Ga0501069_0044296 Ga0501069_0044296_1012_2145 373
194 3300005327 Ga0070658_10023833 Ga0070658_100238332 374
195 3300005328 Ga0070676_10005737 Ga0070676_100057376 374
196 3300005328 Ga0070676_10009931 Ga0070676_100099313 374
197 3300005330 Ga0070690_100018294 Ga0070690_1000182942 374
198 3300005330 Ga0070690_100190043 Ga0070690_1001900431 374
199 3300005331 Ga0070670_100029157 Ga0070670_1000291572 374
200 3300005331 Ga0070670_100039569 Ga0070670_1000395695 374
201 3300005331 Ga0070670_100140288 Ga0070670_1001402882 374
202 3300005331 Ga0070670_100259454 Ga0070670_1002594541 374
203 3300005333 Ga0070677_10000965 Ga0070677_100009653 374
204 3300005334 Ga0068869_100000388 Ga0068869_10000038819 374
205 3300005334 Ga0068869_100008272 Ga0068869_1000082724 374
206 3300005335 Ga0070666_10000887 Ga0070666_100008872 374
207 3300005335 Ga0070666_10007056 Ga0070666_100070566 374
208 3300005335 Ga0070666_10056165 Ga0070666_100561653 374
209 3300005335 Ga0070666_10179563 Ga0070666_101795631 374
210 3300005336 Ga0070680_100180992 Ga0070680_1001809922 374
211 3300005338 Ga0068868_100003424 Ga0068868_1000034248 374
212 3300005338 Ga0068868_100008218 Ga0068868_1000082185 374
213 3300005338 Ga0068868_100022058 Ga0068868_1000220585 374
214 3300005338 Ga0068868_100052818 Ga0068868_1000528183 374
215 3300005340 Ga0070689_100005389 Ga0070689_1000053897 374
216 3300005344 Ga0070661_100008547 Ga0070661_1000085474 374
217 3300005347 Ga0070668_100004358 Ga0070668_1000043589 374
218 3300005347 Ga0070668_100013627 Ga0070668_1000136275 374
219 3300005347 Ga0070668_100019525 Ga0070668_1000195254 374
220 3300005347 Ga0070668_100068530 Ga0070668_1000685303 374
221 3300005353 Ga0070669_100002694 Ga0070669_1000026944 374
222 3300005353 Ga0070669_100117884 Ga0070669_1001178841 374
223 3300005354 Ga0070675_100000476 Ga0070675_1000004764 374
224 3300005354 Ga0070675_100013648 Ga0070675_1000136486 374
225 3300005355 Ga0070671_100002250 Ga0070671_1000022508 374
226 3300005355 Ga0070671_100002660 Ga0070671_1000026604 374
227 3300005355 Ga0070671_100011370 Ga0070671_1000113704 374
228 3300005355 Ga0070671_100021544 Ga0070671_1000215443 374
229 3300005356 Ga0070674_100000409 Ga0070674_10000040921 374
230 3300005356 Ga0070674_100004979 Ga0070674_1000049797 374
231 3300005364 Ga0070673_100000781 Ga0070673_1000007814 374
232 3300005364 Ga0070673_100001204 Ga0070673_1000012047 374
233 3300005364 Ga0070673_100007406 Ga0070673_1000074064 374
234 3300005364 Ga0070673_100020203 Ga0070673_1000202031 374
235 3300005365 Ga0070688_100002928 Ga0070688_1000029287 374
236 3300005366 Ga0070659_100008939 Ga0070659_1000089394 374
237 3300005367 Ga0070667_100000550 Ga0070667_10000055010 374
238 3300005367 Ga0070667_100006019 Ga0070667_1000060194 374
239 3300005367 Ga0070667_100017448 Ga0070667_1000174483 374
240 3300005367 Ga0070667_100090872 Ga0070667_1000908723 374
241 3300005367 Ga0070667_100125814 Ga0070667_1001258142 374
