F463077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 269 | 555 | 379 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100005849|Ga0070706_10000584910 |
| Length | 405 |
| Sequence | MSAAGPPQGANRAPSGGSAAAPAAPVTAGYLKFAGPLLDETTIAGVDDVLRSGHIASGPWVQKFEARLSAFCGGRPVRVLTSATAAVEVALQLCGIGPGDEVITSAQSFFTVLNMIVKVGATPVFVDCDLVTRNIDLRQIEAAITPRTRAIIPTHYSGALVDMDALFALAQRHRLRVIEDAALVIGSRWKGRNVGAFGDLTTFSFHPNKNITSIEGGALVVNDDAEAKRVEALRFHGITYLPDRTRDVAFPGGKFNLPDVNARIGHDQLERLPQFLTRRRALVGRYFAKLATDPPCVLPPQPKDGDDDGHSWNMFCVLLPLDRLTISRKQFRDALEARGIATGVSYEALHLTTLGRRYGGHDGQFPNAERVSRETVTLPLHAGMTEPDVDRVCAAVAAVIAAGRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 176 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.62 |
| Rhizosphere | 98.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10023833 | 3300005327 | Bacteria | 4909 |
| 2 | Ga0070676_10005737 | 3300005328 | Bacteria | 6617 |
| 3 | Ga0070676_10009931 | 3300005328 | Bacteria | 5153 |
| 4 | Ga0070683_100026675 | 3300005329 | Bacteria | 5205 |
| 5 | Ga0070690_100018294 | 3300005330 | Bacteria | 4231 |
| 6 | Ga0070690_100190043 | 3300005330 | Bacteria | 1423 |
| 7 | Ga0070670_100029157 | 3300005331 | Bacteria | 4749 |
| 8 | Ga0070670_100039569 | 3300005331 | Bacteria | 4054 |
| 9 | Ga0070670_100140288 | 3300005331 | Bacteria | 2090 |
| 10 | Ga0070670_100259454 | 3300005331 | Bacteria | 1515 |
| 11 | Ga0070677_10000965 | 3300005333 | Bacteria | 9288 |
| 12 | Ga0068869_100000388 | 3300005334 | Bacteria | 23946 |
| 13 | Ga0068869_100008272 | 3300005334 | Bacteria | 6701 |
| 14 | Ga0070666_10000887 | 3300005335 | Bacteria | 18198 |
| 15 | Ga0070666_10007056 | 3300005335 | Bacteria | 6923 |
| 16 | Ga0070666_10056165 | 3300005335 | Bacteria | 2658 |
| 17 | Ga0070666_10179563 | 3300005335 | Bacteria | 1484 |
| 18 | Ga0070680_100167271 | 3300005336 | Bacteria | 1849 |
| 19 | Ga0070680_100180992 | 3300005336 | Bacteria | 1775 |
| 20 | Ga0068868_100003424 | 3300005338 | Bacteria | 11040 |
| 21 | Ga0068868_100008218 | 3300005338 | Bacteria | 7467 |
| 22 | Ga0068868_100022058 | 3300005338 | Bacteria | 4801 |
| 23 | Ga0068868_100052818 | 3300005338 | Bacteria | 3199 |
| 24 | Ga0070660_100021172 | 3300005339 | Bacteria | 4791 |
| 25 | Ga0070689_100005389 | 3300005340 | Bacteria | 8727 |
| 26 | Ga0070689_100066377 | 3300005340 | Bacteria | 2811 |
| 27 | Ga0070661_100007598 | 3300005344 | Bacteria | 7477 |
| 28 | Ga0070661_100008547 | 3300005344 | Bacteria | 7080 |
| 29 | Ga0070692_10019262 | 3300005345 | Bacteria | 3291 |
| 30 | Ga0070668_100004358 | 3300005347 | Bacteria | 10499 |
| 31 | Ga0070668_100013627 | 3300005347 | Bacteria | 6070 |
| 32 | Ga0070668_100019525 | 3300005347 | Bacteria | 5101 |
| 33 | Ga0070668_100068530 | 3300005347 | Bacteria | 2758 |
| 34 | Ga0070668_100090992 | 3300005347 | Bacteria | 2404 |
| 35 | Ga0070669_100002694 | 3300005353 | Bacteria | 12804 |
| 36 | Ga0070669_100117884 | 3300005353 | Bacteria | 2021 |
| 37 | Ga0070675_100000476 | 3300005354 | Bacteria | 27409 |
| 38 | Ga0070675_100001764 | 3300005354 | Bacteria | 15948 |
| 39 | Ga0070675_100013648 | 3300005354 | Bacteria | 6390 |
| 40 | Ga0070675_100090301 | 3300005354 | Bacteria | 2566 |
| 41 | Ga0070671_100002250 | 3300005355 | Bacteria | 14903 |
| 42 | Ga0070671_100002660 | 3300005355 | Bacteria | 13841 |
| 43 | Ga0070671_100011370 | 3300005355 | Bacteria | 7156 |
| 44 | Ga0070671_100021544 | 3300005355 | Bacteria | 5264 |
| 45 | Ga0070674_100000409 | 3300005356 | Bacteria | 21616 |
| 46 | Ga0070674_100004979 | 3300005356 | Bacteria | 7618 |
| 47 | Ga0070673_100000781 | 3300005364 | Bacteria | 17709 |
| 48 | Ga0070673_100001204 | 3300005364 | Bacteria | 14918 |
| 49 | Ga0070673_100007406 | 3300005364 | Bacteria | 7235 |
| 50 | Ga0070673_100020203 | 3300005364 | Bacteria | 4800 |
| 51 | Ga0070688_100002928 | 3300005365 | Bacteria | 8705 |
| 52 | Ga0070659_100008939 | 3300005366 | Bacteria | 7343 |
| 53 | Ga0070659_100170020 | 3300005366 | Bacteria | 1785 |
| 54 | Ga0070667_100000550 | 3300005367 | Bacteria | 37298 |
| 55 | Ga0070667_100006019 | 3300005367 | Bacteria | 10080 |
| 56 | Ga0070667_100017448 | 3300005367 | Bacteria | 5949 |
| 57 | Ga0070667_100090872 | 3300005367 | Bacteria | 2624 |
| 58 | Ga0070667_100125814 | 3300005367 | Bacteria | 2233 |
| 59 | Ga0070667_100201023 | 3300005367 | Bacteria | 1768 |
| 60 | Ga0070667_100223800 | 3300005367 | Bacteria | 1675 |
| 61 | Ga0070714_100007199 | 3300005435 | Bacteria | 8635 |
| 62 | Ga0070713_100000182 | 3300005436 | Bacteria | 41753 |
| 63 | Ga0070713_100003475 | 3300005436 | Bacteria | 10398 |
| 64 | Ga0070710_10012581 | 3300005437 | Bacteria | 4207 |
| 65 | Ga0070711_100011287 | 3300005439 | Bacteria | 5542 |
| 66 | Ga0070711_100027989 | 3300005439 | Bacteria | 3705 |
| 67 | Ga0070705_100099990 | 3300005440 | Bacteria | 1829 |
| 68 | Ga0070700_100027897 | 3300005441 | Bacteria | 3353 |
| 69 | Ga0070708_100000207 | 3300005445 | Bacteria | 43511 |
| 70 | Ga0070663_100087431 | 3300005455 | Bacteria | 2304 |
| 71 | Ga0070663_100219825 | 3300005455 | Bacteria | 1491 |
| 72 | Ga0070678_100000200 | 3300005456 | Bacteria | 26391 |
| 73 | Ga0070678_100000560 | 3300005456 | Bacteria | 18164 |
| 74 | Ga0070678_100000872 | 3300005456 | Bacteria | 15445 |
| 75 | Ga0070678_100009611 | 3300005456 | Bacteria | 5871 |
| 76 | Ga0070662_100038470 | 3300005457 | Bacteria | 3398 |
| 77 | Ga0070662_100103595 | 3300005457 | Bacteria | 2158 |
| 78 | Ga0070681_10001277 | 3300005458 | Bacteria | 21960 |
| 79 | Ga0068867_100001219 | 3300005459 | Bacteria | 17696 |
| 80 | Ga0068867_100001865 | 3300005459 | Bacteria | 14641 |
| 81 | Ga0068867_100016645 | 3300005459 | Bacteria | 5222 |
| 82 | Ga0068867_100226490 | 3300005459 | Bacteria | 1509 |
| 83 | Ga0070685_10004553 | 3300005466 | Bacteria | 7019 |
| 84 | Ga0070685_10112884 | 3300005466 | Bacteria | 1677 |
| 85 | Ga0070706_100005849 | 3300005467 | Bacteria | 11666 |
| 86 | Ga0070698_100163402 | 3300005471 | Bacteria | 2170 |
| 87 | Ga0070699_100039995 | 3300005518 | Bacteria | 4061 |
| 88 | Ga0070699_100210529 | 3300005518 | Bacteria | 1730 |
| 89 | Ga0070679_100020307 | 3300005530 | Bacteria | 6473 |
| 90 | Ga0070679_100100348 | 3300005530 | Bacteria | 2881 |
| 91 | Ga0070684_100158649 | 3300005535 | Bacteria | 2051 |
| 92 | Ga0070697_100024935 | 3300005536 | Bacteria | 4765 |
| 93 | Ga0068853_100011739 | 3300005539 | Bacteria | 7119 |
| 94 | Ga0068853_100021304 | 3300005539 | Bacteria | 5403 |
| 95 | Ga0068853_100026414 | 3300005539 | Bacteria | 4875 |
| 96 | Ga0070672_100006366 | 3300005543 | Bacteria | 7927 |
| 97 | Ga0070672_100008331 | 3300005543 | Bacteria | 7084 |
| 98 | Ga0070672_100025038 | 3300005543 | Bacteria | 4420 |
| 99 | Ga0070672_100051651 | 3300005543 | Bacteria | 3207 |
| 100 | Ga0070696_100013351 | 3300005546 | Bacteria | 5511 |
| 101 | Ga0070696_100064866 | 3300005546 | Bacteria | 2560 |
| 102 | Ga0070693_100000167 | 3300005547 | Bacteria | 30641 |
| 103 | Ga0070693_100006121 | 3300005547 | Bacteria | 5829 |
| 104 | Ga0070693_100082558 | 3300005547 | Bacteria | 1919 |
| 105 | Ga0070693_100108596 | 3300005547 | Bacteria | 1703 |
| 106 | Ga0070665_100001447 | 3300005548 | Bacteria | 27820 |
| 107 | Ga0070665_100005172 | 3300005548 | Bacteria | 13499 |
| 108 | Ga0070665_100025304 | 3300005548 | Bacteria | 5980 |
| 109 | Ga0070665_100055050 | 3300005548 | Bacteria | 3990 |
| 110 | Ga0070665_100154584 | 3300005548 | Bacteria | 2296 |
| 111 | Ga0070704_100113396 | 3300005549 | Bacteria | 2067 |
| 112 | Ga0068855_100011856 | 3300005563 | Bacteria | 10538 |
| 113 | Ga0068855_100012552 | 3300005563 | Bacteria | 10226 |
| 114 | Ga0068855_100041106 | 3300005563 | Bacteria | 5482 |
| 115 | Ga0068855_100048381 | 3300005563 | Bacteria | 5018 |
| 116 | Ga0068855_100126978 | 3300005563 | Bacteria | 2915 |
| 117 | Ga0068855_100154592 | 3300005563 | Bacteria | 2607 |
| 118 | Ga0070664_100001452 | 3300005564 | Bacteria | 18888 |
| 119 | Ga0070664_100012048 | 3300005564 | Bacteria | 7024 |
| 120 | Ga0070664_100161412 | 3300005564 | Bacteria | 1983 |
| 121 | Ga0068857_100001623 | 3300005577 | Bacteria | 18065 |
| 122 | Ga0068857_100001739 | 3300005577 | Bacteria | 17512 |
| 123 | Ga0068857_100114759 | 3300005577 | Bacteria | 2423 |
| 124 | Ga0068857_100181611 | 3300005577 | Bacteria | 1915 |
| 125 | Ga0068854_100002132 | 3300005578 | Bacteria | 12146 |
| 126 | Ga0068854_100002439 | 3300005578 | Bacteria | 11499 |
| 127 | Ga0068856_100001396 | 3300005614 | Bacteria | 25298 |
| 128 | Ga0068856_100006138 | 3300005614 | Bacteria | 11793 |
| 129 | Ga0068856_100043206 | 3300005614 | Bacteria | 4434 |
| 130 | Ga0068856_100101918 | 3300005614 | Bacteria | 2864 |
| 131 | Ga0068856_100113517 | 3300005614 | Bacteria | 2707 |
| 132 | Ga0068852_100001471 | 3300005616 | Bacteria | 15936 |
| 133 | Ga0068852_100006246 | 3300005616 | Bacteria | 8595 |
| 134 | Ga0068859_100001484 | 3300005617 | Bacteria | 23877 |
| 135 | Ga0068859_100038177 | 3300005617 | Bacteria | 4819 |
| 136 | Ga0068859_100502821 | 3300005617 | Bacteria | 1307 |
| 137 | Ga0068864_100002372 | 3300005618 | Bacteria | 15584 |
| 138 | Ga0068864_100023093 | 3300005618 | Bacteria | 5222 |
| 139 | Ga0068864_100026603 | 3300005618 | Bacteria | 4879 |
| 140 | Ga0068864_100149498 | 3300005618 | Bacteria | 2114 |
| 141 | Ga0068866_10000527 | 3300005718 | Bacteria | 17621 |
| 142 | Ga0068866_10033784 | 3300005718 | Bacteria | 2485 |
| 143 | Ga0068861_100000187 | 3300005719 | Bacteria | 33035 |
| 144 | Ga0068861_100159606 | 3300005719 | Bacteria | 1859 |
| 145 | Ga0068851_10000301 | 3300005834 | Bacteria | 22575 |
| 146 | Ga0068851_10003419 | 3300005834 | Bacteria | 7068 |
| 147 | Ga0068851_10003959 | 3300005834 | Bacteria | 6632 |
| 148 | Ga0068851_10010426 | 3300005834 | Bacteria | 4340 |
| 149 | Ga0068870_10088432 | 3300005840 | Bacteria | 1727 |
| 150 | Ga0068863_100006037 | 3300005841 | Bacteria | 11882 |
| 151 | Ga0068863_100013076 | 3300005841 | Bacteria | 8006 |
| 152 | Ga0068863_100019995 | 3300005841 | Bacteria | 6404 |
| 153 | Ga0068863_100028429 | 3300005841 | Bacteria | 5339 |
| 154 | Ga0068858_100008319 | 3300005842 | Bacteria | 9979 |
| 155 | Ga0068858_100017079 | 3300005842 | Bacteria | 6811 |
| 156 | Ga0068858_100017145 | 3300005842 | Bacteria | 6796 |
| 157 | Ga0068858_100018888 | 3300005842 | Bacteria | 6450 |
| 158 | Ga0068858_100019815 | 3300005842 | Bacteria | 6288 |
| 159 | Ga0068858_100238176 | 3300005842 | Bacteria | 1726 |
| 160 | Ga0068860_100002049 | 3300005843 | Bacteria | 21245 |
| 161 | Ga0068860_100003430 | 3300005843 | Bacteria | 16298 |
| 162 | Ga0068860_100011724 | 3300005843 | Bacteria | 8639 |
| 163 | Ga0068860_100027211 | 3300005843 | Bacteria | 5509 |
| 164 | Ga0068860_100056842 | 3300005843 | Bacteria | 3718 |
| 165 | Ga0068860_100268368 | 3300005843 | Bacteria | 1665 |
| 166 | Ga0068860_100372331 | 3300005843 | Bacteria | 1409 |
| 167 | Ga0081455_10078253 | 3300005937 | Bacteria | 2717 |
| 168 | Ga0070715_10005192 | 3300006163 | Bacteria | 4327 |
| 169 | Ga0070716_100056439 | 3300006173 | Bacteria | 2252 |
| 170 | Ga0070712_100089073 | 3300006175 | Bacteria | 2256 |
| 171 | Ga0097621_100000972 | 3300006237 | Bacteria | 20078 |
| 172 | Ga0097621_100009045 | 3300006237 | Bacteria | 7215 |
| 173 | Ga0097621_100024835 | 3300006237 | Bacteria | 4685 |
| 174 | Ga0097621_100059281 | 3300006237 | Bacteria | 3133 |
| 175 | Ga0097621_100066120 | 3300006237 | Bacteria | 2977 |
| 176 | Ga0097621_100066895 | 3300006237 | Bacteria | 2960 |
| 177 | Ga0068871_100009526 | 3300006358 | Bacteria | 7046 |
| 178 | Ga0068871_100013937 | 3300006358 | Bacteria | 5977 |
| 179 | Ga0068871_100017726 | 3300006358 | Bacteria | 5396 |
| 180 | Ga0068871_100044019 | 3300006358 | Bacteria | 3588 |
| 181 | Ga0068871_100093173 | 3300006358 | Bacteria | 2513 |
| 182 | Ga0068871_100206605 | 3300006358 | Bacteria | 1697 |
| 183 | Ga0075428_100061078 | 3300006844 | Bacteria | 4126 |
| 184 | Ga0075433_10088783 | 3300006852 | Bacteria | 2732 |
| 185 | Ga0068865_100094791 | 3300006881 | Bacteria | 2173 |
| 186 | Ga0068865_100236260 | 3300006881 | Bacteria | 1436 |
| 187 | Ga0075436_100001328 | 3300006914 | Bacteria | 16813 |
| 188 | Ga0075436_100035416 | 3300006914 | Bacteria | 3444 |
| 189 | Ga0097620_100001484 | 3300006931 | Bacteria | 23877 |
| 190 | Ga0097620_100038177 | 3300006931 | Bacteria | 4819 |
| 191 | Ga0097620_100502857 | 3300006931 | Bacteria | 1307 |
| 192 | Ga0075435_100114440 | 3300007076 | Bacteria | 2246 |
| 193 | Ga0099795_10001771 | 3300007788 | Bacteria | 4837 |
| 194 | Ga0105240_10017865 | 3300009093 | Bacteria | 9542 |
| 195 | Ga0105240_10039354 | 3300009093 | Bacteria | 6056 |
| 196 | Ga0105240_10104866 | 3300009093 | Bacteria | 3432 |
| 197 | Ga0105240_10302062 | 3300009093 | Bacteria | 1831 |
| 198 | Ga0111539_10081454 | 3300009094 | Bacteria | 3807 |
| 199 | Ga0105245_10008983 | 3300009098 | Bacteria | 8716 |
| 200 | Ga0105245_10012549 | 3300009098 | Bacteria | 7374 |
| 201 | Ga0105245_10017694 | 3300009098 | Bacteria | 6222 |
| 202 | Ga0105245_10040997 | 3300009098 | Bacteria | 4126 |
| 203 | Ga0114129_10303683 | 3300009147 | Bacteria | 2126 |
| 204 | Ga0105243_10154794 | 3300009148 | Bacteria | 1970 |
| 205 | Ga0105241_10029877 | 3300009174 | Bacteria | 4069 |
| 206 | Ga0105241_10045265 | 3300009174 | Bacteria | 3338 |
| 207 | Ga0105242_10004238 | 3300009176 | Bacteria | 11181 |
| 208 | Ga0105242_10056040 | 3300009176 | Bacteria | 3225 |
| 209 | Ga0105242_10063186 | 3300009176 | Bacteria | 3049 |
| 210 | Ga0105248_10001701 | 3300009177 | Bacteria | 24486 |
| 211 | Ga0105248_10031986 | 3300009177 | Bacteria | 5878 |
| 212 | Ga0105248_10203890 | 3300009177 | Bacteria | 2228 |
| 213 | Ga0105237_10039323 | 3300009545 | Bacteria | 4775 |
| 214 | Ga0105237_10356366 | 3300009545 | Bacteria | 1467 |
| 215 | Ga0105238_10007592 | 3300009551 | Bacteria | 10864 |
| 216 | Ga0105238_10008362 | 3300009551 | Bacteria | 10352 |
| 217 | Ga0105238_10016683 | 3300009551 | Bacteria | 7440 |
| 218 | Ga0105249_10121542 | 3300009553 | Bacteria | 2482 |
| 219 | Ga0105249_10122847 | 3300009553 | Bacteria | 2470 |
| 220 | Ga0105239_10178514 | 3300010375 | Bacteria | 2375 |
| 221 | Ga0157373_10002952 | 3300013100 | Bacteria | 12886 |
| 222 | Ga0157373_10055370 | 3300013100 | Bacteria | 2818 |
| 223 | Ga0157370_10003331 | 3300013104 | Bacteria | 18930 |
| 224 | Ga0157370_10005403 | 3300013104 | Bacteria | 14332 |
| 225 | Ga0157370_10008356 | 3300013104 | Bacteria | 11165 |
| 226 | Ga0157370_10022979 | 3300013104 | Bacteria | 6197 |
| 227 | Ga0157370_10120075 | 3300013104 | Bacteria | 2454 |
| 228 | Ga0157369_10014458 | 3300013105 | Bacteria | 8911 |
| 229 | Ga0157369_10303685 | 3300013105 | Bacteria | 1660 |
| 230 | Ga0157369_10344852 | 3300013105 | Bacteria | 1547 |
| 231 | Ga0157369_10469388 | 3300013105 | Bacteria | 1303 |
| 232 | Ga0157374_10008557 | 3300013296 | Bacteria | 8753 |
| 233 | Ga0157374_10018979 | 3300013296 | Bacteria | 6082 |
| 234 | Ga0157374_10053370 | 3300013296 | Bacteria | 3768 |
| 235 | Ga0157378_10008577 | 3300013297 | Bacteria | 8897 |
| 236 | Ga0157378_10029958 | 3300013297 | Bacteria | 4806 |
| 237 | Ga0157378_10033393 | 3300013297 | Bacteria | 4548 |
| 238 | Ga0157378_10037383 | 3300013297 | Bacteria | 4299 |
| 239 | Ga0157378_10061140 | 3300013297 | Bacteria | 3360 |
| 240 | Ga0163162_10002232 | 3300013306 | Bacteria | 18196 |
| 241 | Ga0163162_10011501 | 3300013306 | Bacteria | 8631 |
| 242 | Ga0163162_10126154 | 3300013306 | Bacteria | 2665 |
| 243 | Ga0157372_10037903 | 3300013307 | Bacteria | 5319 |
| 244 | Ga0157372_10045554 | 3300013307 | Bacteria | 4867 |
| 245 | Ga0157372_10046153 | 3300013307 | Bacteria | 4836 |
| 246 | Ga0157372_10365208 | 3300013307 | Bacteria | 1682 |
| 247 | Ga0157375_10007037 | 3300013308 | Bacteria | 9826 |
| 248 | Ga0157375_10009095 | 3300013308 | Bacteria | 8701 |
| 249 | Ga0157375_10018722 | 3300013308 | Bacteria | 6284 |
| 250 | Ga0157375_10044200 | 3300013308 | Bacteria | 4326 |
| 251 | Ga0157375_10080101 | 3300013308 | Bacteria | 3303 |
| 252 | Ga0157375_10221684 | 3300013308 | Bacteria | 2049 |
| 253 | Ga0157375_10254707 | 3300013308 | Bacteria | 1916 |
| 254 | Ga0163163_10006684 | 3300014325 | Bacteria | 10104 |
| 255 | Ga0163163_10029291 | 3300014325 | Bacteria | 5296 |
| 256 | Ga0157380_10021787 | 3300014326 | Bacteria | 4812 |
| 257 | Ga0157380_10200639 | 3300014326 | Bacteria | 1769 |
| 258 | Ga0182008_10048811 | 3300014497 | Bacteria | 2102 |
| 259 | Ga0157377_10019759 | 3300014745 | Bacteria | 3522 |
| 260 | Ga0157377_10040348 | 3300014745 | Bacteria | 2584 |
| 261 | Ga0157379_10001106 | 3300014968 | Bacteria | 22048 |
| 262 | Ga0157379_10002047 | 3300014968 | Bacteria | 16745 |
| 263 | Ga0157379_10004185 | 3300014968 | Bacteria | 12322 |
| 264 | Ga0157379_10041867 | 3300014968 | Bacteria | 4088 |
| 265 | Ga0157376_10010457 | 3300014969 | Bacteria | 6788 |
| 266 | Ga0157376_10036655 | 3300014969 | Bacteria | 3974 |
| 267 | Ga0157376_10410644 | 3300014969 | Bacteria | 1311 |
| 268 | Ga0163161_10130079 | 3300017792 | Bacteria | 1898 |
| 269 | Ga0206354_10079593 | 3300020081 | Bacteria | 1784 |
| 270 | Ga0207656_10019308 | 3300025321 | Bacteria | 2696 |
| 271 | Ga0207682_10005728 | 3300025893 | Bacteria | 5039 |
| 272 | Ga0207692_10062141 | 3300025898 | Bacteria | 1938 |
| 273 | Ga0207642_10058381 | 3300025899 | Bacteria | 1780 |
| 274 | Ga0207710_10105189 | 3300025900 | Bacteria | 1335 |
| 275 | Ga0207680_10004153 | 3300025903 | Bacteria | 6857 |
| 276 | Ga0207680_10006648 | 3300025903 | Bacteria | 5610 |
| 277 | Ga0207680_10045643 | 3300025903 | Bacteria | 2585 |
| 278 | Ga0207699_10023483 | 3300025906 | Bacteria | 3356 |
| 279 | Ga0207645_10001058 | 3300025907 | Bacteria | 22793 |
| 280 | Ga0207645_10004486 | 3300025907 | Bacteria | 10330 |
| 281 | Ga0207643_10025251 | 3300025908 | Bacteria | 3283 |
| 282 | Ga0207643_10088218 | 3300025908 | Bacteria | 1805 |
| 283 | Ga0207643_10090492 | 3300025908 | Bacteria | 1784 |
| 284 | Ga0207684_10017929 | 3300025910 | Bacteria | 6069 |
| 285 | Ga0207654_10037034 | 3300025911 | Bacteria | 2729 |
| 286 | Ga0207654_10071894 | 3300025911 | Bacteria | 2058 |
| 287 | Ga0207707_10008732 | 3300025912 | Bacteria | 8793 |
| 288 | Ga0207695_10012077 | 3300025913 | Bacteria | 10382 |
| 289 | Ga0207695_10025748 | 3300025913 | Bacteria | 6578 |
| 290 | Ga0207671_10063215 | 3300025914 | Bacteria | 2750 |
| 291 | Ga0207693_10002176 | 3300025915 | Bacteria | 17081 |
| 292 | Ga0207663_10148325 | 3300025916 | Bacteria | 1642 |
| 293 | Ga0207660_10013344 | 3300025917 | Bacteria | 5384 |
| 294 | Ga0207657_10002834 | 3300025919 | Bacteria | 18618 |
| 295 | Ga0207657_10016447 | 3300025919 | Bacteria | 7135 |
| 296 | Ga0207649_10073119 | 3300025920 | Bacteria | 2195 |
| 297 | Ga0207652_10014079 | 3300025921 | Bacteria | 6475 |
| 298 | Ga0207681_10056838 | 3300025923 | Bacteria | 2670 |
| 299 | Ga0207694_10007179 | 3300025924 | Bacteria | 8458 |
| 300 | Ga0207694_10010860 | 3300025924 | Bacteria | 6875 |
| 301 | Ga0207694_10085630 | 3300025924 | Bacteria | 2481 |
| 302 | Ga0207694_10128502 | 3300025924 | Bacteria | 2029 |
| 303 | Ga0207650_10006284 | 3300025925 | Bacteria | 8094 |