242 3300005367 Ga0070667_100223800 Ga0070667_1002238001 374
243 3300005436 Ga0070713_100000182 Ga0070713_10000018221 374
244 3300005436 Ga0070713_100003475 Ga0070713_1000034755 374
245 3300005437 Ga0070710_10012581 Ga0070710_100125812 374
246 3300005439 Ga0070711_100011287 Ga0070711_1000112872 374
247 3300005440 Ga0070705_100099990 Ga0070705_1000999901 374
248 3300005445 Ga0070708_100000207 Ga0070708_10000020718 374
249 3300005455 Ga0070663_100087431 Ga0070663_1000874312 374
250 3300005456 Ga0070678_100000200 Ga0070678_10000020013 374
251 3300005456 Ga0070678_100000560 Ga0070678_10000056018 374
252 3300005456 Ga0070678_100000872 Ga0070678_1000008723 374
253 3300005456 Ga0070678_100009611 Ga0070678_1000096113 374
254 3300005457 Ga0070662_100038470 Ga0070662_1000384703 374
255 3300005457 Ga0070662_100103595 Ga0070662_1001035952 374
256 3300005459 Ga0068867_100001219 Ga0068867_1000012197 374
257 3300005459 Ga0068867_100001865 Ga0068867_1000018654 374
258 3300005459 Ga0068867_100016645 Ga0068867_1000166453 374
259 3300005459 Ga0068867_100226490 Ga0068867_1002264902 374
260 3300005466 Ga0070685_10004553 Ga0070685_100045534 374
261 3300005467 Ga0070706_100005849 Ga0070706_10000584910 374
262 3300005471 Ga0070698_100163402 Ga0070698_1001634022 374
263 3300005518 Ga0070699_100210529 Ga0070699_1002105292 374
264 3300005530 Ga0070679_100100348 Ga0070679_1001003481 374
265 3300005536 Ga0070697_100024935 Ga0070697_1000249353 374
266 3300005539 Ga0068853_100011739 Ga0068853_1000117392 374
267 3300005543 Ga0070672_100006366 Ga0070672_1000063664 374
268 3300005543 Ga0070672_100008331 Ga0070672_1000083313 374
269 3300005543 Ga0070672_100025038 Ga0070672_1000250383 374
270 3300005543 Ga0070672_100051651 Ga0070672_1000516513 374
271 3300005546 Ga0070696_100064866 Ga0070696_1000648662 374
272 3300005547 Ga0070693_100000167 Ga0070693_1000001671 374
273 3300005547 Ga0070693_100082558 Ga0070693_1000825582 374
274 3300005548 Ga0070665_100001447 Ga0070665_1000014476 374
275 3300005548 Ga0070665_100005172 Ga0070665_1000051726 374
276 3300005548 Ga0070665_100025304 Ga0070665_1000253044 374
277 3300005548 Ga0070665_100055050 Ga0070665_1000550503 374
278 3300005548 Ga0070665_100154584 Ga0070665_1001545843 374
279 3300005549 Ga0070704_100113396 Ga0070704_1001133962 374
280 3300005563 Ga0068855_100048381 Ga0068855_1000483812 374
281 3300005563 Ga0068855_100154592 Ga0068855_1001545922 374
282 3300005564 Ga0070664_100012048 Ga0070664_1000120484 374
283 3300005564 Ga0070664_100161412 Ga0070664_1001614122 374
284 3300005577 Ga0068857_100001623 Ga0068857_10000162313 374
285 3300005577 Ga0068857_100181611 Ga0068857_1001816112 374
286 3300005578 Ga0068854_100002132 Ga0068854_1000021327 374
287 3300005578 Ga0068854_100002439 Ga0068854_1000024398 374
288 3300005614 Ga0068856_100043206 Ga0068856_1000432062 374
289 3300005614 Ga0068856_100101918 Ga0068856_1001019182 374
290 3300005617 Ga0068859_100001484 Ga0068859_10000148412 374