| 304 | Ga0207650_10012006 | 3300025925 | Bacteria | 5970 |
| 305 | Ga0207650_10026221 | 3300025925 | Bacteria | 4155 |
| 306 | Ga0207650_10048116 | 3300025925 | Bacteria | 3144 |
| 307 | Ga0207659_10002925 | 3300025926 | Bacteria | 10176 |
| 308 | Ga0207659_10002989 | 3300025926 | Bacteria | 10076 |
| 309 | Ga0207659_10004132 | 3300025926 | Bacteria | 8763 |
| 310 | Ga0207659_10129714 | 3300025926 | Bacteria | 1944 |
| 311 | Ga0207687_10001668 | 3300025927 | Bacteria | 15313 |
| 312 | Ga0207687_10094146 | 3300025927 | Bacteria | 2192 |
| 313 | Ga0207700_10000031 | 3300025928 | Bacteria | 130086 |
| 314 | Ga0207664_10059393 | 3300025929 | Bacteria | 3045 |
| 315 | Ga0207664_10085794 | 3300025929 | Bacteria | 2571 |
| 316 | Ga0207644_10005084 | 3300025931 | Bacteria | 8591 |
| 317 | Ga0207644_10010927 | 3300025931 | Bacteria | 5998 |
| 318 | Ga0207644_10014773 | 3300025931 | Bacteria | 5231 |
| 319 | Ga0207690_10139459 | 3300025932 | Bacteria | 1785 |
| 320 | Ga0207706_10051087 | 3300025933 | Bacteria | 3651 |
| 321 | Ga0207686_10000198 | 3300025934 | Bacteria | 46402 |
| 322 | Ga0207686_10024636 | 3300025934 | Bacteria | 3489 |
| 323 | Ga0207670_10035455 | 3300025936 | Bacteria | 3235 |
| 324 | Ga0207670_10050308 | 3300025936 | Bacteria | 2792 |
| 325 | Ga0207670_10076655 | 3300025936 | Bacteria | 2327 |
| 326 | Ga0207669_10006638 | 3300025937 | Bacteria | 5304 |
| 327 | Ga0207669_10010632 | 3300025937 | Bacteria | 4438 |
| 328 | Ga0207669_10026395 | 3300025937 | Bacteria | 3158 |
| 329 | Ga0207669_10065400 | 3300025937 | Bacteria | 2256 |
| 330 | Ga0207704_10008017 | 3300025938 | Bacteria | 5024 |
| 331 | Ga0207704_10083397 | 3300025938 | Bacteria | 2074 |
| 332 | Ga0207665_10005065 | 3300025939 | Bacteria | 8797 |
| 333 | Ga0207665_10061852 | 3300025939 | Bacteria | 2539 |
| 334 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 335 | Ga0207691_10000041 | 3300025940 | Bacteria | 106275 |
| 336 | Ga0207691_10004308 | 3300025940 | Bacteria | 13821 |
| 337 | Ga0207691_10007049 | 3300025940 | Bacteria | 10844 |
| 338 | Ga0207691_10009490 | 3300025940 | Bacteria | 9343 |
| 339 | Ga0207711_10001347 | 3300025941 | Bacteria | 23185 |
| 340 | Ga0207711_10003428 | 3300025941 | Bacteria | 13714 |
| 341 | Ga0207711_10221282 | 3300025941 | Bacteria | 1731 |
| 342 | Ga0207689_10000042 | 3300025942 | Bacteria | 93077 |
| 343 | Ga0207689_10012114 | 3300025942 | Bacteria | 7382 |
| 344 | Ga0207689_10250190 | 3300025942 | Bacteria | 1465 |
| 345 | Ga0207661_10100295 | 3300025944 | Bacteria | 2430 |
| 346 | Ga0207679_10156752 | 3300025945 | Bacteria | 1860 |
| 347 | Ga0207679_10190648 | 3300025945 | Bacteria | 1704 |
| 348 | Ga0207667_10009435 | 3300025949 | Bacteria | 11491 |
| 349 | Ga0207667_10014732 | 3300025949 | Bacteria | 8898 |
| 350 | Ga0207667_10033313 | 3300025949 | Bacteria | 5541 |
| 351 | Ga0207667_10048117 | 3300025949 | Bacteria | 4510 |
| 352 | Ga0207667_10068736 | 3300025949 | Bacteria | 3687 |
| 353 | Ga0207667_10130246 | 3300025949 | Bacteria | 2591 |
| 354 | Ga0207651_10000821 | 3300025960 | Bacteria | 13431 |
| 355 | Ga0207651_10001393 | 3300025960 | Bacteria | 10955 |
| 356 | Ga0207651_10003097 | 3300025960 | Bacteria | 8086 |
| 357 | Ga0207651_10007836 | 3300025960 | Bacteria | 5717 |
| 358 | Ga0207712_10122671 | 3300025961 | Bacteria | 1968 |
| 359 | Ga0207668_10001997 | 3300025972 | Bacteria | 11916 |
| 360 | Ga0207668_10063947 | 3300025972 | Bacteria | 2598 |
| 361 | Ga0207658_10006384 | 3300025986 | Bacteria | 8050 |
| 362 | Ga0207658_10006722 | 3300025986 | Bacteria | 7830 |
| 363 | Ga0207658_10010407 | 3300025986 | Bacteria | 6318 |
| 364 | Ga0207658_10044284 | 3300025986 | Bacteria | 3240 |
| 365 | Ga0207658_10155158 | 3300025986 | Bacteria | 1870 |
| 366 | Ga0207677_10000799 | 3300026023 | Bacteria | 18068 |
| 367 | Ga0207677_10017124 | 3300026023 | Bacteria | 4312 |
| 368 | Ga0207677_10021263 | 3300026023 | Bacteria | 3960 |
| 369 | Ga0207677_10031777 | 3300026023 | Bacteria | 3384 |
| 370 | Ga0207677_10079362 | 3300026023 | Bacteria | 2347 |
| 371 | Ga0207703_10000143 | 3300026035 | Bacteria | 84508 |
| 372 | Ga0207703_10001515 | 3300026035 | Bacteria | 21165 |
| 373 | Ga0207703_10005123 | 3300026035 | Bacteria | 10606 |
| 374 | Ga0207703_10009453 | 3300026035 | Bacteria | 7655 |
| 375 | Ga0207703_10014450 | 3300026035 | Bacteria | 6157 |
| 376 | Ga0207703_10015029 | 3300026035 | Bacteria | 6043 |
| 377 | Ga0207703_10223532 | 3300026035 | Bacteria | 1685 |
| 378 | Ga0207703_10239777 | 3300026035 | Bacteria | 1630 |
| 379 | Ga0207639_10073257 | 3300026041 | Bacteria | 2684 |
| 380 | Ga0207639_10141048 | 3300026041 | Bacteria | 2008 |
| 381 | Ga0207678_10003847 | 3300026067 | Bacteria | 13501 |
| 382 | Ga0207678_10112885 | 3300026067 | Bacteria | 2318 |
| 383 | Ga0207678_10273275 | 3300026067 | Bacteria | 1449 |
| 384 | Ga0207708_10019739 | 3300026075 | Bacteria | 5082 |
| 385 | Ga0207708_10104076 | 3300026075 | Bacteria | 2199 |
| 386 | Ga0207702_10044512 | 3300026078 | Bacteria | 3731 |
| 387 | Ga0207641_10008173 | 3300026088 | Bacteria | 8657 |
| 388 | Ga0207641_10009450 | 3300026088 | Bacteria | 8034 |
| 389 | Ga0207641_10028656 | 3300026088 | Bacteria | 4602 |
| 390 | Ga0207641_10030138 | 3300026088 | Bacteria | 4493 |
| 391 | Ga0207641_10030311 | 3300026088 | Bacteria | 4481 |
| 392 | Ga0207641_10080760 | 3300026088 | Bacteria | 2822 |
| 393 | Ga0207641_10131588 | 3300026088 | Bacteria | 2247 |
| 394 | Ga0207648_10000601 | 3300026089 | Bacteria | 40481 |
| 395 | Ga0207648_10002730 | 3300026089 | Bacteria | 18749 |
| 396 | Ga0207648_10005057 | 3300026089 | Bacteria | 13371 |
| 397 | Ga0207648_10304792 | 3300026089 | Bacteria | 1429 |
| 398 | Ga0207676_10000837 | 3300026095 | Bacteria | 23871 |
| 399 | Ga0207676_10004178 | 3300026095 | Bacteria | 10207 |
| 400 | Ga0207676_10012832 | 3300026095 | Bacteria | 6015 |
| 401 | Ga0207676_10390525 | 3300026095 | Bacteria | 1298 |
| 402 | Ga0207674_10000049 | 3300026116 | Bacteria | 118784 |
| 403 | Ga0207674_10001272 | 3300026116 | Bacteria | 32948 |
| 404 | Ga0207674_10003466 | 3300026116 | Bacteria | 19294 |
| 405 | Ga0207674_10041729 | 3300026116 | Bacteria | 4744 |
| 406 | Ga0207675_100000517 | 3300026118 | Bacteria | 37526 |
| 407 | Ga0207675_100034799 | 3300026118 | Bacteria | 4698 |
| 408 | Ga0207675_100274420 | 3300026118 | Bacteria | 1637 |
| 409 | Ga0207683_10000011 | 3300026121 | Bacteria | 140261 |
| 410 | Ga0207683_10002753 | 3300026121 | Bacteria | 15353 |
| 411 | Ga0207683_10006764 | 3300026121 | Bacteria | 9811 |
| 412 | Ga0207683_10010698 | 3300026121 | Bacteria | 7819 |
| 413 | Ga0207698_10000922 | 3300026142 | Bacteria | 17101 |
| 414 | Ga0207698_10006726 | 3300026142 | Bacteria | 7184 |
| 415 | Ga0207698_10019689 | 3300026142 | Bacteria | 4626 |
| 416 | Ga0207698_10282944 | 3300026142 | Bacteria | 1535 |
| 417 | Ga0209588_1016821 | 3300027671 | Bacteria | 2262 |
| 418 | Ga0268266_10002385 | 3300028379 | Bacteria | 20297 |
| 419 | Ga0268266_10025406 | 3300028379 | Bacteria | 5039 |
| 420 | Ga0268266_10037041 | 3300028379 | Bacteria | 4156 |
| 421 | Ga0268266_10071429 | 3300028379 | Bacteria | 3008 |
| 422 | Ga0268264_10000641 | 3300028381 | Bacteria | 41364 |
| 423 | Ga0268264_10003919 | 3300028381 | Bacteria | 12743 |
| 424 | Ga0268264_10039987 | 3300028381 | Bacteria | 3874 |
| 425 | Ga0265330_10006553 | 3300031235 | Bacteria | 5754 |
| 426 | Ga0265325_10042004 | 3300031241 | Bacteria | 2393 |
| 427 | Ga0265331_10000310 | 3300031250 | Bacteria | 53265 |
| 428 | Ga0265327_10002920 | 3300031251 | Bacteria | 17116 |
| 429 | Ga0265316_10015797 | 3300031344 | Bacteria | 6581 |
| 430 | Ga0307408_100179700 | 3300031548 | Bacteria | 1696 |
| 431 | Ga0316579_10003538 | 3300031691 | Bacteria | 6113 |
| 432 | Ga0316579_10063156 | 3300031691 | Bacteria | 1745 |
| 433 | Ga0265314_10003412 | 3300031711 | Bacteria | 15382 |
| 434 | Ga0265342_10011276 | 3300031712 | Bacteria | 6129 |
| 435 | Ga0265342_10082861 | 3300031712 | Bacteria | 1850 |
| 436 | Ga0316576_10007693 | 3300031727 | Bacteria | 6797 |
| 437 | Ga0316578_10001353 | 3300031728 | Bacteria | 9875 |
| 438 | Ga0307411_10134290 | 3300032005 | Bacteria | 1814 |
| 439 | Ga0316585_10000825 | 3300032137 | Bacteria | 7836 |
| 440 | Ga0373954_0002126 | 3300035118 | Bacteria | 8225 |
| 441 | Ga0373956_0014030 | 3300035119 | Bacteria | 3342 |
| 442 | Ga0373943_0015419 | 3300035170 | Bacteria | 3470 |
| 443 | Ga0373943_0228088 | 3300035170 | Bacteria | 1039 |
| 444 | Ga0373946_0081085 | 3300035171 | Bacteria | 1421 |
| 445 | Ga0373955_0008031 | 3300035172 | Bacteria | 4878 |
| 446 | Ga0373955_0073608 | 3300035172 | Bacteria | 1915 |
| 447 | Ga0316574_0000657 | 3300035398 | Bacteria | 14546 |
| 448 | Ga0316574_0020235 | 3300035398 | Bacteria | 3938 |
| 449 | Ga0316574_0038325 | 3300035398 | Bacteria | 2942 |
| 450 | Ga0373924_0016252 | 3300035410 | Bacteria | 2839 |
| 451 | Ga0373935_0021847 | 3300035692 | Bacteria | 3918 |
| 452 | Ga0373933_0003333 | 3300035724 | Bacteria | 8957 |
| 453 | Ga0373947_0020754 | 3300035725 | Bacteria | 3796 |
| 454 | Ga0373947_0025241 | 3300035725 | Bacteria | 3465 |
| 455 | Ga0373937_0026978 | 3300036401 | Bacteria | 5193 |
| 456 | Ga0373937_0034394 | 3300036401 | Bacteria | 4610 |
| 457 | Ga0373937_0125447 | 3300036401 | Bacteria | 2394 |
| 458 | Ga0373937_0218694 | 3300036401 | Bacteria | 1793 |
| 459 | Ga0316582_0001314 | 3300036647 | Bacteria | 10750 |
| 460 | Ga0316582_0022447 | 3300036647 | Bacteria | 3747 |
| 461 | Ga0316584_0005109 | 3300036712 | Bacteria | 8755 |
| 462 | Ga0316584_0018869 | 3300036712 | Unclassified | 4980 |
| 463 | Ga0373925_0009503 | 3300037068 | Bacteria | 7079 |
| 464 | Ga0373925_0013381 | 3300037068 | Bacteria | 5937 |
| 465 | Ga0373925_0078847 | 3300037068 | Bacteria | 2501 |
| 466 | Ga0395900_0112752 | 3300037418 | Bacteria | 2792 |
| 467 | Ga0395900_0155145 | 3300037418 | Bacteria | 2339 |
| 468 | Ga0395905_0022658 | 3300037471 | Bacteria | 5938 |
| 469 | Ga0395901_0018353 | 3300038443 | Bacteria | 7142 |
| 470 | Ga0436365_0565898 | 3300039437 | Bacteria | 4978 |
| 471 | Ga0451577_0000040 | 3300042876 | Bacteria | 346755 |
| 472 | Ga0453684_0000179 | 3300044712 | Bacteria | 280195 |
| 473 | Ga0466957_0313610 | 3300044842 | Bacteria | 1057 |
| 474 | Ga0466958_0125547 | 3300045836 | Bacteria | 1609 |
| 475 | Ga0495590_0000011 | 3300046457 | Bacteria | 307470 |
| 476 | Ga0495629_0008490 | 3300046459 | Bacteria | 7563 |
| 477 | Ga0495638_0000058 | 3300046460 | Bacteria | 192656 |
| 478 | Ga0495651_0010132 | 3300046462 | Bacteria | 7240 |
| 479 | Ga0495653_0053985 | 3300046463 | Bacteria | 3072 |
| 480 | Ga0495650_0003025 | 3300046471 | Bacteria | 12689 |
| 481 | Ga0495580_0020023 | 3300046472 | Bacteria | 4959 |
| 482 | Ga0495580_0119519 | 3300046472 | Bacteria | 1830 |
| 483 | Ga0495582_0005046 | 3300046473 | Bacteria | 7397 |
| 484 | Ga0495639_0020731 | 3300046475 | Bacteria | 2872 |
| 485 | Ga0495662_0040418 | 3300046476 | Bacteria | 2252 |
| 486 | Ga0495664_0120213 | 3300046477 | Bacteria | 1589 |
| 487 | Ga0495594_0016481 | 3300046499 | Bacteria | 3893 |
| 488 | Ga0495583_0000751 | 3300046506 | Bacteria | 41181 |
| 489 | Ga0495606_0001241 | 3300046507 | Bacteria | 35622 |
| 490 | Ga0495628_0028581 | 3300046516 | Bacteria | 4528 |
| 491 | Ga0495630_0052254 | 3300046517 | Bacteria | 3059 |
| 492 | Ga0495643_0000230 | 3300046522 | Bacteria | 84299 |
| 493 | Ga0495644_0042987 | 3300046523 | Bacteria | 1701 |
| 494 | Ga0495648_0000082 | 3300046524 | Bacteria | 123682 |
| 495 | Ga0495640_0016426 | 3300046533 | Bacteria | 5536 |
| 496 | Ga0495587_0003983 | 3300046536 | Bacteria | 9791 |
| 497 | Ga0495621_0013853 | 3300046539 | Bacteria | 2542 |
| 498 | Ga0495597_0000341 | 3300046542 | Bacteria | 41785 |
| 499 | Ga0495645_0003028 | 3300046543 | Bacteria | 11372 |
| 500 | Ga0495622_0001811 | 3300046557 | Bacteria | 10527 |
| 501 | Ga0495633_0000459 | 3300046558 | Bacteria | 41806 |
| 502 | Ga0495667_0047399 | 3300046559 | Bacteria | 2840 |
| 503 | Ga0495668_0000266 | 3300046616 | Bacteria | 73736 |
| 504 | Ga0495625_0000843 | 3300046660 | Bacteria | 41880 |
| 505 | Ga0495635_0010528 | 3300046663 | Bacteria | 6473 |
| 506 | Ga0495635_0095460 | 3300046663 | Bacteria | 2033 |
| 507 | Ga0495657_0095298 | 3300046675 | Bacteria | 1902 |
| 508 | Ga0495599_0045241 | 3300046678 | Bacteria | 2760 |
| 509 | Ga0495623_0012139 | 3300046679 | Bacteria | 5582 |
| 510 | Ga0495613_0007994 | 3300046689 | Bacteria | 7866 |
| 511 | Ga0495670_0049307 | 3300046691 | Bacteria | 2107 |
| 512 | Ga0495600_0109080 | 3300046809 | Bacteria | 1802 |
| 513 | Ga0495660_0016819 | 3300046810 | Bacteria | 4214 |
| 514 | Ga0495581_0001341 | 3300047315 | Bacteria | 13603 |
| 515 | Ga0495636_0017782 | 3300047318 | Bacteria | 2848 |
| 516 | Ga0495672_0062345 | 3300047320 | Bacteria | 2145 |
| 517 | Ga0495680_0030368 | 3300047322 | Bacteria | 4412 |
| 518 | Ga0495687_000317 | 3300047443 | Bacteria | 62824 |
| 519 | Ga0495687_001429 | 3300047443 | Bacteria | 21978 |
| 520 | Ga0495675_0059610 | 3300047444 | Bacteria | 2420 |
| 521 | Ga0495684_0056914 | 3300047471 | Bacteria | 2980 |
| 522 | Ga0495684_0082967 | 3300047471 | Bacteria | 2431 |
| 523 | Ga0495614_0008895 | 3300048089 | Bacteria | 4456 |
| 524 | Ga0496101_0022598 | 3300048904 | Bacteria | 4332 |
| 525 | Ga0496104_0008261 | 3300048907 | Bacteria | 9243 |
| 526 | Ga0496105_0137078 | 3300048908 | Bacteria | 2015 |
| 527 | Ga0496107_0010009 | 3300048910 | Bacteria | 6577 |
| 528 | Ga0496109_0032033 | 3300048912 | Bacteria | 4723 |
| 529 | Ga0496109_0155744 | 3300048912 | Bacteria | 2140 |
| 530 | Ga0496110_0143498 | 3300048913 | Bacteria | 2159 |
| 531 | Ga0496115_0042441 | 3300048918 | Bacteria | 3623 |
| 532 | Ga0496115_0076359 | 3300048918 | Bacteria | 2723 |
| 533 | Ga0495678_013802 | 3300049459 | Bacteria | 3781 |
| 534 | Ga0495678_016661 | 3300049459 | Bacteria | 3352 |
| 535 | Ga0501047_0005610 | 3300049581 | Bacteria | 11820 |
| 536 | Ga0501069_0011001 | 3300049585 | Bacteria | 4799 |
| 537 | Ga0501069_0044296 | 3300049585 | Bacteria | 2463 |
| 538 | Ga0501070_0001279 | 3300049586 | Bacteria | 22589 |
| 539 | Ga0501070_0109039 | 3300049586 | Bacteria | 2287 |
| 540 | Ga0501073_0000882 | 3300049589 | Bacteria | 21503 |
| 541 | Ga0501074_0000689 | 3300049590 | Bacteria | 21108 |
| 542 | Ga0501074_0182120 | 3300049590 | Bacteria | 1498 |
| 543 | Ga0501079_0006365 | 3300049741 | Bacteria | 8864 |
| 544 | Ga0501080_0029194 | 3300049742 | Bacteria | 5134 |
| 545 | Ga0501083_0017478 | 3300049744 | Bacteria | 5000 |
| 546 | nmdc:mga08y16_119884_c1 | 3300050511 | Bacteria | 2738 |
| 547 | nmdc:mga0n895_102030_c1 | 3300050512 | Bacteria | 2879 |
| 548 | nmdc:mga0rr50_162288_c1 | 3300050513 | Bacteria | 1815 |
| 549 | nmdc:mga08x19_10942_c1 | 3300050514 | Bacteria | 5457 |
| 550 | nmdc:mga08x19_46651_c1 | 3300050514 | Bacteria | 2772 |
| 551 | nmdc:mga0a205_123815_c1 | 3300050515 | Bacteria | 1800 |
| 552 | nmdc:mga0a205_90977_c1 | 3300050515 | Bacteria | 2948 |
| 553 | Ga0495601_0002762 | 3300053077 | Bacteria | 9969 |
| 554 | Ga0495619_0023365 | 3300053085 | Bacteria | 3963 |
| 555 | Ga0501082_0080868 | 3300060353 | Bacteria | 2804 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0001279 | Ga0501070_0001279_12210_13181 | 315 |
| 2 | 3300060353 | Ga0501082_0080868 | Ga0501082_0080868_1804_2775 | 315 |
| 3 | 3300049590 | Ga0501074_0182120 | Ga0501074_0182120_495_1472 | 321 |
| 4 | 3300035170 | Ga0373943_0228088 | Ga0373943_0228088_40_1020 | 322 |
| 5 | 3300044842 | Ga0466957_0313610 | Ga0466957_0313610_27_1007 | 324 |
| 6 | 3300005340 | Ga0070689_100066377 | Ga0070689_1000663773 | 353 |
| 7 | 3300005547 | Ga0070693_100006121 | Ga0070693_1000061213 | 353 |
| 8 | 3300006358 | Ga0068871_100017726 | Ga0068871_1000177266 | 353 |
| 9 | 3300009098 | Ga0105245_10040997 | Ga0105245_100409974 | 353 |
| 10 | 3300013297 | Ga0157378_10029958 | Ga0157378_100299582 | 353 |
| 11 | 3300027671 | Ga0209588_1016821 | Ga0209588_10168212 | 353 |
| 12 | 3300042876 | Ga0451577_0000040 | Ga0451577_0000040_136807_137934 | 353 |
| 13 | 3300044712 | Ga0453684_0000179 | Ga0453684_0000179_208796_209923 | 353 |
| 14 | 3300025929 | Ga0207664_10059393 | Ga0207664_100593933 | 354 |
| 15 | 3300013104 | Ga0157370_10005403 | Ga0157370_100054035 | 357 |
| 16 | 3300046523 | Ga0495644_0042987 | Ga0495644_0042987_463_1590 | 360 |
| 17 | 3300005539 | Ga0068853_100021304 | Ga0068853_1000213045 | 366 |
| 18 | 3300005563 | Ga0068855_100041106 | Ga0068855_1000411064 | 366 |
| 19 | 3300005563 | Ga0068855_100126978 | Ga0068855_1001269783 | 366 |
| 20 | 3300005614 | Ga0068856_100113517 | Ga0068856_1001135172 | 366 |
| 21 | 3300009093 | Ga0105240_10039354 | Ga0105240_100393542 | 366 |
| 22 | 3300009174 | Ga0105241_10045265 | Ga0105241_100452653 | 366 |
| 23 | 3300009551 | Ga0105238_10008362 | Ga0105238_100083624 | 366 |
| 24 | 3300013105 | Ga0157369_10469388 | Ga0157369_104693882 | 366 |
| 25 | 3300025911 | Ga0207654_10037034 | Ga0207654_100370342 | 366 |
| 26 | 3300025924 | Ga0207694_10010860 | Ga0207694_100108606 | 366 |
| 27 | 3300025949 | Ga0207667_10068736 | Ga0207667_100687363 | 366 |
| 28 | 3300025949 | Ga0207667_10130246 | Ga0207667_101302462 | 366 |
| 29 | 3300005354 | Ga0070675_100001764 | Ga0070675_10000176416 | 367 |
| 30 | 3300005354 | Ga0070675_100090301 | Ga0070675_1000903012 | 367 |
| 31 | 3300005439 | Ga0070711_100027989 | Ga0070711_1000279893 | 367 |
| 32 | 3300005466 | Ga0070685_10112884 | Ga0070685_101128841 | 367 |
| 33 | 3300005518 | Ga0070699_100039995 | Ga0070699_1000399952 | 367 |
| 34 | 3300005535 | Ga0070684_100158649 | Ga0070684_1001586493 | 367 |
| 35 | 3300005546 | Ga0070696_100013351 | Ga0070696_1000133512 | 367 |
| 36 | 3300005563 | Ga0068855_100011856 | Ga0068855_1000118567 | 367 |
| 37 | 3300005577 | Ga0068857_100114759 | Ga0068857_1001147592 | 367 |
| 38 | 3300005616 | Ga0068852_100006246 | Ga0068852_1000062468 | 367 |
| 39 | 3300005617 | Ga0068859_100502821 | Ga0068859_1005028212 | 367 |
| 40 | 3300005834 | Ga0068851_10003419 | Ga0068851_100034192 | 367 |
| 41 | 3300005842 | Ga0068858_100017145 | Ga0068858_1000171454 | 367 |
| 42 | 3300005843 | Ga0068860_100268368 | Ga0068860_1002683682 | 367 |
| 43 | 3300006237 | Ga0097621_100024835 | Ga0097621_1000248353 | 367 |
| 44 | 3300006237 | Ga0097621_100066895 | Ga0097621_1000668952 | 367 |
| 45 | 3300006358 | Ga0068871_100044019 | Ga0068871_1000440193 | 367 |
| 46 | 3300006358 | Ga0068871_100093173 | Ga0068871_1000931732 | 367 |
| 47 | 3300006914 | Ga0075436_100001328 | Ga0075436_10000132817 | 367 |
| 48 | 3300006914 | Ga0075436_100035416 | Ga0075436_1000354162 | 367 |
| 49 | 3300006931 | Ga0097620_100502857 | Ga0097620_1005028572 | 367 |
| 50 | 3300007076 | Ga0075435_100114440 | Ga0075435_1001144402 | 367 |
| 51 | 3300007788 | Ga0099795_10001771 | Ga0099795_100017715 | 367 |
| 52 | 3300009098 | Ga0105245_10008983 | Ga0105245_100089836 | 367 |
| 53 | 3300009148 | Ga0105243_10154794 | Ga0105243_101547942 | 367 |
| 54 | 3300009176 | Ga0105242_10056040 | Ga0105242_100560402 | 367 |
| 55 | 3300009176 | Ga0105242_10063186 | Ga0105242_100631862 | 367 |