291 3300005617 Ga0068859_100038177 Ga0068859_1000381774 374
292 3300005618 Ga0068864_100002372 Ga0068864_1000023724 374
293 3300005618 Ga0068864_100023093 Ga0068864_1000230935 374
294 3300005618 Ga0068864_100026603 Ga0068864_1000266034 374
295 3300005618 Ga0068864_100149498 Ga0068864_1001494983 374
296 3300005718 Ga0068866_10000527 Ga0068866_1000052720 374
297 3300005718 Ga0068866_10033784 Ga0068866_100337843 374
298 3300005719 Ga0068861_100000187 Ga0068861_1000001872 374
299 3300005719 Ga0068861_100159606 Ga0068861_1001596062 374
300 3300005834 Ga0068851_10000301 Ga0068851_100003019 374
301 3300005834 Ga0068851_10010426 Ga0068851_100104262 374
302 3300005840 Ga0068870_10088432 Ga0068870_100884322 374
303 3300005841 Ga0068863_100006037 Ga0068863_1000060376 374
304 3300005841 Ga0068863_100013076 Ga0068863_1000130765 374
305 3300005841 Ga0068863_100019995 Ga0068863_1000199953 374
306 3300005841 Ga0068863_100028429 Ga0068863_1000284294 374
307 3300005842 Ga0068858_100008319 Ga0068858_1000083195 374
308 3300005842 Ga0068858_100017079 Ga0068858_1000170796 374
309 3300005842 Ga0068858_100018888 Ga0068858_1000188884 374
310 3300005842 Ga0068858_100019815 Ga0068858_1000198153 374
311 3300005842 Ga0068858_100238176 Ga0068858_1002381762 374
312 3300005843 Ga0068860_100002049 Ga0068860_10000204917 374
313 3300005843 Ga0068860_100003430 Ga0068860_1000034301 374
314 3300005843 Ga0068860_100011724 Ga0068860_1000117244 374
315 3300005843 Ga0068860_100027211 Ga0068860_1000272115 374
316 3300005843 Ga0068860_100056842 Ga0068860_1000568423 374
317 3300005843 Ga0068860_100372331 Ga0068860_1003723311 374
318 3300006163 Ga0070715_10005192 Ga0070715_100051922 374
319 3300006173 Ga0070716_100056439 Ga0070716_1000564392 374
320 3300006175 Ga0070712_100089073 Ga0070712_1000890732 374
321 3300006237 Ga0097621_100000972 Ga0097621_1000009724 374
322 3300006237 Ga0097621_100009045 Ga0097621_1000090452 374
323 3300006237 Ga0097621_100059281 Ga0097621_1000592813 374
324 3300006237 Ga0097621_100066120 Ga0097621_1000661201 374
325 3300006358 Ga0068871_100009526 Ga0068871_1000095265 374
326 3300006358 Ga0068871_100013937 Ga0068871_1000139374 374
327 3300006358 Ga0068871_100206605 Ga0068871_1002066051 374
328 3300006844 Ga0075428_100061078 Ga0075428_1000610784 374
329 3300006852 Ga0075433_10088783 Ga0075433_100887833 374
330 3300006881 Ga0068865_100236260 Ga0068865_1002362602 374
331 3300006931 Ga0097620_100001484 Ga0097620_10000148412 374
332 3300006931 Ga0097620_100038177 Ga0097620_1000381773 374
333 3300009093 Ga0105240_10104866 Ga0105240_101048663 374
334 3300009094 Ga0111539_10081454 Ga0111539_100814543 374
335 3300009098 Ga0105245_10012549 Ga0105245_100125497 374
336 3300009098 Ga0105245_10017694 Ga0105245_100176944 374
337 3300009147 Ga0114129_10303683 Ga0114129_103036831 374
338 3300009174 Ga0105241_10029877 Ga0105241_100298772 374
339 3300009176 Ga0105242_10004238 Ga0105242_100042385 374
340 3300009177 Ga0105248_10001701 Ga0105248_1000170114 374