| 56 | 3300009553 | Ga0105249_10121542 | Ga0105249_101215421 | 367 |
| 57 | 3300013105 | Ga0157369_10344852 | Ga0157369_103448521 | 367 |
| 58 | 3300013296 | Ga0157374_10018979 | Ga0157374_100189795 | 367 |
| 59 | 3300013296 | Ga0157374_10053370 | Ga0157374_100533703 | 367 |
| 60 | 3300013307 | Ga0157372_10037903 | Ga0157372_100379035 | 367 |
| 61 | 3300013308 | Ga0157375_10044200 | Ga0157375_100442002 | 367 |
| 62 | 3300014745 | Ga0157377_10019759 | Ga0157377_100197593 | 367 |
| 63 | 3300025321 | Ga0207656_10019308 | Ga0207656_100193083 | 367 |
| 64 | 3300025906 | Ga0207699_10023483 | Ga0207699_100234833 | 367 |
| 65 | 3300025916 | Ga0207663_10148325 | Ga0207663_101483252 | 367 |
| 66 | 3300025924 | Ga0207694_10085630 | Ga0207694_100856302 | 367 |
| 67 | 3300025934 | Ga0207686_10024636 | Ga0207686_100246363 | 367 |
| 68 | 3300025936 | Ga0207670_10050308 | Ga0207670_100503082 | 367 |
| 69 | 3300025936 | Ga0207670_10076655 | Ga0207670_100766552 | 367 |
| 70 | 3300025937 | Ga0207669_10065400 | Ga0207669_100654002 | 367 |
| 71 | 3300025939 | Ga0207665_10005065 | Ga0207665_100050654 | 367 |
| 72 | 3300025940 | Ga0207691_10007049 | Ga0207691_100070498 | 367 |
| 73 | 3300025949 | Ga0207667_10048117 | Ga0207667_100481173 | 367 |
| 74 | 3300026075 | Ga0207708_10104076 | Ga0207708_101040762 | 367 |
| 75 | 3300026116 | Ga0207674_10041729 | Ga0207674_100417295 | 367 |
| 76 | 3300026142 | Ga0207698_10000922 | Ga0207698_100009225 | 367 |
| 77 | 3300031548 | Ga0307408_100179700 | Ga0307408_1001797002 | 367 |
| 78 | 3300031691 | Ga0316579_10063156 | Ga0316579_100631562 | 367 |
| 79 | 3300032005 | Ga0307411_10134290 | Ga0307411_101342903 | 367 |
| 80 | 3300036401 | Ga0373937_0034394 | Ga0373937_0034394_2989_4119 | 367 |
| 81 | 3300039437 | Ga0436365_0565898 | Ga0436365_0565898_3546_4676 | 367 |
| 82 | 3300046462 | Ga0495651_0010132 | Ga0495651_0010132_3586_4716 | 367 |
| 83 | 3300046463 | Ga0495653_0053985 | Ga0495653_0053985_321_1451 | 367 |
| 84 | 3300046477 | Ga0495664_0120213 | Ga0495664_0120213_96_1226 | 367 |
| 85 | 3300046522 | Ga0495643_0000230 | Ga0495643_0000230_44858_45967 | 367 |
| 86 | 3300046536 | Ga0495587_0003983 | Ga0495587_0003983_6522_7652 | 367 |
| 87 | 3300046542 | Ga0495597_0000341 | Ga0495597_0000341_3683_4792 | 367 |
| 88 | 3300046543 | Ga0495645_0003028 | Ga0495645_0003028_7381_8511 | 367 |
| 89 | 3300046663 | Ga0495635_0095460 | Ga0495635_0095460_586_1716 | 367 |
| 90 | 3300046675 | Ga0495657_0095298 | Ga0495657_0095298_375_1505 | 367 |
| 91 | 3300046678 | Ga0495599_0045241 | Ga0495599_0045241_723_1853 | 367 |
| 92 | 3300046679 | Ga0495623_0012139 | Ga0495623_0012139_2619_3749 | 367 |
| 93 | 3300046810 | Ga0495660_0016819 | Ga0495660_0016819_1217_2326 | 367 |
| 94 | 3300047318 | Ga0495636_0017782 | Ga0495636_0017782_1624_2754 | 367 |
| 95 | 3300047443 | Ga0495687_000317 | Ga0495687_000317_36001_37110 | 367 |
| 96 | 3300047443 | Ga0495687_001429 | Ga0495687_001429_13322_14431 | 367 |
| 97 | 3300047471 | Ga0495684_0082967 | Ga0495684_0082967_526_1656 | 367 |
| 98 | 3300049581 | Ga0501047_0005610 | Ga0501047_0005610_7054_8214 | 367 |
| 99 | 3300049585 | Ga0501069_0011001 | Ga0501069_0011001_1801_2961 | 367 |
| 100 | 3300049589 | Ga0501073_0000882 | Ga0501073_0000882_13975_15135 | 367 |
| 101 | 3300049590 | Ga0501074_0000689 | Ga0501074_0000689_6324_7484 | 367 |
| 102 | 3300049741 | Ga0501079_0006365 | Ga0501079_0006365_5891_7051 | 367 |
| 103 | 3300049744 | Ga0501083_0017478 | Ga0501083_0017478_1547_2707 | 367 |
| 104 | 3300050512 | nmdc:mga0n895_102030_c1 | nmdc:mga0n895_102030_c1_633_1763 | 367 |
| 105 | 3300050514 | nmdc:mga08x19_10942_c1 | nmdc:mga08x19_10942_c1_1502_2632 | 367 |
| 106 | 3300050514 | nmdc:mga08x19_46651_c1 | nmdc:mga08x19_46651_c1_1181_2311 | 367 |
| 107 | 3300050515 | nmdc:mga0a205_123815_c1 | nmdc:mga0a205_123815_c1_259_1389 | 367 |
| 108 | 3300053077 | Ga0495601_0002762 | Ga0495601_0002762_7175_8305 | 367 |
| 109 | 3300014326 | Ga0157380_10021787 | Ga0157380_100217872 | 368 |
| 110 | 3300046457 | Ga0495590_0000011 | Ga0495590_0000011_47647_48759 | 368 |
| 111 | 3300046460 | Ga0495638_0000058 | Ga0495638_0000058_141081_142193 | 368 |
| 112 | 3300046471 | Ga0495650_0003025 | Ga0495650_0003025_2178_3290 | 368 |
| 113 | 3300046506 | Ga0495583_0000751 | Ga0495583_0000751_37889_39001 | 368 |
| 114 | 3300046507 | Ga0495606_0001241 | Ga0495606_0001241_22827_23939 | 368 |
| 115 | 3300046524 | Ga0495648_0000082 | Ga0495648_0000082_72771_73883 | 368 |
| 116 | 3300046557 | Ga0495622_0001811 | Ga0495622_0001811_7196_8308 | 368 |
| 117 | 3300046558 | Ga0495633_0000459 | Ga0495633_0000459_35111_36223 | 368 |
| 118 | 3300046616 | Ga0495668_0000266 | Ga0495668_0000266_25916_27028 | 368 |
| 119 | 3300046660 | Ga0495625_0000843 | Ga0495625_0000843_37303_38415 | 368 |
| 120 | 3300046691 | Ga0495670_0049307 | Ga0495670_0049307_420_1541 | 368 |
| 121 | 3300049459 | Ga0495678_013802 | Ga0495678_013802_99_1211 | 368 |
| 122 | 3300049459 | Ga0495678_016661 | Ga0495678_016661_2142_3254 | 368 |
| 123 | 3300049742 | Ga0501080_0029194 | Ga0501080_0029194_791_1945 | 368 |
| 124 | 3300026035 | Ga0207703_10005123 | Ga0207703_100051239 | 369 |
| 125 | 3300047320 | Ga0495672_0062345 | Ga0495672_0062345_195_1331 | 369 |
| 126 | 3300005367 | Ga0070667_100201023 | Ga0070667_1002010232 | 370 |
| 127 | 3300005539 | Ga0068853_100026414 | Ga0068853_1000264142 | 370 |
| 128 | 3300009093 | Ga0105240_10302062 | Ga0105240_103020622 | 370 |
| 129 | 3300025925 | Ga0207650_10006284 | Ga0207650_100062846 | 370 |
| 130 | 3300026041 | Ga0207639_10073257 | Ga0207639_100732571 | 370 |
| 131 | 3300031691 | Ga0316579_10003538 | Ga0316579_100035386 | 370 |
| 132 | 3300031712 | Ga0265342_10082861 | Ga0265342_100828611 | 370 |
| 133 | 3300031727 | Ga0316576_10007693 | Ga0316576_100076932 | 370 |
| 134 | 3300031728 | Ga0316578_10001353 | Ga0316578_100013536 | 370 |
| 135 | 3300032137 | Ga0316585_10000825 | Ga0316585_100008254 | 370 |
| 136 | 3300035398 | Ga0316574_0000657 | Ga0316574_0000657_5388_6509 | 370 |
| 137 | 3300035398 | Ga0316574_0020235 | Ga0316574_0020235_2605_3729 | 370 |
| 138 | 3300035398 | Ga0316574_0038325 | Ga0316574_0038325_1406_2527 | 370 |
| 139 | 3300036647 | Ga0316582_0001314 | Ga0316582_0001314_3803_4927 | 370 |
| 140 | 3300036647 | Ga0316582_0022447 | Ga0316582_0022447_1722_2843 | 370 |
| 141 | 3300036712 | Ga0316584_0005109 | Ga0316584_0005109_1311_2435 | 370 |
| 142 | 3300036712 | Ga0316584_0018869 | Ga0316584_0018869_300_1421 | 370 |
| 143 | 3300005329 | Ga0070683_100026675 | Ga0070683_1000266753 | 371 |
| 144 | 3300005336 | Ga0070680_100167271 | Ga0070680_1001672712 | 371 |
| 145 | 3300005339 | Ga0070660_100021172 | Ga0070660_1000211723 | 371 |
| 146 | 3300005344 | Ga0070661_100007598 | Ga0070661_1000075987 | 371 |
| 147 | 3300005366 | Ga0070659_100170020 | Ga0070659_1001700202 | 371 |
| 148 | 3300005435 | Ga0070714_100007199 | Ga0070714_1000071997 | 371 |
| 149 | 3300005458 | Ga0070681_10001277 | Ga0070681_1000127721 | 371 |
| 150 | 3300005530 | Ga0070679_100020307 | Ga0070679_1000203073 | 371 |
| 151 | 3300005547 | Ga0070693_100108596 | Ga0070693_1001085961 | 371 |
| 152 | 3300005563 | Ga0068855_100012552 | Ga0068855_1000125523 | 371 |
| 153 | 3300005564 | Ga0070664_100001452 | Ga0070664_10000145210 | 371 |
| 154 | 3300005577 | Ga0068857_100001739 | Ga0068857_1000017393 | 371 |
| 155 | 3300005614 | Ga0068856_100006138 | Ga0068856_1000061385 | 371 |
| 156 | 3300005616 | Ga0068852_100001471 | Ga0068852_10000147112 | 371 |
| 157 | 3300005834 | Ga0068851_10003959 | Ga0068851_100039595 | 371 |
| 158 | 3300009093 | Ga0105240_10017865 | Ga0105240_100178653 | 371 |
| 159 | 3300009545 | Ga0105237_10356366 | Ga0105237_103563662 | 371 |
| 160 | 3300009551 | Ga0105238_10007592 | Ga0105238_100075924 | 371 |
| 161 | 3300013100 | Ga0157373_10055370 | Ga0157373_100553703 | 371 |
| 162 | 3300013104 | Ga0157370_10008356 | Ga0157370_1000835611 | 371 |
| 163 | 3300013104 | Ga0157370_10120075 | Ga0157370_101200752 | 371 |
| 164 | 3300013105 | Ga0157369_10014458 | Ga0157369_100144586 | 371 |
| 165 | 3300013105 | Ga0157369_10303685 | Ga0157369_103036851 | 371 |
| 166 | 3300013307 | Ga0157372_10045554 | Ga0157372_100455545 | 371 |
| 167 | 3300014497 | Ga0182008_10048811 | Ga0182008_100488112 | 371 |
| 168 | 3300025913 | Ga0207695_10025748 | Ga0207695_100257483 | 371 |
| 169 | 3300025919 | Ga0207657_10016447 | Ga0207657_100164479 | 371 |
| 170 | 3300025920 | Ga0207649_10073119 | Ga0207649_100731192 | 371 |
| 171 | 3300025921 | Ga0207652_10014079 | Ga0207652_100140795 | 371 |
| 172 | 3300025924 | Ga0207694_10007179 | Ga0207694_100071796 | 371 |
| 173 | 3300025932 | Ga0207690_10139459 | Ga0207690_101394593 | 371 |
| 174 | 3300025944 | Ga0207661_10100295 | Ga0207661_101002952 | 371 |
| 175 | 3300025949 | Ga0207667_10009435 | Ga0207667_100094357 | 371 |
| 176 | 3300026116 | Ga0207674_10000049 | Ga0207674_1000004925 | 371 |
| 177 | 3300026142 | Ga0207698_10019689 | Ga0207698_100196893 | 371 |
| 178 | 3300026067 | Ga0207678_10273275 | Ga0207678_102732752 | 372 |
| 179 | 3300005345 | Ga0070692_10019262 | Ga0070692_100192623 | 373 |
| 180 | 3300005347 | Ga0070668_100090992 | Ga0070668_1000909923 | 373 |
| 181 | 3300005441 | Ga0070700_100027897 | Ga0070700_1000278973 | 373 |
| 182 | 3300005455 | Ga0070663_100219825 | Ga0070663_1002198252 | 373 |
| 183 | 3300005614 | Ga0068856_100001396 | Ga0068856_1000013967 | 373 |
| 184 | 3300005937 | Ga0081455_10078253 | Ga0081455_100782532 | 373 |
| 185 | 3300006881 | Ga0068865_100094791 | Ga0068865_1000947913 | 373 |
| 186 | 3300013307 | Ga0157372_10046153 | Ga0157372_100461532 | 373 |
| 187 | 3300025898 | Ga0207692_10062141 | Ga0207692_100621412 | 373 |
| 188 | 3300025938 | Ga0207704_10083397 | Ga0207704_100833972 | 373 |
| 189 | 3300026075 | Ga0207708_10019739 | Ga0207708_100197393 | 373 |
| 190 | 3300037418 | Ga0395900_0112752 | Ga0395900_0112752_1541_2671 | 373 |
| 191 | 3300038443 | Ga0395901_0018353 | Ga0395901_0018353_2160_3290 | 373 |
| 192 | 3300045836 | Ga0466958_0125547 | Ga0466958_0125547_23_1153 | 373 |
| 193 | 3300049585 | Ga0501069_0044296 | Ga0501069_0044296_1012_2145 | 373 |
| 194 | 3300005327 | Ga0070658_10023833 | Ga0070658_100238332 | 374 |
| 195 | 3300005328 | Ga0070676_10005737 | Ga0070676_100057376 | 374 |
| 196 | 3300005328 | Ga0070676_10009931 | Ga0070676_100099313 | 374 |
| 197 | 3300005330 | Ga0070690_100018294 | Ga0070690_1000182942 | 374 |
| 198 | 3300005330 | Ga0070690_100190043 | Ga0070690_1001900431 | 374 |
| 199 | 3300005331 | Ga0070670_100029157 | Ga0070670_1000291572 | 374 |
| 200 | 3300005331 | Ga0070670_100039569 | Ga0070670_1000395695 | 374 |
| 201 | 3300005331 | Ga0070670_100140288 | Ga0070670_1001402882 | 374 |
| 202 | 3300005331 | Ga0070670_100259454 | Ga0070670_1002594541 | 374 |
| 203 | 3300005333 | Ga0070677_10000965 | Ga0070677_100009653 | 374 |
| 204 | 3300005334 | Ga0068869_100000388 | Ga0068869_10000038819 | 374 |
| 205 | 3300005334 | Ga0068869_100008272 | Ga0068869_1000082724 | 374 |
| 206 | 3300005335 | Ga0070666_10000887 | Ga0070666_100008872 | 374 |
| 207 | 3300005335 | Ga0070666_10007056 | Ga0070666_100070566 | 374 |
| 208 | 3300005335 | Ga0070666_10056165 | Ga0070666_100561653 | 374 |
| 209 | 3300005335 | Ga0070666_10179563 | Ga0070666_101795631 | 374 |
| 210 | 3300005336 | Ga0070680_100180992 | Ga0070680_1001809922 | 374 |
| 211 | 3300005338 | Ga0068868_100003424 | Ga0068868_1000034248 | 374 |
| 212 | 3300005338 | Ga0068868_100008218 | Ga0068868_1000082185 | 374 |
| 213 | 3300005338 | Ga0068868_100022058 | Ga0068868_1000220585 | 374 |
| 214 | 3300005338 | Ga0068868_100052818 | Ga0068868_1000528183 | 374 |
| 215 | 3300005340 | Ga0070689_100005389 | Ga0070689_1000053897 | 374 |
| 216 | 3300005344 | Ga0070661_100008547 | Ga0070661_1000085474 | 374 |
| 217 | 3300005347 | Ga0070668_100004358 | Ga0070668_1000043589 | 374 |
| 218 | 3300005347 | Ga0070668_100013627 | Ga0070668_1000136275 | 374 |
| 219 | 3300005347 | Ga0070668_100019525 | Ga0070668_1000195254 | 374 |
| 220 | 3300005347 | Ga0070668_100068530 | Ga0070668_1000685303 | 374 |
| 221 | 3300005353 | Ga0070669_100002694 | Ga0070669_1000026944 | 374 |
| 222 | 3300005353 | Ga0070669_100117884 | Ga0070669_1001178841 | 374 |
| 223 | 3300005354 | Ga0070675_100000476 | Ga0070675_1000004764 | 374 |
| 224 | 3300005354 | Ga0070675_100013648 | Ga0070675_1000136486 | 374 |
| 225 | 3300005355 | Ga0070671_100002250 | Ga0070671_1000022508 | 374 |
| 226 | 3300005355 | Ga0070671_100002660 | Ga0070671_1000026604 | 374 |
| 227 | 3300005355 | Ga0070671_100011370 | Ga0070671_1000113704 | 374 |
| 228 | 3300005355 | Ga0070671_100021544 | Ga0070671_1000215443 | 374 |
| 229 | 3300005356 | Ga0070674_100000409 | Ga0070674_10000040921 | 374 |
| 230 | 3300005356 | Ga0070674_100004979 | Ga0070674_1000049797 | 374 |
| 231 | 3300005364 | Ga0070673_100000781 | Ga0070673_1000007814 | 374 |
| 232 | 3300005364 | Ga0070673_100001204 | Ga0070673_1000012047 | 374 |
| 233 | 3300005364 | Ga0070673_100007406 | Ga0070673_1000074064 | 374 |
| 234 | 3300005364 | Ga0070673_100020203 | Ga0070673_1000202031 | 374 |
| 235 | 3300005365 | Ga0070688_100002928 | Ga0070688_1000029287 | 374 |
| 236 | 3300005366 | Ga0070659_100008939 | Ga0070659_1000089394 | 374 |
| 237 | 3300005367 | Ga0070667_100000550 | Ga0070667_10000055010 | 374 |
| 238 | 3300005367 | Ga0070667_100006019 | Ga0070667_1000060194 | 374 |
| 239 | 3300005367 | Ga0070667_100017448 | Ga0070667_1000174483 | 374 |
| 240 | 3300005367 | Ga0070667_100090872 | Ga0070667_1000908723 | 374 |
| 241 | 3300005367 | Ga0070667_100125814 | Ga0070667_1001258142 | 374 |
| 242 | 3300005367 | Ga0070667_100223800 | Ga0070667_1002238001 | 374 |
| 243 | 3300005436 | Ga0070713_100000182 | Ga0070713_10000018221 | 374 |
| 244 | 3300005436 | Ga0070713_100003475 | Ga0070713_1000034755 | 374 |
| 245 | 3300005437 | Ga0070710_10012581 | Ga0070710_100125812 | 374 |
| 246 | 3300005439 | Ga0070711_100011287 | Ga0070711_1000112872 | 374 |
| 247 | 3300005440 | Ga0070705_100099990 | Ga0070705_1000999901 | 374 |
| 248 | 3300005445 | Ga0070708_100000207 | Ga0070708_10000020718 | 374 |
| 249 | 3300005455 | Ga0070663_100087431 | Ga0070663_1000874312 | 374 |
| 250 | 3300005456 | Ga0070678_100000200 | Ga0070678_10000020013 | 374 |
| 251 | 3300005456 | Ga0070678_100000560 | Ga0070678_10000056018 | 374 |
| 252 | 3300005456 | Ga0070678_100000872 | Ga0070678_1000008723 | 374 |
| 253 | 3300005456 | Ga0070678_100009611 | Ga0070678_1000096113 | 374 |
| 254 | 3300005457 | Ga0070662_100038470 | Ga0070662_1000384703 | 374 |
| 255 | 3300005457 | Ga0070662_100103595 | Ga0070662_1001035952 | 374 |
| 256 | 3300005459 | Ga0068867_100001219 | Ga0068867_1000012197 | 374 |
| 257 | 3300005459 | Ga0068867_100001865 | Ga0068867_1000018654 | 374 |
| 258 | 3300005459 | Ga0068867_100016645 | Ga0068867_1000166453 | 374 |
| 259 | 3300005459 | Ga0068867_100226490 | Ga0068867_1002264902 | 374 |
| 260 | 3300005466 | Ga0070685_10004553 | Ga0070685_100045534 | 374 |
| 261 | 3300005467 | Ga0070706_100005849 | Ga0070706_10000584910 | 374 |
| 262 | 3300005471 | Ga0070698_100163402 | Ga0070698_1001634022 | 374 |
| 263 | 3300005518 | Ga0070699_100210529 | Ga0070699_1002105292 | 374 |
| 264 | 3300005530 | Ga0070679_100100348 | Ga0070679_1001003481 | 374 |
| 265 | 3300005536 | Ga0070697_100024935 | Ga0070697_1000249353 | 374 |
| 266 | 3300005539 | Ga0068853_100011739 | Ga0068853_1000117392 | 374 |
| 267 | 3300005543 | Ga0070672_100006366 | Ga0070672_1000063664 | 374 |
| 268 | 3300005543 | Ga0070672_100008331 | Ga0070672_1000083313 | 374 |
| 269 | 3300005543 | Ga0070672_100025038 | Ga0070672_1000250383 | 374 |
| 270 | 3300005543 | Ga0070672_100051651 | Ga0070672_1000516513 | 374 |
| 271 | 3300005546 | Ga0070696_100064866 | Ga0070696_1000648662 | 374 |
| 272 | 3300005547 | Ga0070693_100000167 | Ga0070693_1000001671 | 374 |
| 273 | 3300005547 | Ga0070693_100082558 | Ga0070693_1000825582 | 374 |
| 274 | 3300005548 | Ga0070665_100001447 | Ga0070665_1000014476 | 374 |
| 275 | 3300005548 | Ga0070665_100005172 | Ga0070665_1000051726 | 374 |
| 276 | 3300005548 | Ga0070665_100025304 | Ga0070665_1000253044 | 374 |
| 277 | 3300005548 | Ga0070665_100055050 | Ga0070665_1000550503 | 374 |
| 278 | 3300005548 | Ga0070665_100154584 | Ga0070665_1001545843 | 374 |
| 279 | 3300005549 | Ga0070704_100113396 | Ga0070704_1001133962 | 374 |
| 280 | 3300005563 | Ga0068855_100048381 | Ga0068855_1000483812 | 374 |
| 281 | 3300005563 | Ga0068855_100154592 | Ga0068855_1001545922 | 374 |
| 282 | 3300005564 | Ga0070664_100012048 | Ga0070664_1000120484 | 374 |
| 283 | 3300005564 | Ga0070664_100161412 | Ga0070664_1001614122 | 374 |
| 284 | 3300005577 | Ga0068857_100001623 | Ga0068857_10000162313 | 374 |
| 285 | 3300005577 | Ga0068857_100181611 | Ga0068857_1001816112 | 374 |
| 286 | 3300005578 | Ga0068854_100002132 | Ga0068854_1000021327 | 374 |
| 287 | 3300005578 | Ga0068854_100002439 | Ga0068854_1000024398 | 374 |
| 288 | 3300005614 | Ga0068856_100043206 | Ga0068856_1000432062 | 374 |
| 289 | 3300005614 | Ga0068856_100101918 | Ga0068856_1001019182 | 374 |
| 290 | 3300005617 | Ga0068859_100001484 | Ga0068859_10000148412 | 374 |
| 291 | 3300005617 | Ga0068859_100038177 | Ga0068859_1000381774 | 374 |
| 292 | 3300005618 | Ga0068864_100002372 | Ga0068864_1000023724 | 374 |
| 293 | 3300005618 | Ga0068864_100023093 | Ga0068864_1000230935 | 374 |
| 294 | 3300005618 | Ga0068864_100026603 | Ga0068864_1000266034 | 374 |
| 295 | 3300005618 | Ga0068864_100149498 | Ga0068864_1001494983 | 374 |
| 296 | 3300005718 | Ga0068866_10000527 | Ga0068866_1000052720 | 374 |
| 297 | 3300005718 | Ga0068866_10033784 | Ga0068866_100337843 | 374 |
| 298 | 3300005719 | Ga0068861_100000187 | Ga0068861_1000001872 | 374 |
| 299 | 3300005719 | Ga0068861_100159606 | Ga0068861_1001596062 | 374 |
| 300 | 3300005834 | Ga0068851_10000301 | Ga0068851_100003019 | 374 |
| 301 | 3300005834 | Ga0068851_10010426 | Ga0068851_100104262 | 374 |
| 302 | 3300005840 | Ga0068870_10088432 | Ga0068870_100884322 | 374 |
| 303 | 3300005841 | Ga0068863_100006037 | Ga0068863_1000060376 | 374 |
| 304 | 3300005841 | Ga0068863_100013076 | Ga0068863_1000130765 | 374 |
| 305 | 3300005841 | Ga0068863_100019995 | Ga0068863_1000199953 | 374 |
| 306 | 3300005841 | Ga0068863_100028429 | Ga0068863_1000284294 | 374 |
| 307 | 3300005842 | Ga0068858_100008319 | Ga0068858_1000083195 | 374 |
| 308 | 3300005842 | Ga0068858_100017079 | Ga0068858_1000170796 | 374 |
| 309 | 3300005842 | Ga0068858_100018888 | Ga0068858_1000188884 | 374 |
| 310 | 3300005842 | Ga0068858_100019815 | Ga0068858_1000198153 | 374 |
| 311 | 3300005842 | Ga0068858_100238176 | Ga0068858_1002381762 | 374 |
| 312 | 3300005843 | Ga0068860_100002049 | Ga0068860_10000204917 | 374 |
| 313 | 3300005843 | Ga0068860_100003430 | Ga0068860_1000034301 | 374 |
| 314 | 3300005843 | Ga0068860_100011724 | Ga0068860_1000117244 | 374 |
| 315 | 3300005843 | Ga0068860_100027211 | Ga0068860_1000272115 | 374 |
| 316 | 3300005843 | Ga0068860_100056842 | Ga0068860_1000568423 | 374 |
| 317 | 3300005843 | Ga0068860_100372331 | Ga0068860_1003723311 | 374 |
| 318 | 3300006163 | Ga0070715_10005192 | Ga0070715_100051922 | 374 |