341 3300009177 Ga0105248_10031986 Ga0105248_100319864 374
342 3300009177 Ga0105248_10203890 Ga0105248_102038902 374
343 3300009545 Ga0105237_10039323 Ga0105237_100393232 374
344 3300009551 Ga0105238_10016683 Ga0105238_100166834 374
345 3300009553 Ga0105249_10122847 Ga0105249_101228472 374
346 3300010375 Ga0105239_10178514 Ga0105239_101785142 374
347 3300013100 Ga0157373_10002952 Ga0157373_1000295210 374
348 3300013104 Ga0157370_10003331 Ga0157370_1000333114 374
349 3300013104 Ga0157370_10022979 Ga0157370_100229795 374
350 3300013296 Ga0157374_10008557 Ga0157374_100085574 374
351 3300013297 Ga0157378_10008577 Ga0157378_100085778 374
352 3300013297 Ga0157378_10033393 Ga0157378_100333933 374
353 3300013297 Ga0157378_10037383 Ga0157378_100373834 374
354 3300013297 Ga0157378_10061140 Ga0157378_100611403 374
355 3300013306 Ga0163162_10002232 Ga0163162_100022325 374
356 3300013306 Ga0163162_10011501 Ga0163162_100115017 374
357 3300013306 Ga0163162_10126154 Ga0163162_101261544 374
358 3300013307 Ga0157372_10365208 Ga0157372_103652082 374
359 3300013308 Ga0157375_10007037 Ga0157375_1000703710 374
360 3300013308 Ga0157375_10009095 Ga0157375_100090956 374
361 3300013308 Ga0157375_10018722 Ga0157375_100187224 374
362 3300013308 Ga0157375_10080101 Ga0157375_100801013 374
363 3300013308 Ga0157375_10221684 Ga0157375_102216841 374
364 3300013308 Ga0157375_10254707 Ga0157375_102547073 374
365 3300014325 Ga0163163_10006684 Ga0163163_100066847 374
366 3300014325 Ga0163163_10029291 Ga0163163_100292912 374
367 3300014326 Ga0157380_10200639 Ga0157380_102006393 374
368 3300014745 Ga0157377_10040348 Ga0157377_100403482 374
369 3300014968 Ga0157379_10001106 Ga0157379_100011069 374
370 3300014968 Ga0157379_10002047 Ga0157379_100020476 374
371 3300014968 Ga0157379_10004185 Ga0157379_100041856 374
372 3300014968 Ga0157379_10041867 Ga0157379_100418672 374
373 3300014969 Ga0157376_10010457 Ga0157376_100104576 374
374 3300014969 Ga0157376_10036655 Ga0157376_100366554 374
375 3300014969 Ga0157376_10410644 Ga0157376_104106442 374
376 3300017792 Ga0163161_10130079 Ga0163161_101300792 374
377 3300020081 Ga0206354_10079593 Ga0206354_100795932 374
378 3300025893 Ga0207682_10005728 Ga0207682_100057284 374
379 3300025899 Ga0207642_10058381 Ga0207642_100583812 374
380 3300025900 Ga0207710_10105189 Ga0207710_101051892 374
381 3300025903 Ga0207680_10004153 Ga0207680_100041536 374
382 3300025903 Ga0207680_10006648 Ga0207680_100066485 374
383 3300025903 Ga0207680_10045643 Ga0207680_100456432 374
384 3300025907 Ga0207645_10001058 Ga0207645_1000105813 374
385 3300025907 Ga0207645_10004486 Ga0207645_100044866 374
386 3300025908 Ga0207643_10025251 Ga0207643_100252512 374
387 3300025908 Ga0207643_10088218 Ga0207643_100882182 374
388 3300025908 Ga0207643_10090492 Ga0207643_100904922 374
389 3300025910 Ga0207684_10017929 Ga0207684_100179295 374
390 3300025911 Ga0207654_10071894 Ga0207654_100718942 374
391 3300025912 Ga0207707_10008732 Ga0207707_100087325 374
392 3300025913 Ga0207695_10012077 Ga0207695_100120772 374
393 3300025914 Ga0207671_10063215 Ga0207671_100632151 374
394 3300025915 Ga0207693_10002176 Ga0207693_100021768 374
395 3300025917 Ga0207660_10013344 Ga0207660_100133445 374
396 3300025919 Ga0207657_10002834 Ga0207657_1000283415 374
397 3300025923 Ga0207681_10056838 Ga0207681_100568382 374
398 3300025924 Ga0207694_10128502 Ga0207694_101285022 374
399 3300025925 Ga0207650_10012006 Ga0207650_100120063 374
400 3300025925 Ga0207650_10026221 Ga0207650_100262214 374
401 3300025925 Ga0207650_10048116 Ga0207650_100481163 374
402 3300025926 Ga0207659_10002925 Ga0207659_100029253 374
403 3300025926 Ga0207659_10002989 Ga0207659_100029893 374
404 3300025926 Ga0207659_10004132 Ga0207659_100041325 374
405 3300025926 Ga0207659_10129714 Ga0207659_101297143 374
406 3300025927 Ga0207687_10001668 Ga0207687_1000166810 374
407 3300025927 Ga0207687_10094146 Ga0207687_100941462 374
408 3300025928 Ga0207700_10000031 Ga0207700_1000003134 374
409 3300025929 Ga0207664_10085794 Ga0207664_100857942 374
410 3300025931 Ga0207644_10005084 Ga0207644_100050849 374
411 3300025931 Ga0207644_10010927 Ga0207644_100109275 374
412 3300025931 Ga0207644_10014773 Ga0207644_100147734 374
413 3300025933 Ga0207706_10051087 Ga0207706_100510872 374
414 3300025934 Ga0207686_10000198 Ga0207686_100001986 374
415 3300025936 Ga0207670_10035455 Ga0207670_100354553 374
416 3300025937 Ga0207669_10006638 Ga0207669_100066384 374
417 3300025937 Ga0207669_10010632 Ga0207669_100106324 374
418 3300025937 Ga0207669_10026395 Ga0207669_100263952 374
419 3300025938 Ga0207704_10008017 Ga0207704_100080174 374
420 3300025939 Ga0207665_10061852 Ga0207665_100618522 374
421 3300025940 Ga0207691_10000006 Ga0207691_1000000613 374
422 3300025940 Ga0207691_10000041 Ga0207691_1000004175 374
423 3300025940 Ga0207691_10004308 Ga0207691_100043089 374
424 3300025940 Ga0207691_10009490 Ga0207691_100094903 374
425 3300025941 Ga0207711_10001347 Ga0207711_1000134713 374
426 3300025941 Ga0207711_10003428 Ga0207711_100034288 374
427 3300025941 Ga0207711_10221282 Ga0207711_102212821 374
428 3300025942 Ga0207689_10000042 Ga0207689_1000004283 374
429 3300025942 Ga0207689_10012114 Ga0207689_100121144 374
430 3300025942 Ga0207689_10250190 Ga0207689_102501902 374
431 3300025945 Ga0207679_10156752 Ga0207679_101567521 374
432 3300025945 Ga0207679_10190648 Ga0207679_101906482 374
433 3300025949 Ga0207667_10014732 Ga0207667_100147326 374
434 3300025949 Ga0207667_10033313 Ga0207667_100333133 374
435 3300025960 Ga0207651_10000821 Ga0207651_1000082111 374
436 3300025960 Ga0207651_10001393 Ga0207651_100013937 374
437 3300025960 Ga0207651_10003097 Ga0207651_100030977 374
438 3300025960 Ga0207651_10007836 Ga0207651_100078362 374
439 3300025961 Ga0207712_10122671 Ga0207712_101226712 374
440 3300025972 Ga0207668_10001997 Ga0207668_100019972 374
441 3300025972 Ga0207668_10063947 Ga0207668_100639472 374
442 3300025986 Ga0207658_10006384 Ga0207658_100063844 374
443 3300025986 Ga0207658_10006722 Ga0207658_100067224 374
444 3300025986 Ga0207658_10010407 Ga0207658_100104074 374
445 3300025986 Ga0207658_10044284 Ga0207658_100442842 374
446 3300025986 Ga0207658_10155158 Ga0207658_101551582 374
447 3300026023 Ga0207677_10000799 Ga0207677_100007994 374
448 3300026023 Ga0207677_10017124 Ga0207677_100171243 374
449 3300026023 Ga0207677_10021263 Ga0207677_100212634 374
450 3300026023 Ga0207677_10031777 Ga0207677_100317772 374
451 3300026023 Ga0207677_10079362 Ga0207677_100793622 374
452 3300026035 Ga0207703_10000143 Ga0207703_100001434 374
453 3300026035 Ga0207703_10001515 Ga0207703_1000151517 374
454 3300026035 Ga0207703_10009453 Ga0207703_100094537 374
455 3300026035 Ga0207703_10014450 Ga0207703_100144504 374
456 3300026035 Ga0207703_10015029 Ga0207703_100150296 374
457 3300026035 Ga0207703_10223532 Ga0207703_102235322 374
458 3300026035 Ga0207703_10239777 Ga0207703_102397772 374
459 3300026041 Ga0207639_10141048 Ga0207639_101410482 374
460 3300026067 Ga0207678_10003847 Ga0207678_100038475 374
461 3300026067 Ga0207678_10112885 Ga0207678_101128852 374
462 3300026078 Ga0207702_10044512 Ga0207702_100445124 374
463 3300026088 Ga0207641_10008173 Ga0207641_100081734 374
464 3300026088 Ga0207641_10009450 Ga0207641_100094507 374
465 3300026088 Ga0207641_10028656 Ga0207641_100286564 374
466 3300026088 Ga0207641_10030138 Ga0207641_100301382 374
467 3300026088 Ga0207641_10030311 Ga0207641_100303112 374
468 3300026088 Ga0207641_10080760 Ga0207641_100807602 374
469 3300026088 Ga0207641_10131588 Ga0207641_101315882 374
470 3300026089 Ga0207648_10000601 Ga0207648_1000060122 374
471 3300026089 Ga0207648_10002730 Ga0207648_1000273013 374
472 3300026089 Ga0207648_10005057 Ga0207648_1000505711 374
473 3300026089 Ga0207648_10304792 Ga0207648_103047921 374
474 3300026095 Ga0207676_10000837 Ga0207676_1000083714 374
475 3300026095 Ga0207676_10004178 Ga0207676_100041784 374
476 3300026095 Ga0207676_10012832 Ga0207676_100128324 374
477 3300026095 Ga0207676_10390525 Ga0207676_103905251 374
478 3300026116 Ga0207674_10001272 Ga0207674_100012725 374
479 3300026116 Ga0207674_10003466 Ga0207674_100034667 374
480 3300026118 Ga0207675_100000517 Ga0207675_10000051725 374
481 3300026118 Ga0207675_100034799 Ga0207675_1000347993 374
482 3300026118 Ga0207675_100274420 Ga0207675_1002744202 374
483 3300026121 Ga0207683_10000011 Ga0207683_1000001142 374
484 3300026121 Ga0207683_10002753 Ga0207683_1000275310 374
485 3300026121 Ga0207683_10006764 Ga0207683_100067647 374
486 3300026121 Ga0207683_10010698 Ga0207683_100106985 374
487 3300026142 Ga0207698_10006726 Ga0207698_100067264 374
488 3300026142 Ga0207698_10282944 Ga0207698_102829442 374
489 3300028379 Ga0268266_10002385 Ga0268266_100023859 374
490 3300028379 Ga0268266_10025406 Ga0268266_100254062 374
491 3300028379 Ga0268266_10037041 Ga0268266_100370413 374
492 3300028379 Ga0268266_10071429 Ga0268266_100714293 374
493 3300028381 Ga0268264_10000641 Ga0268264_1000064121 374
494 3300028381 Ga0268264_10003919 Ga0268264_100039194 374
495 3300028381 Ga0268264_10039987 Ga0268264_100399871 374
496 3300031235 Ga0265330_10006553 Ga0265330_100065533 374
497 3300031241 Ga0265325_10042004 Ga0265325_100420042 374
498 3300031250 Ga0265331_10000310 Ga0265331_1000031036 374
499 3300031251 Ga0265327_10002920 Ga0265327_1000292010 374
500 3300031344 Ga0265316_10015797 Ga0265316_100157973 374
501 3300031711 Ga0265314_10003412 Ga0265314_100034129 374
502 3300031712 Ga0265342_10011276 Ga0265342_100112763 374
503 3300035118 Ga0373954_0002126 Ga0373954_0002126_6105_7265 374
504 3300035119 Ga0373956_0014030 Ga0373956_0014030_81_1241 374
505 3300035170 Ga0373943_0015419 Ga0373943_0015419_521_1681 374
506 3300035171 Ga0373946_0081085 Ga0373946_0081085_173_1312 374
507 3300035172 Ga0373955_0008031 Ga0373955_0008031_3018_4178 374
508 3300035172 Ga0373955_0073608 Ga0373955_0073608_209_1369 374
509 3300035410 Ga0373924_0016252 Ga0373924_0016252_334_1494 374
510 3300035692 Ga0373935_0021847 Ga0373935_0021847_1098_2258 374
511 3300035724 Ga0373933_0003333 Ga0373933_0003333_2886_4046 374
512 3300035725 Ga0373947_0020754 Ga0373947_0020754_442_1602 374
513 3300035725 Ga0373947_0025241 Ga0373947_0025241_2027_3187 374
514 3300036401 Ga0373937_0026978 Ga0373937_0026978_1267_2406 374
515 3300036401 Ga0373937_0125447 Ga0373937_0125447_915_2075 374
516 3300036401 Ga0373937_0218694 Ga0373937_0218694_37_1251 374
517 3300037068 Ga0373925_0009503 Ga0373925_0009503_4465_5625 374
518 3300037068 Ga0373925_0013381 Ga0373925_0013381_2807_3967 374
519 3300037068 Ga0373925_0078847 Ga0373925_0078847_1084_2223 374
520 3300037418 Ga0395900_0155145 Ga0395900_0155145_154_1278 374
521 3300037471 Ga0395905_0022658 Ga0395905_0022658_2639_3763 374
522 3300046459 Ga0495629_0008490 Ga0495629_0008490_5493_6653 374
523 3300046472 Ga0495580_0020023 Ga0495580_0020023_3288_4448 374
524 3300046472 Ga0495580_0119519 Ga0495580_0119519_366_1505 374
525 3300046473 Ga0495582_0005046 Ga0495582_0005046_2341_3501 374
526 3300046475 Ga0495639_0020731 Ga0495639_0020731_835_1995 374
527 3300046476 Ga0495662_0040418 Ga0495662_0040418_401_1561 374
528 3300046499 Ga0495594_0016481 Ga0495594_0016481_2501_3661 374
529 3300046516 Ga0495628_0028581 Ga0495628_0028581_1370_2530 374
530 3300046517 Ga0495630_0052254 Ga0495630_0052254_183_1343 374
531 3300046533 Ga0495640_0016426 Ga0495640_0016426_31_1191 374
532 3300046539 Ga0495621_0013853 Ga0495621_0013853_1259_2419 374
533 3300046559 Ga0495667_0047399 Ga0495667_0047399_210_1370 374
534 3300046663 Ga0495635_0010528 Ga0495635_0010528_3789_4949 374
535 3300046689 Ga0495613_0007994 Ga0495613_0007994_3784_4944 374
536 3300046809 Ga0495600_0109080 Ga0495600_0109080_487_1647 374
537 3300047315 Ga0495581_0001341 Ga0495581_0001341_6988_8148 374
538 3300047322 Ga0495680_0030368 Ga0495680_0030368_2179_3339 374
539 3300047444 Ga0495675_0059610 Ga0495675_0059610_642_1802 374
540 3300047471 Ga0495684_0056914 Ga0495684_0056914_510_1670 374
541 3300048089 Ga0495614_0008895 Ga0495614_0008895_2463_3623 374
542 3300048904 Ga0496101_0022598 Ga0496101_0022598_754_1914 374
543 3300048907 Ga0496104_0008261 Ga0496104_0008261_2780_3940 374
544 3300048908 Ga0496105_0137078 Ga0496105_0137078_565_1725 374
545 3300048910 Ga0496107_0010009 Ga0496107_0010009_2574_3734 374
546 3300048912 Ga0496109_0032033 Ga0496109_0032033_2906_4066 374
547 3300048912 Ga0496109_0155744 Ga0496109_0155744_487_1638 374
548 3300048913 Ga0496110_0143498 Ga0496110_0143498_389_1549 374
549 3300048918 Ga0496115_0042441 Ga0496115_0042441_1500_2660 374
550 3300048918 Ga0496115_0076359 Ga0496115_0076359_1394_2536 374
551 3300049586 Ga0501070_0109039 Ga0501070_0109039_257_1420 374
552 3300050511 nmdc:mga08y16_119884_c1 nmdc:mga08y16_119884_c1_388_1533 374
553 3300050513 nmdc:mga0rr50_162288_c1 nmdc:mga0rr50_162288_c1_82_1224 374
554 3300050515 nmdc:mga0a205_90977_c1 nmdc:mga0a205_90977_c1_86_1228 374
555 3300053085 Ga0495619_0023365 Ga0495619_0023365_1455_2615 374

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

36

397

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lc3-assembly1.cif.gz_B x-ray crystal structure of a putative udp-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from burkholderia cenocepacia 0.9629 2 372
1mdo-assembly1.cif.gz_A crystal structure of arnb aminotransferase with pyridomine 5' phosphate 0.9531 4 372
4lc3-assembly1.cif.gz_B x-ray crystal structure of a putative udp-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from burkholderia cenocepacia 0.9528 2 372
8su6-assembly1.cif.gz_B crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) 0.9522 4 370
8snj-assembly3.cif.gz_E crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form) 0.9518 4 370
ID Description Score Start End Superfamily
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9719 2 244 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9642 4 244 3.40.640.10
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9641 2 244 3.40.640.10
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9539 1 244 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9524 4 244 3.40.640.10
ID Description Score Start End GO Terms
AF-X0VYK0-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9776 14 155 GO:0000271
GO:0008483
GO:0030170
AF-A0A3N5MYN8-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9735 55 371 GO:0000271
GO:0008483
GO:0030170
AF-X1L0T4-F1-model_v4 Aminotransferase class I/classII domain-containing protein 0.9718 39 153 GO:0000271
GO:0008483
GO:0030170
AF-A0A2J0LSW6-F1-model_v4 UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase 0.9713 5 191 GO:0000271
GO:0008483
GO:0030170
AF-A0A3L9I879-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.971 1 212 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
95.87 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map