| 319 | 3300006173 | Ga0070716_100056439 | Ga0070716_1000564392 | 374 |
| 320 | 3300006175 | Ga0070712_100089073 | Ga0070712_1000890732 | 374 |
| 321 | 3300006237 | Ga0097621_100000972 | Ga0097621_1000009724 | 374 |
| 322 | 3300006237 | Ga0097621_100009045 | Ga0097621_1000090452 | 374 |
| 323 | 3300006237 | Ga0097621_100059281 | Ga0097621_1000592813 | 374 |
| 324 | 3300006237 | Ga0097621_100066120 | Ga0097621_1000661201 | 374 |
| 325 | 3300006358 | Ga0068871_100009526 | Ga0068871_1000095265 | 374 |
| 326 | 3300006358 | Ga0068871_100013937 | Ga0068871_1000139374 | 374 |
| 327 | 3300006358 | Ga0068871_100206605 | Ga0068871_1002066051 | 374 |
| 328 | 3300006844 | Ga0075428_100061078 | Ga0075428_1000610784 | 374 |
| 329 | 3300006852 | Ga0075433_10088783 | Ga0075433_100887833 | 374 |
| 330 | 3300006881 | Ga0068865_100236260 | Ga0068865_1002362602 | 374 |
| 331 | 3300006931 | Ga0097620_100001484 | Ga0097620_10000148412 | 374 |
| 332 | 3300006931 | Ga0097620_100038177 | Ga0097620_1000381773 | 374 |
| 333 | 3300009093 | Ga0105240_10104866 | Ga0105240_101048663 | 374 |
| 334 | 3300009094 | Ga0111539_10081454 | Ga0111539_100814543 | 374 |
| 335 | 3300009098 | Ga0105245_10012549 | Ga0105245_100125497 | 374 |
| 336 | 3300009098 | Ga0105245_10017694 | Ga0105245_100176944 | 374 |
| 337 | 3300009147 | Ga0114129_10303683 | Ga0114129_103036831 | 374 |
| 338 | 3300009174 | Ga0105241_10029877 | Ga0105241_100298772 | 374 |
| 339 | 3300009176 | Ga0105242_10004238 | Ga0105242_100042385 | 374 |
| 340 | 3300009177 | Ga0105248_10001701 | Ga0105248_1000170114 | 374 |
| 341 | 3300009177 | Ga0105248_10031986 | Ga0105248_100319864 | 374 |
| 342 | 3300009177 | Ga0105248_10203890 | Ga0105248_102038902 | 374 |
| 343 | 3300009545 | Ga0105237_10039323 | Ga0105237_100393232 | 374 |
| 344 | 3300009551 | Ga0105238_10016683 | Ga0105238_100166834 | 374 |
| 345 | 3300009553 | Ga0105249_10122847 | Ga0105249_101228472 | 374 |
| 346 | 3300010375 | Ga0105239_10178514 | Ga0105239_101785142 | 374 |
| 347 | 3300013100 | Ga0157373_10002952 | Ga0157373_1000295210 | 374 |
| 348 | 3300013104 | Ga0157370_10003331 | Ga0157370_1000333114 | 374 |
| 349 | 3300013104 | Ga0157370_10022979 | Ga0157370_100229795 | 374 |
| 350 | 3300013296 | Ga0157374_10008557 | Ga0157374_100085574 | 374 |
| 351 | 3300013297 | Ga0157378_10008577 | Ga0157378_100085778 | 374 |
| 352 | 3300013297 | Ga0157378_10033393 | Ga0157378_100333933 | 374 |
| 353 | 3300013297 | Ga0157378_10037383 | Ga0157378_100373834 | 374 |
| 354 | 3300013297 | Ga0157378_10061140 | Ga0157378_100611403 | 374 |
| 355 | 3300013306 | Ga0163162_10002232 | Ga0163162_100022325 | 374 |
| 356 | 3300013306 | Ga0163162_10011501 | Ga0163162_100115017 | 374 |
| 357 | 3300013306 | Ga0163162_10126154 | Ga0163162_101261544 | 374 |
| 358 | 3300013307 | Ga0157372_10365208 | Ga0157372_103652082 | 374 |
| 359 | 3300013308 | Ga0157375_10007037 | Ga0157375_1000703710 | 374 |
| 360 | 3300013308 | Ga0157375_10009095 | Ga0157375_100090956 | 374 |
| 361 | 3300013308 | Ga0157375_10018722 | Ga0157375_100187224 | 374 |
| 362 | 3300013308 | Ga0157375_10080101 | Ga0157375_100801013 | 374 |
| 363 | 3300013308 | Ga0157375_10221684 | Ga0157375_102216841 | 374 |
| 364 | 3300013308 | Ga0157375_10254707 | Ga0157375_102547073 | 374 |
| 365 | 3300014325 | Ga0163163_10006684 | Ga0163163_100066847 | 374 |
| 366 | 3300014325 | Ga0163163_10029291 | Ga0163163_100292912 | 374 |
| 367 | 3300014326 | Ga0157380_10200639 | Ga0157380_102006393 | 374 |
| 368 | 3300014745 | Ga0157377_10040348 | Ga0157377_100403482 | 374 |
| 369 | 3300014968 | Ga0157379_10001106 | Ga0157379_100011069 | 374 |
| 370 | 3300014968 | Ga0157379_10002047 | Ga0157379_100020476 | 374 |
| 371 | 3300014968 | Ga0157379_10004185 | Ga0157379_100041856 | 374 |
| 372 | 3300014968 | Ga0157379_10041867 | Ga0157379_100418672 | 374 |
| 373 | 3300014969 | Ga0157376_10010457 | Ga0157376_100104576 | 374 |
| 374 | 3300014969 | Ga0157376_10036655 | Ga0157376_100366554 | 374 |
| 375 | 3300014969 | Ga0157376_10410644 | Ga0157376_104106442 | 374 |
| 376 | 3300017792 | Ga0163161_10130079 | Ga0163161_101300792 | 374 |
| 377 | 3300020081 | Ga0206354_10079593 | Ga0206354_100795932 | 374 |
| 378 | 3300025893 | Ga0207682_10005728 | Ga0207682_100057284 | 374 |
| 379 | 3300025899 | Ga0207642_10058381 | Ga0207642_100583812 | 374 |
| 380 | 3300025900 | Ga0207710_10105189 | Ga0207710_101051892 | 374 |
| 381 | 3300025903 | Ga0207680_10004153 | Ga0207680_100041536 | 374 |
| 382 | 3300025903 | Ga0207680_10006648 | Ga0207680_100066485 | 374 |
| 383 | 3300025903 | Ga0207680_10045643 | Ga0207680_100456432 | 374 |
| 384 | 3300025907 | Ga0207645_10001058 | Ga0207645_1000105813 | 374 |
| 385 | 3300025907 | Ga0207645_10004486 | Ga0207645_100044866 | 374 |
| 386 | 3300025908 | Ga0207643_10025251 | Ga0207643_100252512 | 374 |
| 387 | 3300025908 | Ga0207643_10088218 | Ga0207643_100882182 | 374 |
| 388 | 3300025908 | Ga0207643_10090492 | Ga0207643_100904922 | 374 |
| 389 | 3300025910 | Ga0207684_10017929 | Ga0207684_100179295 | 374 |
| 390 | 3300025911 | Ga0207654_10071894 | Ga0207654_100718942 | 374 |
| 391 | 3300025912 | Ga0207707_10008732 | Ga0207707_100087325 | 374 |
| 392 | 3300025913 | Ga0207695_10012077 | Ga0207695_100120772 | 374 |
| 393 | 3300025914 | Ga0207671_10063215 | Ga0207671_100632151 | 374 |
| 394 | 3300025915 | Ga0207693_10002176 | Ga0207693_100021768 | 374 |
| 395 | 3300025917 | Ga0207660_10013344 | Ga0207660_100133445 | 374 |
| 396 | 3300025919 | Ga0207657_10002834 | Ga0207657_1000283415 | 374 |
| 397 | 3300025923 | Ga0207681_10056838 | Ga0207681_100568382 | 374 |
| 398 | 3300025924 | Ga0207694_10128502 | Ga0207694_101285022 | 374 |
| 399 | 3300025925 | Ga0207650_10012006 | Ga0207650_100120063 | 374 |
| 400 | 3300025925 | Ga0207650_10026221 | Ga0207650_100262214 | 374 |
| 401 | 3300025925 | Ga0207650_10048116 | Ga0207650_100481163 | 374 |
| 402 | 3300025926 | Ga0207659_10002925 | Ga0207659_100029253 | 374 |
| 403 | 3300025926 | Ga0207659_10002989 | Ga0207659_100029893 | 374 |
| 404 | 3300025926 | Ga0207659_10004132 | Ga0207659_100041325 | 374 |
| 405 | 3300025926 | Ga0207659_10129714 | Ga0207659_101297143 | 374 |
| 406 | 3300025927 | Ga0207687_10001668 | Ga0207687_1000166810 | 374 |
| 407 | 3300025927 | Ga0207687_10094146 | Ga0207687_100941462 | 374 |
| 408 | 3300025928 | Ga0207700_10000031 | Ga0207700_1000003134 | 374 |
| 409 | 3300025929 | Ga0207664_10085794 | Ga0207664_100857942 | 374 |
| 410 | 3300025931 | Ga0207644_10005084 | Ga0207644_100050849 | 374 |
| 411 | 3300025931 | Ga0207644_10010927 | Ga0207644_100109275 | 374 |
| 412 | 3300025931 | Ga0207644_10014773 | Ga0207644_100147734 | 374 |
| 413 | 3300025933 | Ga0207706_10051087 | Ga0207706_100510872 | 374 |
| 414 | 3300025934 | Ga0207686_10000198 | Ga0207686_100001986 | 374 |
| 415 | 3300025936 | Ga0207670_10035455 | Ga0207670_100354553 | 374 |
| 416 | 3300025937 | Ga0207669_10006638 | Ga0207669_100066384 | 374 |
| 417 | 3300025937 | Ga0207669_10010632 | Ga0207669_100106324 | 374 |
| 418 | 3300025937 | Ga0207669_10026395 | Ga0207669_100263952 | 374 |
| 419 | 3300025938 | Ga0207704_10008017 | Ga0207704_100080174 | 374 |
| 420 | 3300025939 | Ga0207665_10061852 | Ga0207665_100618522 | 374 |
| 421 | 3300025940 | Ga0207691_10000006 | Ga0207691_1000000613 | 374 |
| 422 | 3300025940 | Ga0207691_10000041 | Ga0207691_1000004175 | 374 |
| 423 | 3300025940 | Ga0207691_10004308 | Ga0207691_100043089 | 374 |
| 424 | 3300025940 | Ga0207691_10009490 | Ga0207691_100094903 | 374 |
| 425 | 3300025941 | Ga0207711_10001347 | Ga0207711_1000134713 | 374 |
| 426 | 3300025941 | Ga0207711_10003428 | Ga0207711_100034288 | 374 |
| 427 | 3300025941 | Ga0207711_10221282 | Ga0207711_102212821 | 374 |
| 428 | 3300025942 | Ga0207689_10000042 | Ga0207689_1000004283 | 374 |
| 429 | 3300025942 | Ga0207689_10012114 | Ga0207689_100121144 | 374 |
| 430 | 3300025942 | Ga0207689_10250190 | Ga0207689_102501902 | 374 |
| 431 | 3300025945 | Ga0207679_10156752 | Ga0207679_101567521 | 374 |
| 432 | 3300025945 | Ga0207679_10190648 | Ga0207679_101906482 | 374 |
| 433 | 3300025949 | Ga0207667_10014732 | Ga0207667_100147326 | 374 |
| 434 | 3300025949 | Ga0207667_10033313 | Ga0207667_100333133 | 374 |
| 435 | 3300025960 | Ga0207651_10000821 | Ga0207651_1000082111 | 374 |
| 436 | 3300025960 | Ga0207651_10001393 | Ga0207651_100013937 | 374 |
| 437 | 3300025960 | Ga0207651_10003097 | Ga0207651_100030977 | 374 |
| 438 | 3300025960 | Ga0207651_10007836 | Ga0207651_100078362 | 374 |
| 439 | 3300025961 | Ga0207712_10122671 | Ga0207712_101226712 | 374 |
| 440 | 3300025972 | Ga0207668_10001997 | Ga0207668_100019972 | 374 |
| 441 | 3300025972 | Ga0207668_10063947 | Ga0207668_100639472 | 374 |
| 442 | 3300025986 | Ga0207658_10006384 | Ga0207658_100063844 | 374 |
| 443 | 3300025986 | Ga0207658_10006722 | Ga0207658_100067224 | 374 |
| 444 | 3300025986 | Ga0207658_10010407 | Ga0207658_100104074 | 374 |
| 445 | 3300025986 | Ga0207658_10044284 | Ga0207658_100442842 | 374 |
| 446 | 3300025986 | Ga0207658_10155158 | Ga0207658_101551582 | 374 |
| 447 | 3300026023 | Ga0207677_10000799 | Ga0207677_100007994 | 374 |
| 448 | 3300026023 | Ga0207677_10017124 | Ga0207677_100171243 | 374 |
| 449 | 3300026023 | Ga0207677_10021263 | Ga0207677_100212634 | 374 |
| 450 | 3300026023 | Ga0207677_10031777 | Ga0207677_100317772 | 374 |
| 451 | 3300026023 | Ga0207677_10079362 | Ga0207677_100793622 | 374 |
| 452 | 3300026035 | Ga0207703_10000143 | Ga0207703_100001434 | 374 |
| 453 | 3300026035 | Ga0207703_10001515 | Ga0207703_1000151517 | 374 |
| 454 | 3300026035 | Ga0207703_10009453 | Ga0207703_100094537 | 374 |
| 455 | 3300026035 | Ga0207703_10014450 | Ga0207703_100144504 | 374 |
| 456 | 3300026035 | Ga0207703_10015029 | Ga0207703_100150296 | 374 |
| 457 | 3300026035 | Ga0207703_10223532 | Ga0207703_102235322 | 374 |
| 458 | 3300026035 | Ga0207703_10239777 | Ga0207703_102397772 | 374 |
| 459 | 3300026041 | Ga0207639_10141048 | Ga0207639_101410482 | 374 |
| 460 | 3300026067 | Ga0207678_10003847 | Ga0207678_100038475 | 374 |
| 461 | 3300026067 | Ga0207678_10112885 | Ga0207678_101128852 | 374 |
| 462 | 3300026078 | Ga0207702_10044512 | Ga0207702_100445124 | 374 |
| 463 | 3300026088 | Ga0207641_10008173 | Ga0207641_100081734 | 374 |
| 464 | 3300026088 | Ga0207641_10009450 | Ga0207641_100094507 | 374 |
| 465 | 3300026088 | Ga0207641_10028656 | Ga0207641_100286564 | 374 |
| 466 | 3300026088 | Ga0207641_10030138 | Ga0207641_100301382 | 374 |
| 467 | 3300026088 | Ga0207641_10030311 | Ga0207641_100303112 | 374 |
| 468 | 3300026088 | Ga0207641_10080760 | Ga0207641_100807602 | 374 |
| 469 | 3300026088 | Ga0207641_10131588 | Ga0207641_101315882 | 374 |
| 470 | 3300026089 | Ga0207648_10000601 | Ga0207648_1000060122 | 374 |
| 471 | 3300026089 | Ga0207648_10002730 | Ga0207648_1000273013 | 374 |
| 472 | 3300026089 | Ga0207648_10005057 | Ga0207648_1000505711 | 374 |
| 473 | 3300026089 | Ga0207648_10304792 | Ga0207648_103047921 | 374 |
| 474 | 3300026095 | Ga0207676_10000837 | Ga0207676_1000083714 | 374 |
| 475 | 3300026095 | Ga0207676_10004178 | Ga0207676_100041784 | 374 |
| 476 | 3300026095 | Ga0207676_10012832 | Ga0207676_100128324 | 374 |
| 477 | 3300026095 | Ga0207676_10390525 | Ga0207676_103905251 | 374 |
| 478 | 3300026116 | Ga0207674_10001272 | Ga0207674_100012725 | 374 |
| 479 | 3300026116 | Ga0207674_10003466 | Ga0207674_100034667 | 374 |
| 480 | 3300026118 | Ga0207675_100000517 | Ga0207675_10000051725 | 374 |
| 481 | 3300026118 | Ga0207675_100034799 | Ga0207675_1000347993 | 374 |
| 482 | 3300026118 | Ga0207675_100274420 | Ga0207675_1002744202 | 374 |
| 483 | 3300026121 | Ga0207683_10000011 | Ga0207683_1000001142 | 374 |
| 484 | 3300026121 | Ga0207683_10002753 | Ga0207683_1000275310 | 374 |
| 485 | 3300026121 | Ga0207683_10006764 | Ga0207683_100067647 | 374 |
| 486 | 3300026121 | Ga0207683_10010698 | Ga0207683_100106985 | 374 |
| 487 | 3300026142 | Ga0207698_10006726 | Ga0207698_100067264 | 374 |
| 488 | 3300026142 | Ga0207698_10282944 | Ga0207698_102829442 | 374 |
| 489 | 3300028379 | Ga0268266_10002385 | Ga0268266_100023859 | 374 |
| 490 | 3300028379 | Ga0268266_10025406 | Ga0268266_100254062 | 374 |
| 491 | 3300028379 | Ga0268266_10037041 | Ga0268266_100370413 | 374 |
| 492 | 3300028379 | Ga0268266_10071429 | Ga0268266_100714293 | 374 |
| 493 | 3300028381 | Ga0268264_10000641 | Ga0268264_1000064121 | 374 |
| 494 | 3300028381 | Ga0268264_10003919 | Ga0268264_100039194 | 374 |
| 495 | 3300028381 | Ga0268264_10039987 | Ga0268264_100399871 | 374 |
| 496 | 3300031235 | Ga0265330_10006553 | Ga0265330_100065533 | 374 |
| 497 | 3300031241 | Ga0265325_10042004 | Ga0265325_100420042 | 374 |
| 498 | 3300031250 | Ga0265331_10000310 | Ga0265331_1000031036 | 374 |
| 499 | 3300031251 | Ga0265327_10002920 | Ga0265327_1000292010 | 374 |
| 500 | 3300031344 | Ga0265316_10015797 | Ga0265316_100157973 | 374 |
| 501 | 3300031711 | Ga0265314_10003412 | Ga0265314_100034129 | 374 |
| 502 | 3300031712 | Ga0265342_10011276 | Ga0265342_100112763 | 374 |
| 503 | 3300035118 | Ga0373954_0002126 | Ga0373954_0002126_6105_7265 | 374 |
| 504 | 3300035119 | Ga0373956_0014030 | Ga0373956_0014030_81_1241 | 374 |
| 505 | 3300035170 | Ga0373943_0015419 | Ga0373943_0015419_521_1681 | 374 |
| 506 | 3300035171 | Ga0373946_0081085 | Ga0373946_0081085_173_1312 | 374 |
| 507 | 3300035172 | Ga0373955_0008031 | Ga0373955_0008031_3018_4178 | 374 |
| 508 | 3300035172 | Ga0373955_0073608 | Ga0373955_0073608_209_1369 | 374 |
| 509 | 3300035410 | Ga0373924_0016252 | Ga0373924_0016252_334_1494 | 374 |
| 510 | 3300035692 | Ga0373935_0021847 | Ga0373935_0021847_1098_2258 | 374 |
| 511 | 3300035724 | Ga0373933_0003333 | Ga0373933_0003333_2886_4046 | 374 |
| 512 | 3300035725 | Ga0373947_0020754 | Ga0373947_0020754_442_1602 | 374 |
| 513 | 3300035725 | Ga0373947_0025241 | Ga0373947_0025241_2027_3187 | 374 |
| 514 | 3300036401 | Ga0373937_0026978 | Ga0373937_0026978_1267_2406 | 374 |
| 515 | 3300036401 | Ga0373937_0125447 | Ga0373937_0125447_915_2075 | 374 |
| 516 | 3300036401 | Ga0373937_0218694 | Ga0373937_0218694_37_1251 | 374 |
| 517 | 3300037068 | Ga0373925_0009503 | Ga0373925_0009503_4465_5625 | 374 |
| 518 | 3300037068 | Ga0373925_0013381 | Ga0373925_0013381_2807_3967 | 374 |
| 519 | 3300037068 | Ga0373925_0078847 | Ga0373925_0078847_1084_2223 | 374 |
| 520 | 3300037418 | Ga0395900_0155145 | Ga0395900_0155145_154_1278 | 374 |
| 521 | 3300037471 | Ga0395905_0022658 | Ga0395905_0022658_2639_3763 | 374 |
| 522 | 3300046459 | Ga0495629_0008490 | Ga0495629_0008490_5493_6653 | 374 |
| 523 | 3300046472 | Ga0495580_0020023 | Ga0495580_0020023_3288_4448 | 374 |
| 524 | 3300046472 | Ga0495580_0119519 | Ga0495580_0119519_366_1505 | 374 |
| 525 | 3300046473 | Ga0495582_0005046 | Ga0495582_0005046_2341_3501 | 374 |
| 526 | 3300046475 | Ga0495639_0020731 | Ga0495639_0020731_835_1995 | 374 |
| 527 | 3300046476 | Ga0495662_0040418 | Ga0495662_0040418_401_1561 | 374 |
| 528 | 3300046499 | Ga0495594_0016481 | Ga0495594_0016481_2501_3661 | 374 |
| 529 | 3300046516 | Ga0495628_0028581 | Ga0495628_0028581_1370_2530 | 374 |
| 530 | 3300046517 | Ga0495630_0052254 | Ga0495630_0052254_183_1343 | 374 |
| 531 | 3300046533 | Ga0495640_0016426 | Ga0495640_0016426_31_1191 | 374 |
| 532 | 3300046539 | Ga0495621_0013853 | Ga0495621_0013853_1259_2419 | 374 |
| 533 | 3300046559 | Ga0495667_0047399 | Ga0495667_0047399_210_1370 | 374 |
| 534 | 3300046663 | Ga0495635_0010528 | Ga0495635_0010528_3789_4949 | 374 |
| 535 | 3300046689 | Ga0495613_0007994 | Ga0495613_0007994_3784_4944 | 374 |
| 536 | 3300046809 | Ga0495600_0109080 | Ga0495600_0109080_487_1647 | 374 |
| 537 | 3300047315 | Ga0495581_0001341 | Ga0495581_0001341_6988_8148 | 374 |
| 538 | 3300047322 | Ga0495680_0030368 | Ga0495680_0030368_2179_3339 | 374 |
| 539 | 3300047444 | Ga0495675_0059610 | Ga0495675_0059610_642_1802 | 374 |
| 540 | 3300047471 | Ga0495684_0056914 | Ga0495684_0056914_510_1670 | 374 |
| 541 | 3300048089 | Ga0495614_0008895 | Ga0495614_0008895_2463_3623 | 374 |
| 542 | 3300048904 | Ga0496101_0022598 | Ga0496101_0022598_754_1914 | 374 |
| 543 | 3300048907 | Ga0496104_0008261 | Ga0496104_0008261_2780_3940 | 374 |
| 544 | 3300048908 | Ga0496105_0137078 | Ga0496105_0137078_565_1725 | 374 |
| 545 | 3300048910 | Ga0496107_0010009 | Ga0496107_0010009_2574_3734 | 374 |
| 546 | 3300048912 | Ga0496109_0032033 | Ga0496109_0032033_2906_4066 | 374 |
| 547 | 3300048912 | Ga0496109_0155744 | Ga0496109_0155744_487_1638 | 374 |
| 548 | 3300048913 | Ga0496110_0143498 | Ga0496110_0143498_389_1549 | 374 |
| 549 | 3300048918 | Ga0496115_0042441 | Ga0496115_0042441_1500_2660 | 374 |
| 550 | 3300048918 | Ga0496115_0076359 | Ga0496115_0076359_1394_2536 | 374 |
| 551 | 3300049586 | Ga0501070_0109039 | Ga0501070_0109039_257_1420 | 374 |
| 552 | 3300050511 | nmdc:mga08y16_119884_c1 | nmdc:mga08y16_119884_c1_388_1533 | 374 |
| 553 | 3300050513 | nmdc:mga0rr50_162288_c1 | nmdc:mga0rr50_162288_c1_82_1224 | 374 |
| 554 | 3300050515 | nmdc:mga0a205_90977_c1 | nmdc:mga0a205_90977_c1_86_1228 | 374 |
| 555 | 3300053085 | Ga0495619_0023365 | Ga0495619_0023365_1455_2615 | 374 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lc3-assembly1.cif.gz_B | x-ray crystal structure of a putative udp-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from burkholderia cenocepacia | 0.9629 | 2 | 372 |
| 1mdo-assembly1.cif.gz_A | crystal structure of arnb aminotransferase with pyridomine 5' phosphate | 0.9531 | 4 | 372 |
| 4lc3-assembly1.cif.gz_B | x-ray crystal structure of a putative udp-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from burkholderia cenocepacia | 0.9528 | 2 | 372 |
| 8su6-assembly1.cif.gz_B | crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) | 0.9522 | 4 | 370 |
| 8snj-assembly3.cif.gz_E | crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form) | 0.9518 | 4 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lc3B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9719 | 2 | 244 | 3.40.640.10 |
| 1mdxA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9642 | 4 | 244 | 3.40.640.10 |
| 4lc3B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9641 | 2 | 244 | 3.40.640.10 |
| af_Q58466_2_255_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9539 | 1 | 244 | 3.40.640.10 |
| 1mdxA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9524 | 4 | 244 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0VYK0-F1-model_v4 | Aminotransferase class I/classII domain-containing protein | 0.9776 | 14 | 155 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A3N5MYN8-F1-model_v4 | DegT/DnrJ/EryC1/StrS family aminotransferase | 0.9735 | 55 | 371 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-X1L0T4-F1-model_v4 | Aminotransferase class I/classII domain-containing protein | 0.9718 | 39 | 153 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A2J0LSW6-F1-model_v4 | UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase | 0.9713 | 5 | 191 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A3L9I879-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.971 | 1 | 212 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar