F463073

General Info

Members Datasets Scaffolds Average Seq Length
555 271 555 198

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10159486|Ga0070691_101594862
Length 206
Sequence MRRIALLTGFLALLAAGAARADAIEVRDAALRVVEEGLVLDADFDFELTPRLAEVVANGVPLYFRVEFELTRPRWYWFDERAASRLLQMRLSYHALSRHYRLSAGTQPERFMLQQNFATLEDALKVLKRVRNWLVLERAAGISRSDYDAAVRMRLDTTLLPKPFQLSALTSRELHLESPWKRFVLRSPQQVPAPVESIEPKKAAAR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
151 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
182 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.36
Rhizosphere 99.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10045579 3300003203 Bacteria 1508
2 Ga0065707_10012777 3300005295 Unclassified 2063
3 Ga0065707_10091059 3300005295 Bacteria 4014
4 Ga0065707_10422218 3300005295 Bacteria 829
5 Ga0065707_10433339 3300005295 Bacteria 818
6 Ga0070676_10117618 3300005328 Bacteria 1664
7 Ga0070690_100000082 3300005330 Bacteria 46700
8 Ga0070690_100161145 3300005330 Bacteria 1537
9 Ga0068869_100000044 3300005334 Bacteria 52351
10 Ga0068869_100139584 3300005334 Bacteria 1870
11 Ga0070666_10075840 3300005335 Bacteria 2293
12 Ga0070680_100000771 3300005336 Bacteria 22468
13 Ga0070680_100043245 3300005336 Bacteria 3659
14 Ga0070680_100265676 3300005336 Bacteria 1452
15 Ga0070682_100080731 3300005337 Bacteria 2104
16 Ga0068868_100000780 3300005338 Bacteria 21561
17 Ga0068868_100143534 3300005338 Bacteria 1962
18 Ga0068868_100399774 3300005338 Bacteria 1185
19 Ga0068868_100402997 3300005338 Bacteria 1181
20 Ga0070689_100002046 3300005340 Bacteria 13088
21 Ga0070689_100074829 3300005340 Bacteria 2650
22 Ga0070691_10000079 3300005341 Bacteria 26738
23 Ga0070691_10159486 3300005341 Bacteria 1162
24 Ga0070687_100000034 3300005343 Bacteria 43229
25 Ga0070687_100039763 3300005343 Bacteria 2365
26 Ga0070687_100072962 3300005343 Bacteria 1848
27 Ga0070687_100329639 3300005343 Bacteria 978
28 Ga0070668_100012347 3300005347 Bacteria 6361
29 Ga0070669_100357931 3300005353 Bacteria 1186
30 Ga0070669_100858560 3300005353 Unclassified 774
31 Ga0070675_100007884 3300005354 Bacteria 8254
32 Ga0070675_100744755 3300005354 Unclassified 894
33 Ga0070673_100093425 3300005364 Bacteria 2463
34 Ga0070667_101274264 3300005367 Unclassified 688
35 Ga0070703_10005461 3300005406 Bacteria 3554
36 Ga0070709_10160134 3300005434 Bacteria 1564
37 Ga0070710_10035208 3300005437 Bacteria 2729
38 Ga0070701_10000247 3300005438 Bacteria 17402
39 Ga0070701_10056487 3300005438 Bacteria 2054
40 Ga0070701_10299829 3300005438 Bacteria 987
41 Ga0070711_100041319 3300005439 Bacteria 3114
42 Ga0070705_100000030 3300005440 Bacteria 71489
43 Ga0070705_100118981 3300005440 Bacteria 1702
44 Ga0070705_100275158 3300005440 Bacteria 1194
45 Ga0070705_100516292 3300005440 Unclassified 910
46 Ga0070705_101053708 3300005440 Unclassified 663
47 Ga0070700_100001187 3300005441 Bacteria 12899
48 Ga0070700_100002744 3300005441 Bacteria 9006
49 Ga0070700_100503759 3300005441 Bacteria 932
50 Ga0070694_100000202 3300005444 Bacteria 31690
51 Ga0070694_100005384 3300005444 Bacteria 7745
52 Ga0070694_100098869 3300005444 Bacteria 2061
53 Ga0070694_100604401 3300005444 Bacteria 883
54 Ga0070694_100666748 3300005444 Bacteria 843
55 Ga0070681_10000257 3300005458 Bacteria 42143
56 Ga0070681_10201540 3300005458 Bacteria 1908
57 Ga0068867_100000032 3300005459 Bacteria 84727
58 Ga0068867_100000126 3300005459 Bacteria 49231
59 Ga0068867_100390428 3300005459 Bacteria 1171
60 Ga0070706_100455766 3300005467 Bacteria 1190
61 Ga0070698_100448231 3300005471 Bacteria 1226
62 Ga0070699_101329823 3300005518 Bacteria 659
63 Ga0070679_100004882 3300005530 Bacteria 12368
64 Ga0070684_100024281 3300005535 Bacteria 5083
65 Ga0070697_100001805 3300005536 Bacteria 16337
66 Ga0070697_100196066 3300005536 Bacteria 1715
67 Ga0068853_100720965 3300005539 Bacteria 952
68 Ga0070672_100213794 3300005543 Bacteria 1616
69 Ga0070686_100000286 3300005544 Bacteria 34009
70 Ga0070686_100013122 3300005544 Bacteria 4731
71 Ga0070686_100154944 3300005544 Bacteria 1608
72 Ga0070686_100439233 3300005544 Bacteria 1001
73 Ga0070695_100000818 3300005545 Bacteria 16783
74 Ga0070695_100158687 3300005545 Bacteria 1585
75 Ga0070695_100428986 3300005545 Bacteria 1008
76 Ga0070696_100000344 3300005546 Bacteria 28208
77 Ga0070696_100005765 3300005546 Bacteria 8268
78 Ga0070696_100124529 3300005546 Unclassified 1869
79 Ga0070696_100130661 3300005546 Bacteria 1827
80 Ga0070696_100168607 3300005546 Bacteria 1617
81 Ga0070696_100191285 3300005546 Bacteria 1523
82 Ga0070696_100192339 3300005546 Bacteria 1519
83 Ga0070696_100510923 3300005546 Bacteria 957
84 Ga0070696_100518327 3300005546 Bacteria 951
85 Ga0070693_100000100 3300005547 Bacteria 38176
86 Ga0070693_100166047 3300005547 Bacteria 1410
87 Ga0070704_100000159 3300005549 Bacteria 26321
88 Ga0070704_100009938 3300005549 Bacteria 5777
89 Ga0070704_100197327 3300005549 Bacteria 1622
90 Ga0070704_101034007 3300005549 Bacteria 744
91 Ga0068855_100000695 3300005563 Bacteria 41137
92 Ga0068855_100555021 3300005563 Bacteria 1243
93 Ga0068854_100025568 3300005578 Bacteria 4052
94 Ga0068856_100042208 3300005614 Bacteria 4487
95 Ga0068856_100371922 3300005614 Bacteria 1448
96 Ga0068856_100597995 3300005614 Bacteria 1124
97 Ga0070702_100000001 3300005615 Bacteria 87224
98 Ga0070702_100046156 3300005615 Bacteria 2468
99 Ga0070702_100424242 3300005615 Bacteria 958
100 Ga0070702_100445982 3300005615 Bacteria 938
101 Ga0068852_100066231 3300005616 Bacteria 3154
102 Ga0068859_100001620 3300005617 Bacteria 23013
103 Ga0068859_100018583 3300005617 Bacteria 6988
104 Ga0068859_100388507 3300005617 Bacteria 1491
105 Ga0068864_100166248 3300005618 Bacteria 2008
106 Ga0068866_10215718 3300005718 Bacteria 1155
107 Ga0068861_100000057 3300005719 Bacteria 52351
108 Ga0068861_100000134 3300005719 Bacteria 38219
109 Ga0068870_10181724 3300005840 Bacteria 1263
110 Ga0068858_100000289 3300005842 Bacteria 54365
111 Ga0068858_100097668 3300005842 Bacteria 2738
112 Ga0068858_100553809 3300005842 Bacteria 1113
113 Ga0068860_100004021 3300005843 Bacteria 15102
114 Ga0068860_100142708 3300005843 Unclassified 2303
115 Ga0068860_100506303 3300005843 Bacteria 1206
116 Ga0068860_100813832 3300005843 Bacteria 948
117 Ga0068862_100000583 3300005844 Bacteria 37988
118 Ga0068862_100001111 3300005844 Bacteria 25519
119 Ga0068862_100146396 3300005844 Bacteria 2100
120 Ga0068862_100268040 3300005844 Bacteria 1561
121 Ga0081538_10099149 3300005981 Unclassified 1473
122 Ga0081539_10002484 3300005985 Bacteria 25931
123 Ga0097621_100000368 3300006237 Bacteria 31276
124 Ga0097621_100000927 3300006237 Bacteria 20534
125 Ga0068871_100000246 3300006358 Bacteria 37632
126 Ga0068871_100003416 3300006358 Bacteria 10916
127 Ga0068871_100232011 3300006358 Bacteria 1602
128 Ga0068871_101067921 3300006358 Bacteria 754
129 Ga0075428_100000083 3300006844 Bacteria 78689
130 Ga0075428_100509725 3300006844 Bacteria 1287
131 Ga0075430_100000063 3300006846 Bacteria 57435
132 Ga0075430_100006901 3300006846 Bacteria 9573
133 Ga0075431_100015155 3300006847 Bacteria 7809
134 Ga0075431_100029695 3300006847 Bacteria 5629
135 Ga0075431_100113319 3300006847 Bacteria 2799
136 Ga0075431_100132949 3300006847 Bacteria 2565
137 Ga0075433_10003931 3300006852 Bacteria 11508
138 Ga0075433_10027271 3300006852 Bacteria 4842
139 Ga0075433_10165962 3300006852 Bacteria 1965
140 Ga0075433_10899415 3300006852 Bacteria 772
141 Ga0075434_100000064 3300006871 Bacteria 54394
142 Ga0075434_100016529 3300006871 Bacteria 7094
143 Ga0075434_100053099 3300006871 Bacteria 4027
144 Ga0075429_100001065 3300006880 Bacteria 21974
145 Ga0075429_100019585 3300006880 Bacteria 5865
146 Ga0068865_100000327 3300006881 Bacteria 26283
147 Ga0068865_100026071 3300006881 Bacteria 3851
148 Ga0075436_100000050 3300006914 Bacteria 71245
149 Ga0075436_100003460 3300006914 Bacteria 10826
150 Ga0075436_100034075 3300006914 Bacteria 3510
151 Ga0097620_100001620 3300006931 Bacteria 23013
152 Ga0097620_100018583 3300006931 Bacteria 6988
153 Ga0097620_100388541 3300006931 Bacteria 1491
154 Ga0075435_100000260 3300007076 Bacteria 32721
155 Ga0075435_100002126 3300007076 Bacteria 13046
156 Ga0075435_100013750 3300007076 Bacteria 6031
157 Ga0075435_100020168 3300007076 Bacteria 5102
158 Ga0075435_100331704 3300007076 Bacteria 1303
159 Ga0111539_10003219 3300009094 Bacteria 21595
160 Ga0111539_10008749 3300009094 Bacteria 12841
161 Ga0111539_10041451 3300009094 Bacteria 5536
162 Ga0111539_10085337 3300009094 Bacteria 3711
163 Ga0111539_10240521 3300009094 Bacteria 2107
164 Ga0105245_10000075 3300009098 Bacteria 103550
165 Ga0105245_10461920 3300009098 Bacteria 1280
166 Ga0105245_10478149 3300009098 Unclassified 1259
167 Ga0114129_10001164 3300009147 Bacteria 34871
168 Ga0114129_10110095 3300009147 Bacteria 3802
169 Ga0114129_10291815 3300009147 Bacteria 2176
170 Ga0114129_10298511 3300009147 Bacteria 2148
171 Ga0114129_10989165 3300009147 Bacteria 1060
172 Ga0114129_11310859 3300009147 Unclassified 897
173 Ga0105243_10001533 3300009148 Bacteria 20197
174 Ga0105243_10003894 3300009148 Bacteria 11915
175 Ga0105241_10020104 3300009174 Bacteria 4932
176 Ga0105242_10000359 3300009176 Bacteria 36471
177 Ga0105242_10000823 3300009176 Bacteria 24120
178 Ga0105248_10971398 3300009177 Bacteria 959
179 Ga0105249_10010306 3300009553 Bacteria 8212
180 Ga0105249_10011629 3300009553 Bacteria 7738
181 Ga0105246_10337310 3300011119 Bacteria 1231
182 Ga0157369_11102130 3300013105 Unclassified 811
183 Ga0157378_10000074 3300013297 Bacteria 90608
184 Ga0157380_10003099 3300014326 Bacteria 11340
185 Ga0157380_10012618 3300014326 Bacteria 6131
186 Ga0157377_10159148 3300014745 Bacteria 1403
187 Ga0157376_10015737 3300014969 Bacteria 5723
188 Ga0157376_10084950 3300014969 Bacteria 2726
189 Ga0207653_10009902 3300025885 Bacteria 2972
190 Ga0207642_10003500 3300025899 Bacteria 4961
191 Ga0207688_10401305 3300025901 Bacteria 850
192 Ga0207680_10245658 3300025903 Bacteria 1235
193 Ga0207685_10021986 3300025905 Bacteria 2147
194 Ga0207699_10665556 3300025906 Bacteria 761
195 Ga0207645_10047899 3300025907 Bacteria 2729
196 Ga0207645_10113741 3300025907 Bacteria 1753
197 Ga0207643_10193448 3300025908 Bacteria 1236
198 Ga0207643_10252399 3300025908 Bacteria 1087
199 Ga0207684_10449199 3300025910 Bacteria 1107
200 Ga0207654_10012040 3300025911 Bacteria 4424
201 Ga0207707_10005329 3300025912 Bacteria 11240
202 Ga0207707_10107082 3300025912 Bacteria 2444
203 Ga0207695_10380068 3300025913 Bacteria 1298
204 Ga0207663_10184505 3300025916 Unclassified 1493
205 Ga0207660_10013906 3300025917 Bacteria 5281
206 Ga0207660_10031530 3300025917 Bacteria 3652
207 Ga0207660_10173846 3300025917 Bacteria 1669
208 Ga0207662_10000319 3300025918 Bacteria 21867
209 Ga0207662_10007825 3300025918 Bacteria 5823
210 Ga0207662_10028980 3300025918 Bacteria 3205
211 Ga0207662_10167540 3300025918 Bacteria 1407
212 Ga0207646_10291430 3300025922 Bacteria 1475
213 Ga0207681_10000301 3300025923 Bacteria 36454
214 Ga0207681_10312142 3300025923 Bacteria 1247
215 Ga0207659_10057259 3300025926 Bacteria 2794
216 Ga0207659_10209648 3300025926 Bacteria 1561
217 Ga0207687_10000832 3300025927 Bacteria 20844
218 Ga0207686_10001412 3300025934 Bacteria 13640
219 Ga0207686_10014439 3300025934 Bacteria 4397
220 Ga0207709_10000711 3300025935 Bacteria 26768
221 Ga0207709_10002128 3300025935 Bacteria 12728
222 Ga0207670_10002481 3300025936 Bacteria 9687
223 Ga0207670_10035961 3300025936 Bacteria 3217
224 Ga0207670_10048018 3300025936 Bacteria 2846
225 Ga0207670_10067142 3300025936 Bacteria 2467
226 Ga0207704_10000292 3300025938 Bacteria 23710
227 Ga0207704_10000660 3300025938 Bacteria 15241
228 Ga0207704_10480794 3300025938 Bacteria 997
229 Ga0207665_10047720 3300025939 Bacteria 2872
230 Ga0207691_10531130 3300025940 Bacteria 998
231 Ga0207711_10164270 3300025941 Bacteria 2012
232 Ga0207711_10688435 3300025941 Unclassified 953
233 Ga0207689_10000007 3300025942 Bacteria 132362
234 Ga0207689_10012667 3300025942 Bacteria 7205
235 Ga0207689_10514130 3300025942 Unclassified 1004
236 Ga0207667_10045637 3300025949 Bacteria 4640
237 Ga0207667_10285933 3300025949 Bacteria 1685
238 Ga0207651_10066743 3300025960 Bacteria 2529
239 Ga0207651_10120563 3300025960 Bacteria 1988
240 Ga0207651_10153527 3300025960 Bacteria 1796
241 Ga0207712_10006247 3300025961 Bacteria 7509
242 Ga0207712_10011207 3300025961 Bacteria 5709
243 Ga0207668_10007568 3300025972 Bacteria 6464
244 Ga0207640_10043507 3300025981 Bacteria 2871
245 Ga0207658_11073265 3300025986 Unclassified 735
246 Ga0207677_10001738 3300026023 Bacteria 11555
247 Ga0207703_10000606 3300026035 Bacteria 36379
248 Ga0207703_10079516 3300026035 Bacteria 2728
249 Ga0207703_10808390 3300026035 Bacteria 895
250 Ga0207639_11155397 3300026041 Unclassified 726
251 Ga0207708_10000086 3300026075 Bacteria 73314
252 Ga0207708_10000697 3300026075 Bacteria 25504
253 Ga0207708_10774211 3300026075 Bacteria 825
254 Ga0207702_10017383 3300026078 Bacteria 5951
255 Ga0207702_10061938 3300026078 Bacteria 3193
256 Ga0207702_10318489 3300026078 Bacteria 1481
257 Ga0207641_10076138 3300026088 Bacteria 2900
258 Ga0207648_10000079 3300026089 Bacteria 92044
259 Ga0207648_10000352 3300026089 Bacteria 50550
260 Ga0207648_10347786 3300026089 Bacteria 1336
261 Ga0207648_10444547 3300026089 Bacteria 1180
262 Ga0207676_10072364 3300026095 Unclassified 2771
263 Ga0207676_10097305 3300026095 Bacteria 2431
264 Ga0207675_100000093 3300026118 Bacteria 70343
265 Ga0207675_100000223 3300026118 Bacteria 53251
266 Ga0207675_101304744 3300026118 Bacteria 746
267 Ga0207683_10531499 3300026121 Bacteria 1087
268 Ga0209967_1017464 3300027364 Bacteria 1035
269 Ga0209981_1001021 3300027378 Bacteria 3539
270 Ga0209981_1009862 3300027378 Bacteria 1308
271 Ga0209981_1022771 3300027378 Bacteria 899
272 Ga0209996_1013243 3300027395 Bacteria 1113
273 Ga0210000_1004369 3300027462 Bacteria 2043
274 Ga0210000_1025507 3300027462 Bacteria 914
275 Ga0209995_1006185 3300027471 Bacteria 1925
276 Ga0209999_1000687 3300027543 Bacteria 5471
277 Ga0209970_1028308 3300027614 Bacteria 967
278 Ga0209983_1002209 3300027665 Bacteria 4283
279 Ga0209588_1007008 3300027671 Bacteria 3304
280 Ga0209588_1016176 3300027671 Bacteria 2299
281 Ga0209971_1043655 3300027682 Unclassified 1080
282 Ga0209966_1002603 3300027695 Bacteria 3012
283 Ga0209966_1008975 3300027695 Unclassified 1781
284 Ga0209998_10006830 3300027717 Bacteria 2368
285 Ga0209974_10075568 3300027876 Bacteria 1154
286 Ga0207428_10000321 3300027907 Bacteria 62664
287 Ga0207428_10028576 3300027907 Bacteria 4632
288 Ga0207428_10095016 3300027907 Bacteria 2310
289 Ga0207428_10255647 3300027907 Bacteria 1305
290 Ga0207428_10494055 3300027907 Bacteria 889
291 Ga0268265_10000579 3300028380 Bacteria 37090
292 Ga0268265_10005154 3300028380 Bacteria 8951
293 Ga0268265_10033842 3300028380 Bacteria 3719
294 Ga0268265_10393315 3300028380 Bacteria 1279
295 Ga0268264_10001253 3300028381 Bacteria 24204
296 Ga0268264_10113513 3300028381 Bacteria 2377
297 Ga0268264_10519347 3300028381 Bacteria 1164
298 Ga0307408_100064063 3300031548 Bacteria 2691
299 Ga0307408_100950247 3300031548 Unclassified 789
300 Ga0316575_10024709 3300031665 Bacteria 2327
301 Ga0316579_10000235 3300031691 Bacteria 16905
302 Ga0316578_10001845 3300031728 Bacteria 8908
303 Ga0316583_10001540 3300032133 Bacteria 7743
304 Ga0316583_10006500 3300032133 Bacteria 4199
305 Ga0373930_0004162 3300034816 Bacteria 2340
306 Ga0373948_0003815 3300034817 Bacteria 2345
307 Ga0373958_0008305 3300034819 Bacteria 1678
308 Ga0373926_0001423 3300035083 Bacteria 7276
309 Ga0373928_0011079 3300035084 Bacteria 1779
310 Ga0373928_0017323 3300035084 Bacteria 1482
311 Ga0373929_0016877 3300035085 Bacteria 1436
312 Ga0373940_0006582 3300035088 Bacteria 2584
313 Ga0373944_0002534 3300035089 Bacteria 4640
314 Ga0373949_0003832 3300035090 Bacteria 3501
315 Ga0373951_0002918 3300035091 Bacteria 4251
316 Ga0373952_0003595 3300035092 Bacteria 2796
317 Ga0373952_0011244 3300035092 Bacteria 1743
318 Ga0373952_0050122 3300035092 Bacteria 993
319 Ga0373923_0080946 3300035111 Bacteria 1409
320 Ga0373936_0005049 3300035113 Bacteria 4965
321 Ga0373936_0047227 3300035113 Bacteria 1736
322 Ga0373939_0201302 3300035114 Unclassified 753
323 Ga0373941_0035719 3300035115 Bacteria 1507
324 Ga0373941_0062674 3300035115 Bacteria 1214
325 Ga0373941_0110145 3300035115 Bacteria 970
326 Ga0373945_0006474 3300035116 Bacteria 3779
327 Ga0373953_0001215 3300035117 Bacteria 7337
328 Ga0373953_0032392 3300035117 Bacteria 2039
329 Ga0373954_0000002 3300035118 Bacteria 147478
330 Ga0373954_0122266 3300035118 Bacteria 1264
331 Ga0373960_0008088 3300035121 Bacteria 2511
332 Ga0373960_0008711 3300035121 Bacteria 2439
333 Ga0373960_0076433 3300035121 Unclassified 1046
334 Ga0373943_0040586 3300035170 Bacteria 2247
335 Ga0373946_0003690 3300035171 Bacteria 5425
336 Ga0373946_0182161 3300035171 Bacteria 997
337 Ga0373955_0002137 3300035172 Bacteria 8539
338 Ga0373955_0010473 3300035172 Bacteria 4382
339 Ga0373942_0019948 3300035207 Bacteria 1679
340 Ga0373942_0045746 3300035207 Bacteria 1210
341 Ga0373962_0034016 3300035242 Bacteria 1409
342 Ga0316574_0217533 3300035398 Bacteria 1225
343 Ga0373924_0004868 3300035410 Bacteria 4717
344 Ga0373924_0009924 3300035410 Bacteria 3503
345 Ga0373924_0012888 3300035410 Bacteria 3132
346 Ga0373931_0000134 3300035691 Bacteria 33430
347 Ga0373931_0002977 3300035691 Bacteria 7567
348 Ga0373931_0004561 3300035691 Bacteria 6336
349 Ga0373931_0250381 3300035691 Unclassified 1077
350 Ga0373935_0012022 3300035692 Bacteria 5202
351 Ga0373935_0015429 3300035692 Bacteria 4618
352 Ga0373927_0042855 3300035695 Bacteria 2932
353 Ga0373927_0043694 3300035695 Bacteria 2900
354 Ga0373933_0036551 3300035724 Bacteria 2875
355 Ga0373933_0474167 3300035724 Archaea 819
356 Ga0373947_0053589 3300035725 Bacteria 2432
357 Ga0373947_0578632 3300035725 Unclassified 765
358 Ga0373937_0000646 3300036401 Bacteria 30603
359 Ga0373937_0006721 3300036401 Bacteria 9921
360 Ga0373937_0018224 3300036401 Bacteria 6266
361 Ga0373937_0039910 3300036401 Bacteria 4278
362 Ga0373937_0272028 3300036401 Bacteria 1599
363 Ga0373937_0311226 3300036401 Bacteria 1490
364 Ga0373937_0390844 3300036401 Bacteria 1319
365 Ga0316582_0000784 3300036647 Bacteria 12827
366 Ga0316584_0257507 3300036712 Bacteria 1273
367 Ga0373925_0022805 3300037068 Bacteria 4569
368 Ga0373925_0027389 3300037068 Bacteria 4171
369 Ga0373925_0181953 3300037068 Bacteria 1664
370 Ga0316581_0005299 3300037588 Bacteria 3349
371 Ga0439453_0000413 3300041408 Bacteria 4604
372 Ga0451807_1154876 3300041486 Bacteria 3129
373 Ga0439441_000175 3300042001 Bacteria 5721
374 Ga0439441_000300 3300042001 Bacteria 4958
375 Ga0439441_003526 3300042001 Bacteria 2315
376 Ga0439442_051484 3300042002 Bacteria 869
377 Ga0439443_001970 3300042003 Bacteria 2383
378 Ga0439456_013918 3300042013 Bacteria 1676
379 Ga0439446_0011264 3300042156 Bacteria 2425
380 Ga0439446_0035582 3300042156 Bacteria 1453
381 Ga0439446_0079714 3300042156 Bacteria 1013
382 Ga0439434_0000165 3300042435 Bacteria 17901
383 Ga0439434_0055467 3300042435 Bacteria 1233
384 Ga0439435_0000132 3300042436 Bacteria 9910
385 Ga0439435_0011080 3300042436 Bacteria 2156
386 Ga0439444_0010082 3300042437 Bacteria 1503
387 Ga0439444_0016698 3300042437 Bacteria 1252
388 Ga0439460_0000243 3300042461 Bacteria 11109
389 Ga0439460_0001886 3300042461 Bacteria 5004
390 Ga0450893_0012037 3300042532 Bacteria 1434
391 Ga0451577_0149036 3300042876 Bacteria 2104
392 Ga0466957_0109729 3300044842 Bacteria 1749
393 Ga0451576_0005699 3300045051 Bacteria 15536
394 Ga0451576_0043018 3300045051 Bacteria 4767
395 Ga0451576_0430506 3300045051 Bacteria 1384
396 Ga0451576_1121439 3300045051 Unclassified 823
397 Ga0495592_0019870 3300046454 Bacteria 5107
398 Ga0495603_0116160 3300046455 Bacteria 1560
399 Ga0495641_0031513 3300046461 Bacteria 2533
400 Ga0495651_0260565 3300046462 Bacteria 1180
401 Ga0495580_0028878 3300046472 Bacteria 4029
402 Ga0495582_0013615 3300046473 Bacteria 4478
403 Ga0495639_0007114 3300046475 Bacteria 4806
404 Ga0495639_0069489 3300046475 Bacteria 1625
405 Ga0495662_0013077 3300046476 Bacteria 4042
406 Ga0495608_0000913 3300046511 Bacteria 20720
407 Ga0495628_0004622 3300046516 Bacteria 12162
408 Ga0495628_0547790 3300046516 Bacteria 831
409 Ga0495630_0035426 3300046517 Bacteria 3729
410 Ga0495630_0269682 3300046517 Bacteria 1300
411 Ga0495666_0040539 3300046526 Bacteria 2257
412 Ga0495666_0177718 3300046526 Bacteria 983
413 Ga0495652_0081831 3300046529 Bacteria 2663
414 Ga0495665_0016002 3300046531 Bacteria 4042
415 Ga0495640_0001515 3300046533 Bacteria 18292
416 Ga0495586_0001426 3300046535 Bacteria 13223
417 Ga0495586_0025477 3300046535 Bacteria 3165
418 Ga0495586_0215998 3300046535 Bacteria 1089
419 Ga0495645_0092243 3300046543 Bacteria 2163
420 Ga0495667_0005087 3300046559 Bacteria 8891
421 Ga0495667_0064899 3300046559 Bacteria 2388
422 Ga0495656_0005519 3300046615 Bacteria 4370
423 Ga0495634_0036458 3300046642 Bacteria 3363
424 Ga0495634_0420173 3300046642 Bacteria 792
425 Ga0495635_0235012 3300046663 Bacteria 1237
426 Ga0495657_0310915 3300046675 Archaea 938
427 Ga0495623_0399543 3300046679 Unclassified 740
428 Ga0495647_0000674 3300046681 Bacteria 10164
429 Ga0495658_0001043 3300046683 Bacteria 14639
430 Ga0495658_0041954 3300046683 Bacteria 2552
431 Ga0495613_0021648 3300046689 Bacteria 4789
432 Ga0495624_0042710 3300046690 Bacteria 2897
433 Ga0495624_0119077 3300046690 Bacteria 1622
434 Ga0495600_0020498 3300046809 Bacteria 4228
435 Ga0495581_0226858 3300047315 Bacteria 1093
436 Ga0495636_0012131 3300047318 Bacteria 3413
437 Ga0495680_0001187 3300047322 Bacteria 28585
438 Ga0495680_0059099 3300047322 Bacteria 2961
439 Ga0495593_0043827 3300047673 Bacteria 2396
440 Ga0496106_0414772 3300048909 Bacteria 1082
441 Ga0501032_0050336 3300049569 Bacteria 2809
442 Ga0501033_0004036 3300049570 Bacteria 11859
443 Ga0501033_0377636 3300049570 Bacteria 990
444 Ga0501036_0000314 3300049572 Bacteria 33786
445 Ga0501036_0297896 3300049572 Bacteria 1349
446 Ga0501037_0057939 3300049573 Bacteria 2827
447 Ga0501038_0002946 3300049574 Bacteria 15875
448 Ga0501038_0113324 3300049574 Bacteria 2244
449 Ga0501038_0240965 3300049574 Bacteria 1436
450 Ga0501039_0000438 3300049575 Bacteria 30118
451 Ga0501039_0114897 3300049575 Bacteria 2106
452 Ga0501039_0243923 3300049575 Bacteria 1413
453 Ga0501039_0907045 3300049575 Unclassified 686
454 Ga0501040_0000261 3300049576 Bacteria 30880
455 Ga0501040_0011163 3300049576 Bacteria 5874
456 Ga0501040_0113999 3300049576 Bacteria 1892
457 Ga0501040_0143734 3300049576 Bacteria 1681
458 Ga0501041_0000207 3300049577 Bacteria 27155
459 Ga0501041_0014791 3300049577 Bacteria 4635
460 Ga0501041_0064124 3300049577 Bacteria 2250
461 Ga0501042_0007514 3300049578 Bacteria 7145
462 Ga0501042_0066965 3300049578 Bacteria 2567
463 Ga0501042_0087381 3300049578 Bacteria 2237
464 Ga0501043_1006144 3300049579 Bacteria 593
465 Ga0501046_0000806 3300049580 Bacteria 30435
466 Ga0501046_0133856 3300049580 Bacteria 1879
467 Ga0501046_0192317 3300049580 Bacteria 1521
468 Ga0501046_0632788 3300049580 Bacteria 757
469 Ga0501048_0001059 3300049582 Bacteria 20596
470 Ga0501048_0022772 3300049582 Bacteria 4580
471 Ga0501048_0194391 3300049582 Bacteria 1438
472 Ga0501068_0448966 3300049584 Bacteria 834
473 Ga0501070_0015814 3300049586 Bacteria 6345
474 Ga0501071_0005067 3300049587 Bacteria 8428
475 Ga0501071_0038892 3300049587 Bacteria 3401
476 Ga0501072_0000329 3300049588 Bacteria 33886
477 Ga0501072_0039983 3300049588 Bacteria 3682
478 Ga0501072_0331194 3300049588 Bacteria 1210
479 Ga0501073_0033825 3300049589 Bacteria 3638
480 Ga0501073_0162171 3300049589 Bacteria 1549
481 Ga0501073_0352410 3300049589 Bacteria 1016
482 Ga0501074_0019835 3300049590 Bacteria 4883
483 Ga0501074_0111957 3300049590 Unclassified 1953
484 Ga0501075_0004029 3300049591 Bacteria 9907
485 Ga0501075_0006513 3300049591 Bacteria 8039
486 Ga0501075_0221771 3300049591 Bacteria 1442
487 Ga0501075_0325865 3300049591 Bacteria 1170
488 Ga0501076_0000989 3300049592 Bacteria 18566
489 Ga0501076_0015089 3300049592 Bacteria 5833
490 Ga0501076_0415795 3300049592 Bacteria 1106
491 Ga0501077_0001375 3300049593 Bacteria 14643
492 Ga0501077_0022365 3300049593 Bacteria 4005
493 Ga0501216_055218 3300049660 Bacteria 789
494 Ga0501079_0000149 3300049741 Bacteria 38185
495 Ga0501079_0108813 3300049741 Bacteria 2152
496 Ga0501079_0294443 3300049741 Bacteria 1269
497 Ga0501080_0012142 3300049742 Bacteria 7892
498 Ga0501080_0085783 3300049742 Bacteria 2926
499 Ga0501080_0121795 3300049742 Bacteria 2417
500 Ga0501080_0264596 3300049742 Bacteria 1566
501 Ga0501081_0000497 3300049743 Bacteria 21992
502 Ga0501081_0000738 3300049743 Bacteria 19080
503 Ga0501035_0023262 3300049822 Bacteria 5683
504 Ga0501035_0061931 3300049822 Bacteria 3329
505 Ga0501035_0111940 3300049822 Bacteria 2392
506 Ga0501045_0000100 3300049824 Bacteria 42747
507 Ga0501045_0154150 3300049824 Bacteria 1709
508 Ga0501045_0521865 3300049824 Bacteria 882
509 nmdc:mga05p37_1001973_c1 3300050507 Bacteria 887
510 nmdc:mga05p37_114313_c1 3300050507 Bacteria 3318
511 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
512 nmdc:mga05p37_246548_c1 3300050507 Bacteria 2144
513 nmdc:mga05p37_478462_c1 3300050507 Bacteria 1435
514 nmdc:mga05p37_847220_c1 3300050507 Bacteria 993
515 nmdc:mga09592_350_c1 3300050508 Bacteria 33875
516 nmdc:mga09592_685247_c1 3300050508 Bacteria 873
517 nmdc:mga0qj67_143171_c1 3300050509 Bacteria 1938
518 nmdc:mga0qj67_1671_c1 3300050509 Bacteria 15623
519 nmdc:mga0qj67_26351_c1 3300050509 Bacteria 4500
520 nmdc:mga0qj67_27614_c1 3300050509 Bacteria 4401
521 nmdc:mga0qj67_62433_c1 3300050509 Bacteria 2961
522 nmdc:mga06r32_272914_c1 3300050510 Bacteria 1679
523 nmdc:mga06r32_48163_c1 3300050510 Bacteria 4074
524 nmdc:mga06r32_83258_c1 3300050510 Bacteria 3117
525 nmdc:mga08y16_2879_c1 3300050511 Bacteria 17709
526 nmdc:mga08y16_30512_c1 3300050511 Bacteria 5673
527 nmdc:mga08y16_54165_c1 3300050511 Bacteria 4192
528 nmdc:mga08y16_73615_c1 3300050511 Bacteria 3560
529 nmdc:mga08y16_91009_c1 3300050511 Bacteria 3180
530 nmdc:mga0n895_10896_c1 3300050512 Bacteria 8075
531 nmdc:mga0n895_42998_c1 3300050512 Bacteria 4400
532 nmdc:mga0n895_468_c1 3300050512 Bacteria 27132
533 nmdc:mga0rr50_1288_c1 3300050513 Bacteria 13672
534 nmdc:mga0rr50_139419_c1 3300050513 Bacteria 1949
535 nmdc:mga0rr50_145_c1 3300050513 Bacteria 39313
536 nmdc:mga0rr50_2771_c1 3300050513 Bacteria 9956
537 nmdc:mga08x19_20102_c2 3300050514 Bacteria 3788
538 nmdc:mga08x19_28186_c1 3300050514 Bacteria 3516
539 nmdc:mga08x19_305277_c1 3300050514 Bacteria 1106
540 nmdc:mga08x19_522_c1 3300050514 Bacteria 25573
541 nmdc:mga08x19_55_c1 3300050514 Bacteria 120851
542 nmdc:mga0a205_1077_c1 3300050515 Bacteria 22648
543 nmdc:mga0a205_137556_c1 3300050515 Bacteria 2343
544 nmdc:mga0a205_19674_c1 3300050515 Bacteria 4758
545 Ga0495601_0104567 3300053077 Unclassified 1830
546 Ga0495595_0064738 3300053084 Bacteria 1719
547 Ga0495619_0154357 3300053085 Bacteria 1584
548 Ga0501084_0005737 3300054114 Bacteria 10205
549 Ga0501084_0028728 3300054114 Bacteria 4650
550 Ga0501084_0161052 3300054114 Bacteria 1893
551 Ga0501082_0004296 3300060353 Bacteria 12455
552 Ga0501082_0049462 3300060353 Bacteria 3626
553 Ga0530510_0000579 3300061734 Bacteria 23494
554 Ga0530510_0001762 3300061734 Bacteria 14739
555 Ga0530510_0321135 3300061734 Bacteria 1161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100455766 Ga0070706_1004557661 171
2 3300049579 Ga0501043_1006144 Ga0501043_1006144_55_576 171
3 3300026095 Ga0207676_10072364 Ga0207676_100723643 174
4 3300036401 Ga0373937_0311226 Ga0373937_0311226_270_884 175
5 3300006846 Ga0075430_100000063 Ga0075430_10000006314 176
6 3300006847 Ga0075431_100029695 Ga0075431_1000296954 176
7 3300042001 Ga0439441_003526 Ga0439441_003526_297_860 176
8 3300042436 Ga0439435_0011080 Ga0439435_0011080_1298_1861 176
9 3300042437 Ga0439444_0010082 Ga0439444_0010082_311_874 176
10 3300042461 Ga0439460_0000243 Ga0439460_0000243_10352_10915 176
11 3300042532 Ga0450893_0012037 Ga0450893_0012037_377_940 176
12 3300049576 Ga0501040_0113999 Ga0501040_0113999_31_594 176
13 3300050508 nmdc:mga09592_685247_c1 nmdc:mga09592_685247_c1_323_862 176
14 3300050509 nmdc:mga0qj67_1671_c1 nmdc:mga0qj67_1671_c1_11610_12149 176
15 3300050510 nmdc:mga06r32_48163_c1 nmdc:mga06r32_48163_c1_2335_2874 176
16 3300061734 Ga0530510_0321135 Ga0530510_0321135_550_1113 176
17 3300005353 Ga0070669_100858560 Ga0070669_1008585601 179
18 3300006847 Ga0075431_100113319 Ga0075431_1001133192 179
19 3300009094 Ga0111539_10041451 Ga0111539_100414512 179
20 3300009147 Ga0114129_10989165 Ga0114129_109891652 179
21 3300027907 Ga0207428_10028576 Ga0207428_100285763 179
22 3300028380 Ga0268265_10033842 Ga0268265_100338423 179
23 3300035114 Ga0373939_0201302 Ga0373939_0201302_57_617 179
24 3300050509 nmdc:mga0qj67_26351_c1 nmdc:mga0qj67_26351_c1_793_1353 179
25 3300050509 nmdc:mga0qj67_62433_c1 nmdc:mga0qj67_62433_c1_1312_1872 179
26 3300050510 nmdc:mga06r32_272914_c1 nmdc:mga06r32_272914_c1_105_665 179
27 3300050511 nmdc:mga08y16_91009_c1 nmdc:mga08y16_91009_c1_1188_1748 179
28 3300005295 Ga0065707_10422218 Ga0065707_104222182 180
29 3300005328 Ga0070676_10117618 Ga0070676_101176182 180
30 3300005336 Ga0070680_100043245 Ga0070680_1000432452 180
31 3300005338 Ga0068868_100402997 Ga0068868_1004029971 180
32 3300005343 Ga0070687_100039763 Ga0070687_1000397632 180
33 3300005347 Ga0070668_100012347 Ga0070668_1000123472 180
34 3300005354 Ga0070675_100007884 Ga0070675_1000078843 180
35 3300005354 Ga0070675_100744755 Ga0070675_1007447552 180
36 3300005438 Ga0070701_10056487 Ga0070701_100564872 180
37 3300005438 Ga0070701_10299829 Ga0070701_102998291 180
38 3300005441 Ga0070700_100002744 Ga0070700_1000027444 180
39 3300005441 Ga0070700_100503759 Ga0070700_1005037592 180
40 3300005459 Ga0068867_100000126 Ga0068867_10000012624 180
41 3300005539 Ga0068853_100720965 Ga0068853_1007209651 180
42 3300005543 Ga0070672_100213794 Ga0070672_1002137942 180
43 3300005544 Ga0070686_100439233 Ga0070686_1004392332 180
44 3300005546 Ga0070696_100124529 Ga0070696_1001245292 180
45 3300005549 Ga0070704_101034007 Ga0070704_1010340072 180
46 3300005615 Ga0070702_100445982 Ga0070702_1004459822 180
47 3300005617 Ga0068859_100018583 Ga0068859_1000185835 180
48 3300005718 Ga0068866_10215718 Ga0068866_102157182 180
49 3300005719 Ga0068861_100000134 Ga0068861_10000013414 180
50 3300005843 Ga0068860_100813832 Ga0068860_1008138321 180
51 3300005844 Ga0068862_100001111 Ga0068862_1000011115 180
52 3300005844 Ga0068862_100146396 Ga0068862_1001463962 180
53 3300005844 Ga0068862_100268040 Ga0068862_1002680402 180
54 3300006847 Ga0075431_100015155 Ga0075431_1000151553 180
55 3300006880 Ga0075429_100019585 Ga0075429_1000195855 180
56 3300006881 Ga0068865_100026071 Ga0068865_1000260713 180
57 3300006931 Ga0097620_100018583 Ga0097620_1000185834 180
58 3300009094 Ga0111539_10240521 Ga0111539_102405212 180
59 3300009147 Ga0114129_10110095 Ga0114129_101100952 180
60 3300009147 Ga0114129_11310859 Ga0114129_113108592 180
61 3300009148 Ga0105243_10003894 Ga0105243_100038945 180
62 3300009553 Ga0105249_10011629 Ga0105249_100116292 180
63 3300014326 Ga0157380_10003099 Ga0157380_100030999 180
64 3300014745 Ga0157377_10159148 Ga0157377_101591482 180
65 3300025907 Ga0207645_10047899 Ga0207645_100478992 180
66 3300025907 Ga0207645_10113741 Ga0207645_101137412 180
67 3300025908 Ga0207643_10252399 Ga0207643_102523992 180
68 3300025917 Ga0207660_10031530 Ga0207660_100315302 180
69 3300025918 Ga0207662_10007825 Ga0207662_100078255 180
70 3300025923 Ga0207681_10000301 Ga0207681_1000030124 180
71 3300025926 Ga0207659_10057259 Ga0207659_100572592 180
72 3300025926 Ga0207659_10209648 Ga0207659_102096482 180
73 3300025935 Ga0207709_10002128 Ga0207709_100021285 180
74 3300025936 Ga0207670_10067142 Ga0207670_100671422 180
75 3300025938 Ga0207704_10000660 Ga0207704_1000066015 180
76 3300025940 Ga0207691_10531130 Ga0207691_105311302 180
77 3300025942 Ga0207689_10012667 Ga0207689_100126676 180
78 3300025960 Ga0207651_10120563 Ga0207651_101205632 180
79 3300025961 Ga0207712_10011207 Ga0207712_100112072 180
80 3300025972 Ga0207668_10007568 Ga0207668_100075685 180
81 3300026041 Ga0207639_11155397 Ga0207639_111553972 180
82 3300026075 Ga0207708_10000697 Ga0207708_100006974 180
83 3300026089 Ga0207648_10000352 Ga0207648_1000035244 180
84 3300026118 Ga0207675_100000223 Ga0207675_10000022339 180
85 3300026121 Ga0207683_10531499 Ga0207683_105314992 180
86 3300027378 Ga0209981_1022771 Ga0209981_10227712 180
87 3300027395 Ga0209996_1013243 Ga0209996_10132432 180
88 3300027471 Ga0209995_1006185 Ga0209995_10061852 180
89 3300027665 Ga0209983_1002209 Ga0209983_10022092 180
90 3300027695 Ga0209966_1002603 Ga0209966_10026032 180
91 3300027695 Ga0209966_1008975 Ga0209966_10089753 180
92 3300027717 Ga0209998_10006830 Ga0209998_100068302 180
93 3300027907 Ga0207428_10255647 Ga0207428_102556472 180
94 3300028380 Ga0268265_10000579 Ga0268265_1000057914 180
95 3300028380 Ga0268265_10393315 Ga0268265_103933152 180
96 3300028381 Ga0268264_10519347 Ga0268264_105193472 180
97 3300035115 Ga0373941_0110145 Ga0373941_0110145_243_818 180
98 3300041408 Ga0439453_0000413 Ga0439453_0000413_613_1176 180
99 3300042001 Ga0439441_000175 Ga0439441_000175_1213_1776 180
100 3300042002 Ga0439442_051484 Ga0439442_051484_165_710 180
101 3300042003 Ga0439443_001970 Ga0439443_001970_628_1191 180
102 3300042013 Ga0439456_013918 Ga0439456_013918_400_963 180
103 3300042156 Ga0439446_0011264 Ga0439446_0011264_1400_1945 180
104 3300042156 Ga0439446_0035582 Ga0439446_0035582_645_1208 180
105 3300042435 Ga0439434_0000165 Ga0439434_0000165_16715_17260 180
106 3300042436 Ga0439435_0000132 Ga0439435_0000132_9169_9714 180
107 3300042437 Ga0439444_0016698 Ga0439444_0016698_652_1215 180
108 3300042461 Ga0439460_0001886 Ga0439460_0001886_4232_4795 180
109 3300049570 Ga0501033_0377636 Ga0501033_0377636_393_956 180
110 3300049572 Ga0501036_0297896 Ga0501036_0297896_521_1084 180
111 3300049574 Ga0501038_0113324 Ga0501038_0113324_491_1054 180
112 3300049575 Ga0501039_0114897 Ga0501039_0114897_1249_1812 180
113 3300049576 Ga0501040_0011163 Ga0501040_0011163_2527_3090 180
114 3300049577 Ga0501041_0014791 Ga0501041_0014791_1990_2553 180
115 3300049578 Ga0501042_0066965 Ga0501042_0066965_296_859 180
116 3300049580 Ga0501046_0192317 Ga0501046_0192317_655_1218 180
117 3300049582 Ga0501048_0022772 Ga0501048_0022772_3135_3698 180
118 3300049587 Ga0501071_0038892 Ga0501071_0038892_1193_1756 180
119 3300049589 Ga0501073_0352410 Ga0501073_0352410_387_950 180
120 3300049590 Ga0501074_0111957 Ga0501074_0111957_14_577 180
121 3300049591 Ga0501075_0006513 Ga0501075_0006513_2220_2783 180
122 3300049592 Ga0501076_0015089 Ga0501076_0015089_2439_3002 180
123 3300049593 Ga0501077_0022365 Ga0501077_0022365_765_1328 180
124 3300049741 Ga0501079_0108813 Ga0501079_0108813_735_1298 180
125 3300049742 Ga0501080_0012142 Ga0501080_0012142_1251_1814 180
126 3300049743 Ga0501081_0000738 Ga0501081_0000738_12727_13290 180
127 3300049822 Ga0501035_0061931 Ga0501035_0061931_1759_2322 180
128 3300049824 Ga0501045_0154150 Ga0501045_0154150_886_1449 180
129 3300050507 nmdc:mga05p37_114313_c1 nmdc:mga05p37_114313_c1_1512_2075 180
130 3300050511 nmdc:mga08y16_54165_c1 nmdc:mga08y16_54165_c1_2766_3329 180
131 3300054114 Ga0501084_0028728 Ga0501084_0028728_3968_4531 180
132 3300060353 Ga0501082_0049462 Ga0501082_0049462_928_1491 180
133 3300061734 Ga0530510_0001762 Ga0530510_0001762_9168_9731 180
134 3300005981 Ga0081538_10099149 Ga0081538_100991492 181
135 3300009147 Ga0114129_10298511 Ga0114129_102985112 181
136 3300026075 Ga0207708_10774211 Ga0207708_107742112 181
137 3300027364 Ga0209967_1017464 Ga0209967_10174642 181
138 3300027378 Ga0209981_1009862 Ga0209981_10098622 181
139 3300027462 Ga0210000_1025507 Ga0210000_10255072 181
140 3300027614 Ga0209970_1028308 Ga0209970_10283082 181
141 3300049574 Ga0501038_0240965 Ga0501038_0240965_116_682 181
142 3300049575 Ga0501039_0907045 Ga0501039_0907045_27_593 181
143 3300049576 Ga0501040_0143734 Ga0501040_0143734_274_840 181
144 3300049577 Ga0501041_0064124 Ga0501041_0064124_1461_2027 181
145 3300049578 Ga0501042_0087381 Ga0501042_0087381_1464_2030 181
146 3300049580 Ga0501046_0632788 Ga0501046_0632788_80_646 181
147 3300049584 Ga0501068_0448966 Ga0501068_0448966_35_601 181
148 3300049588 Ga0501072_0331194 Ga0501072_0331194_354_920 181
149 3300049591 Ga0501075_0325865 Ga0501075_0325865_133_699 181
150 3300049741 Ga0501079_0294443 Ga0501079_0294443_326_892 181
151 3300049742 Ga0501080_0121795 Ga0501080_0121795_439_1005 181
152 3300049822 Ga0501035_0111940 Ga0501035_0111940_221_787 181
153 3300049824 Ga0501045_0521865 Ga0501045_0521865_72_638 181
154 3300050507 nmdc:mga05p37_1001973_c1 nmdc:mga05p37_1001973_c1_25_591 181
155 3300005614 Ga0068856_100371922 Ga0068856_1003719221 182
156 3300006846 Ga0075430_100006901 Ga0075430_1000069014 182
157 3300006847 Ga0075431_100132949 Ga0075431_1001329492 182
158 3300026078 Ga0207702_10318489 Ga0207702_103184892 182
159 3300042156 Ga0439446_0079714 Ga0439446_0079714_224_790 182
160 3300042435 Ga0439434_0055467 Ga0439434_0055467_402_968 182
161 3300050509 nmdc:mga0qj67_27614_c1 nmdc:mga0qj67_27614_c1_2022_2588 182
162 3300050510 nmdc:mga06r32_83258_c1 nmdc:mga06r32_83258_c1_1727_2293 182
163 3300050507 nmdc:mga05p37_847220_c1 nmdc:mga05p37_847220_c1_229_804 183
164 3300005295 Ga0065707_10433339 Ga0065707_104333392 184
165 3300005444 Ga0070694_100098869 Ga0070694_1000988692 184
166 3300005615 Ga0070702_100046156 Ga0070702_1000461562 185
167 3300006358 Ga0068871_101067921 Ga0068871_1010679211 185
168 3300009177 Ga0105248_10971398 Ga0105248_109713982 185
169 3300025938 Ga0207704_10480794 Ga0207704_104807942 187
170 3300035117 Ga0373953_0032392 Ga0373953_0032392_67_684 189
171 3300035118 Ga0373954_0000002 Ga0373954_0000002_103244_103861 189
172 3300035172 Ga0373955_0010473 Ga0373955_0010473_1149_1766 189
173 3300035410 Ga0373924_0012888 Ga0373924_0012888_1896_2513 189
174 3300035691 Ga0373931_0250381 Ga0373931_0250381_29_634 189
175 3300036401 Ga0373937_0000646 Ga0373937_0000646_6698_7315 189
176 3300046679 Ga0495623_0399543 Ga0495623_0399543_100_717 189
177 3300006844 Ga0075428_100509725 Ga0075428_1005097252 190
178 3300026089 Ga0207648_10347786 Ga0207648_103477862 190
179 3300044842 Ga0466957_0109729 Ga0466957_0109729_1098_1694 190
180 3300005434 Ga0070709_10160134 Ga0070709_101601342 191
181 3300005518 Ga0070699_101329823 Ga0070699_1013298231 191
182 3300005546 Ga0070696_100191285 Ga0070696_1001912852 191
183 3300005614 Ga0068856_100597995 Ga0068856_1005979952 191
184 3300005615 Ga0070702_100424242 Ga0070702_1004242422 191
185 3300009176 Ga0105242_10000823 Ga0105242_1000082315 191
186 3300025906 Ga0207699_10665556 Ga0207699_106655561 191
187 3300025934 Ga0207686_10014439 Ga0207686_100144392 191
188 3300005338 Ga0068868_100143534 Ga0068868_1001435342 193
189 3300005340 Ga0070689_100074829 Ga0070689_1000748292 193
190 3300005343 Ga0070687_100072962 Ga0070687_1000729622 193
191 3300005437 Ga0070710_10035208 Ga0070710_100352082 193
192 3300005439 Ga0070711_100041319 Ga0070711_1000413192 193
193 3300005535 Ga0070684_100024281 Ga0070684_1000242812 193
194 3300005544 Ga0070686_100013122 Ga0070686_1000131225 193
195 3300005617 Ga0068859_100388507 Ga0068859_1003885072 193
196 3300005842 Ga0068858_100553809 Ga0068858_1005538092 193
197 3300006237 Ga0097621_100000368 Ga0097621_10000036813 193
198 3300006358 Ga0068871_100003416 Ga0068871_1000034166 193
199 3300006931 Ga0097620_100388541 Ga0097620_1003885412 193
200 3300014969 Ga0157376_10084950 Ga0157376_100849502 193
201 3300025918 Ga0207662_10028980 Ga0207662_100289802 193
202 3300025936 Ga0207670_10048018 Ga0207670_100480182 193
203 3300025960 Ga0207651_10153527 Ga0207651_101535272 193
204 3300026035 Ga0207703_10808390 Ga0207703_108083902 193
205 3300032133 Ga0316583_10006500 Ga0316583_100065004 193
206 3300035117 Ga0373953_0001215 Ga0373953_0001215_3389_3982 193
207 3300035118 Ga0373954_0122266 Ga0373954_0122266_57_650 193
208 3300035121 Ga0373960_0008088 Ga0373960_0008088_609_1208 193
209 3300035172 Ga0373955_0002137 Ga0373955_0002137_3142_3735 193
210 3300035207 Ga0373942_0045746 Ga0373942_0045746_304_903 193
211 3300035410 Ga0373924_0004868 Ga0373924_0004868_2517_3110 193
212 3300035691 Ga0373931_0002977 Ga0373931_0002977_1269_1868 193
213 3300035724 Ga0373933_0036551 Ga0373933_0036551_1676_2269 193
214 3300035725 Ga0373947_0578632 Ga0373947_0578632_66_659 193
215 3300036401 Ga0373937_0039910 Ga0373937_0039910_2284_2877 193
216 3300037068 Ga0373925_0181953 Ga0373925_0181953_594_1187 193
217 3300041486 Ga0451807_1154876 Ga0451807_1154876_2463_3056 193
218 3300046559 Ga0495667_0064899 Ga0495667_0064899_1401_1994 193
219 3300047322 Ga0495680_0059099 Ga0495680_0059099_286_879 193
220 3300049660 Ga0501216_055218 Ga0501216_055218_129_722 193
221 3300053084 Ga0495595_0064738 Ga0495595_0064738_650_1243 193
222 3300005459 Ga0068867_100390428 Ga0068867_1003904282 194
223 3300009098 Ga0105245_10461920 Ga0105245_104619202 194
224 3300026089 Ga0207648_10444547 Ga0207648_104445472 194
225 3300027378 Ga0209981_1001021 Ga0209981_10010213 194
226 3300027462 Ga0210000_1004369 Ga0210000_10043692 194
227 3300027543 Ga0209999_1000687 Ga0209999_10006875 194
228 3300027682 Ga0209971_1043655 Ga0209971_10436552 194
229 3300031548 Ga0307408_100950247 Ga0307408_1009502472 194
230 3300026118 Ga0207675_101304744 Ga0207675_1013047441 195
231 3300035121 Ga0373960_0076433 Ga0373960_0076433_82_681 195
232 3300049589 Ga0501073_0033825 Ga0501073_0033825_1671_2300 195
233 3300049742 Ga0501080_0264596 Ga0501080_0264596_457_1086 195
234 3300005343 Ga0070687_100329639 Ga0070687_1003296392 196
235 3300005545 Ga0070695_100428986 Ga0070695_1004289862 196
236 3300005546 Ga0070696_100510923 Ga0070696_1005109232 196
237 3300005549 Ga0070704_100197327 Ga0070704_1001973272 196
238 3300006852 Ga0075433_10165962 Ga0075433_101659622 196
239 3300007076 Ga0075435_100020168 Ga0075435_1000201682 196
240 3300025918 Ga0207662_10167540 Ga0207662_101675402 196
241 3300035084 Ga0373928_0017323 Ga0373928_0017323_13_609 196
242 3300045051 Ga0451576_1121439 Ga0451576_1121439_119_736 196
243 3300050513 nmdc:mga0rr50_1288_c1 nmdc:mga0rr50_1288_c1_12592_13200 196
244 3300050515 nmdc:mga0a205_19674_c1 nmdc:mga0a205_19674_c1_3481_4089 196
245 3300005295 Ga0065707_10012777 Ga0065707_100127772 197
246 3300005295 Ga0065707_10091059 Ga0065707_100910595 197
247 3300005330 Ga0070690_100000082 Ga0070690_10000008217 197
248 3300005330 Ga0070690_100161145 Ga0070690_1001611452 197
249 3300005334 Ga0068869_100000044 Ga0068869_10000004412 197
250 3300005334 Ga0068869_100139584 Ga0068869_1001395842 197
251 3300005335 Ga0070666_10075840 Ga0070666_100758402 197
252 3300005336 Ga0070680_100000771 Ga0070680_1000007713 197
253 3300005337 Ga0070682_100080731 Ga0070682_1000807312 197
254 3300005338 Ga0068868_100000780 Ga0068868_10000078015 197
255 3300005338 Ga0068868_100399774 Ga0068868_1003997742 197
256 3300005340 Ga0070689_100002046 Ga0070689_1000020467 197
257 3300005341 Ga0070691_10000079 Ga0070691_100000799 197
258 3300005343 Ga0070687_100000034 Ga0070687_10000003443 197
259 3300005353 Ga0070669_100357931 Ga0070669_1003579312 197
260 3300005364 Ga0070673_100093425 Ga0070673_1000934252 197
261 3300005367 Ga0070667_101274264 Ga0070667_1012742641 197
262 3300005406 Ga0070703_10005461 Ga0070703_100054613 197
263 3300005438 Ga0070701_10000247 Ga0070701_100002478 197
264 3300005440 Ga0070705_100000030 Ga0070705_10000003044 197
265 3300005440 Ga0070705_101053708 Ga0070705_1010537081 197
266 3300005441 Ga0070700_100001187 Ga0070700_1000011878 197
267 3300005444 Ga0070694_100000202 Ga0070694_10000020212 197
268 3300005459 Ga0068867_100000032 Ga0068867_10000003215 197
269 3300005530 Ga0070679_100004882 Ga0070679_1000048824 197
270 3300005536 Ga0070697_100196066 Ga0070697_1001960661 197
271 3300005544 Ga0070686_100000286 Ga0070686_10000028614 197
272 3300005545 Ga0070695_100000818 Ga0070695_10000081811 197
273 3300005546 Ga0070696_100000344 Ga0070696_10000034417 197
274 3300005546 Ga0070696_100192339 Ga0070696_1001923392 197
275 3300005547 Ga0070693_100000100 Ga0070693_10000010029 197
276 3300005547 Ga0070693_100166047 Ga0070693_1001660472 197
277 3300005549 Ga0070704_100000159 Ga0070704_1000001597 197
278 3300005563 Ga0068855_100000695 Ga0068855_10000069516 197
279 3300005563 Ga0068855_100555021 Ga0068855_1005550212 197
280 3300005578 Ga0068854_100025568 Ga0068854_1000255682 197
281 3300005614 Ga0068856_100042208 Ga0068856_1000422083 197
282 3300005615 Ga0070702_100000001 Ga0070702_10000000175 197
283 3300005616 Ga0068852_100066231 Ga0068852_1000662312 197
284 3300005617 Ga0068859_100001620 Ga0068859_1000016207 197
285 3300005719 Ga0068861_100000057 Ga0068861_10000005712 197
286 3300005840 Ga0068870_10181724 Ga0068870_101817242 197
287 3300005842 Ga0068858_100000289 Ga0068858_10000028916 197
288 3300005842 Ga0068858_100097668 Ga0068858_1000976682 197
289 3300005843 Ga0068860_100004021 Ga0068860_1000040218 197
290 3300005843 Ga0068860_100142708 Ga0068860_1001427083 197
291 3300005844 Ga0068862_100000583 Ga0068862_10000058316 197
292 3300006237 Ga0097621_100000927 Ga0097621_1000009272 197
293 3300006358 Ga0068871_100000246 Ga0068871_10000024617 197
294 3300006844 Ga0075428_100000083 Ga0075428_10000008358 197
295 3300006852 Ga0075433_10003931 Ga0075433_100039312 197
296 3300006852 Ga0075433_10899415 Ga0075433_108994152 197
297 3300006871 Ga0075434_100000064 Ga0075434_10000006419 197
298 3300006871 Ga0075434_100016529 Ga0075434_1000165296 197
299 3300006871 Ga0075434_100053099 Ga0075434_1000530993 197
300 3300006880 Ga0075429_100001065 Ga0075429_10000106517 197
301 3300006881 Ga0068865_100000327 Ga0068865_1000003277 197
302 3300006914 Ga0075436_100003460 Ga0075436_1000034605 197
303 3300006914 Ga0075436_100034075 Ga0075436_1000340752 197
304 3300006931 Ga0097620_100001620 Ga0097620_1000016207 197
305 3300007076 Ga0075435_100000260 Ga0075435_10000026030 197
306 3300007076 Ga0075435_100013750 Ga0075435_1000137503 197
307 3300007076 Ga0075435_100331704 Ga0075435_1003317042 197
308 3300009094 Ga0111539_10003219 Ga0111539_100032198 197
309 3300009094 Ga0111539_10008749 Ga0111539_100087496 197
310 3300009098 Ga0105245_10000075 Ga0105245_1000007516 197
311 3300009098 Ga0105245_10478149 Ga0105245_104781491 197
312 3300009147 Ga0114129_10001164 Ga0114129_1000116423 197
313 3300009148 Ga0105243_10001533 Ga0105243_100015333 197
314 3300009174 Ga0105241_10020104 Ga0105241_100201043 197
315 3300009176 Ga0105242_10000359 Ga0105242_1000035917 197
316 3300009553 Ga0105249_10010306 Ga0105249_100103063 197
317 3300011119 Ga0105246_10337310 Ga0105246_103373101 197
318 3300013297 Ga0157378_10000074 Ga0157378_1000007479 197
319 3300014326 Ga0157380_10012618 Ga0157380_100126184 197
320 3300014969 Ga0157376_10015737 Ga0157376_100157373 197
321 3300025885 Ga0207653_10009902 Ga0207653_100099022 197
322 3300025899 Ga0207642_10003500 Ga0207642_100035002 197
323 3300025901 Ga0207688_10401305 Ga0207688_104013051 197
324 3300025903 Ga0207680_10245658 Ga0207680_102456582 197
325 3300025908 Ga0207643_10193448 Ga0207643_101934482 197
326 3300025911 Ga0207654_10012040 Ga0207654_100120402 197
327 3300025913 Ga0207695_10380068 Ga0207695_103800681 197
328 3300025917 Ga0207660_10013906 Ga0207660_100139062 197
329 3300025918 Ga0207662_10000319 Ga0207662_100003197 197
330 3300025923 Ga0207681_10312142 Ga0207681_103121422 197
331 3300025927 Ga0207687_10000832 Ga0207687_1000083216 197
332 3300025934 Ga0207686_10001412 Ga0207686_100014128 197
333 3300025935 Ga0207709_10000711 Ga0207709_1000071116 197
334 3300025936 Ga0207670_10002481 Ga0207670_100024815 197
335 3300025936 Ga0207670_10035961 Ga0207670_100359612 197
336 3300025938 Ga0207704_10000292 Ga0207704_1000029214 197
337 3300025939 Ga0207665_10047720 Ga0207665_100477203 197
338 3300025941 Ga0207711_10164270 Ga0207711_101642702 197
339 3300025942 Ga0207689_10000007 Ga0207689_10000007124 197
340 3300025942 Ga0207689_10514130 Ga0207689_105141302 197
341 3300025949 Ga0207667_10045637 Ga0207667_100456372 197
342 3300025949 Ga0207667_10285933 Ga0207667_102859331 197
343 3300025960 Ga0207651_10066743 Ga0207651_100667432 197
344 3300025961 Ga0207712_10006247 Ga0207712_100062472 197
345 3300025981 Ga0207640_10043507 Ga0207640_100435072 197
346 3300025986 Ga0207658_11073265 Ga0207658_110732652 197
347 3300026023 Ga0207677_10001738 Ga0207677_100017388 197
348 3300026035 Ga0207703_10000606 Ga0207703_1000060617 197
349 3300026035 Ga0207703_10079516 Ga0207703_100795162 197
350 3300026075 Ga0207708_10000086 Ga0207708_1000008658 197
351 3300026078 Ga0207702_10017383 Ga0207702_100173832 197
352 3300026078 Ga0207702_10061938 Ga0207702_100619382 197
353 3300026088 Ga0207641_10076138 Ga0207641_100761382 197
354 3300026089 Ga0207648_10000079 Ga0207648_1000007915 197
355 3300026118 Ga0207675_100000093 Ga0207675_10000009317 197
356 3300027876 Ga0209974_10075568 Ga0209974_100755682 197
357 3300027907 Ga0207428_10000321 Ga0207428_1000032160 197
358 3300027907 Ga0207428_10095016 Ga0207428_100950163 197
359 3300028380 Ga0268265_10005154 Ga0268265_100051548 197
360 3300028381 Ga0268264_10001253 Ga0268264_100012533 197
361 3300028381 Ga0268264_10113513 Ga0268264_101135133 197
362 3300031665 Ga0316575_10024709 Ga0316575_100247092 197
363 3300031691 Ga0316579_10000235 Ga0316579_100002359 197
364 3300031728 Ga0316578_10001845 Ga0316578_100018454 197
365 3300032133 Ga0316583_10001540 Ga0316583_100015404 197
366 3300034816 Ga0373930_0004162 Ga0373930_0004162_72_680 197
367 3300034817 Ga0373948_0003815 Ga0373948_0003815_888_1496 197
368 3300034819 Ga0373958_0008305 Ga0373958_0008305_668_1276 197
369 3300035083 Ga0373926_0001423 Ga0373926_0001423_6552_7160 197
370 3300035084 Ga0373928_0011079 Ga0373928_0011079_832_1440 197
371 3300035085 Ga0373929_0016877 Ga0373929_0016877_186_794 197
372 3300035088 Ga0373940_0006582 Ga0373940_0006582_432_1040 197
373 3300035089 Ga0373944_0002534 Ga0373944_0002534_1427_2035 197
374 3300035090 Ga0373949_0003832 Ga0373949_0003832_334_942 197
375 3300035091 Ga0373951_0002918 Ga0373951_0002918_367_975 197
376 3300035092 Ga0373952_0003595 Ga0373952_0003595_1910_2518 197
377 3300035092 Ga0373952_0011244 Ga0373952_0011244_1093_1701 197
378 3300035092 Ga0373952_0050122 Ga0373952_0050122_258_866 197
379 3300035111 Ga0373923_0080946 Ga0373923_0080946_778_1386 197
380 3300035113 Ga0373936_0005049 Ga0373936_0005049_4314_4922 197
381 3300035115 Ga0373941_0035719 Ga0373941_0035719_644_1252 197
382 3300035115 Ga0373941_0062674 Ga0373941_0062674_553_1161 197
383 3300035116 Ga0373945_0006474 Ga0373945_0006474_2704_3312 197
384 3300035121 Ga0373960_0008711 Ga0373960_0008711_1590_2198 197
385 3300035170 Ga0373943_0040586 Ga0373943_0040586_1432_2040 197
386 3300035171 Ga0373946_0003690 Ga0373946_0003690_1777_2385 197
387 3300035207 Ga0373942_0019948 Ga0373942_0019948_234_842 197
388 3300035242 Ga0373962_0034016 Ga0373962_0034016_31_639 197
389 3300035398 Ga0316574_0217533 Ga0316574_0217533_225_839 197
390 3300035410 Ga0373924_0009924 Ga0373924_0009924_1765_2373 197
391 3300035691 Ga0373931_0000134 Ga0373931_0000134_6479_7087 197
392 3300035691 Ga0373931_0004561 Ga0373931_0004561_3049_3657 197
393 3300035692 Ga0373935_0012022 Ga0373935_0012022_2664_3272 197
394 3300035695 Ga0373927_0042855 Ga0373927_0042855_393_1001 197
395 3300035725 Ga0373947_0053589 Ga0373947_0053589_393_1001 197
396 3300036647 Ga0316582_0000784 Ga0316582_0000784_7457_8071 197
397 3300036712 Ga0316584_0257507 Ga0316584_0257507_18_632 197
398 3300037068 Ga0373925_0027389 Ga0373925_0027389_936_1544 197
399 3300037588 Ga0316581_0005299 Ga0316581_0005299_420_1034 197
400 3300042876 Ga0451577_0149036 Ga0451577_0149036_750_1358 197
401 3300045051 Ga0451576_0005699 Ga0451576_0005699_2031_2639 197
402 3300046455 Ga0495603_0116160 Ga0495603_0116160_279_887 197
403 3300046472 Ga0495580_0028878 Ga0495580_0028878_448_1056 197
404 3300046473 Ga0495582_0013615 Ga0495582_0013615_3161_3769 197
405 3300046475 Ga0495639_0007114 Ga0495639_0007114_3597_4205 197
406 3300046526 Ga0495666_0040539 Ga0495666_0040539_1107_1715 197
407 3300046531 Ga0495665_0016002 Ga0495665_0016002_1291_1899 197
408 3300046535 Ga0495586_0025477 Ga0495586_0025477_325_933 197
409 3300046681 Ga0495647_0000674 Ga0495647_0000674_4866_5474 197
410 3300046683 Ga0495658_0001043 Ga0495658_0001043_5203_5811 197
411 3300048909 Ga0496106_0414772 Ga0496106_0414772_70_678 197
412 3300049569 Ga0501032_0050336 Ga0501032_0050336_289_897 197
413 3300049570 Ga0501033_0004036 Ga0501033_0004036_8977_9585 197
414 3300049572 Ga0501036_0000314 Ga0501036_0000314_15122_15730 197
415 3300049573 Ga0501037_0057939 Ga0501037_0057939_901_1509 197
416 3300049574 Ga0501038_0002946 Ga0501038_0002946_6106_6714 197
417 3300049575 Ga0501039_0000438 Ga0501039_0000438_11125_11733 197
418 3300049576 Ga0501040_0000261 Ga0501040_0000261_14994_15602 197
419 3300049577 Ga0501041_0000207 Ga0501041_0000207_13429_14037 197
420 3300049578 Ga0501042_0007514 Ga0501042_0007514_4519_5127 197
421 3300049580 Ga0501046_0000806 Ga0501046_0000806_17791_18399 197
422 3300049582 Ga0501048_0001059 Ga0501048_0001059_4711_5319 197
423 3300049586 Ga0501070_0015814 Ga0501070_0015814_2873_3481 197
424 3300049587 Ga0501071_0005067 Ga0501071_0005067_4857_5465 197
425 3300049588 Ga0501072_0000329 Ga0501072_0000329_28784_29392 197
426 3300049589 Ga0501073_0162171 Ga0501073_0162171_756_1364 197
427 3300049590 Ga0501074_0019835 Ga0501074_0019835_1158_1766 197
428 3300049591 Ga0501075_0004029 Ga0501075_0004029_2759_3367 197
429 3300049592 Ga0501076_0000989 Ga0501076_0000989_626_1234 197
430 3300049593 Ga0501077_0001375 Ga0501077_0001375_7888_8496 197
431 3300049741 Ga0501079_0000149 Ga0501079_0000149_27645_28253 197
432 3300049742 Ga0501080_0085783 Ga0501080_0085783_2016_2624 197
433 3300049743 Ga0501081_0000497 Ga0501081_0000497_6391_6999 197
434 3300049822 Ga0501035_0023262 Ga0501035_0023262_2322_2930 197
435 3300049824 Ga0501045_0000100 Ga0501045_0000100_34124_34732 197
436 3300050507 nmdc:mga05p37_132_c1 nmdc:mga05p37_132_c1_46222_46830 197
437 3300050508 nmdc:mga09592_350_c1 nmdc:mga09592_350_c1_11514_12122 197
438 3300050511 nmdc:mga08y16_2879_c1 nmdc:mga08y16_2879_c1_10123_10731 197
439 3300050511 nmdc:mga08y16_30512_c1 nmdc:mga08y16_30512_c1_2684_3292 197
440 3300050512 nmdc:mga0n895_10896_c1 nmdc:mga0n895_10896_c1_2799_3401 197
441 3300050512 nmdc:mga0n895_42998_c1 nmdc:mga0n895_42998_c1_2349_2948 197
442 3300050512 nmdc:mga0n895_468_c1 nmdc:mga0n895_468_c1_16462_17070 197
443 3300050513 nmdc:mga0rr50_139419_c1 nmdc:mga0rr50_139419_c1_283_885 197
444 3300050513 nmdc:mga0rr50_145_c1 nmdc:mga0rr50_145_c1_17283_17891 197
445 3300050513 nmdc:mga0rr50_2771_c1 nmdc:mga0rr50_2771_c1_6825_7424 197
446 3300050514 nmdc:mga08x19_28186_c1 nmdc:mga08x19_28186_c1_777_1376 197
447 3300050514 nmdc:mga08x19_522_c1 nmdc:mga08x19_522_c1_21076_21684 197
448 3300050515 nmdc:mga0a205_1077_c1 nmdc:mga0a205_1077_c1_7724_8332 197
449 3300050515 nmdc:mga0a205_137556_c1 nmdc:mga0a205_137556_c1_1363_1965 197
450 3300054114 Ga0501084_0005737 Ga0501084_0005737_3384_3992 197
451 3300054114 Ga0501084_0161052 Ga0501084_0161052_1157_1756 197
452 3300060353 Ga0501082_0004296 Ga0501082_0004296_10522_11130 197
453 3300061734 Ga0530510_0000579 Ga0530510_0000579_18537_19145 197
454 3300005336 Ga0070680_100265676 Ga0070680_1002656762 198
455 3300005341 Ga0070691_10159486 Ga0070691_101594862 198
456 3300005440 Ga0070705_100118981 Ga0070705_1001189812 198
457 3300005440 Ga0070705_100275158 Ga0070705_1002751582 198
458 3300005440 Ga0070705_100516292 Ga0070705_1005162922 198
459 3300005444 Ga0070694_100005384 Ga0070694_1000053842 198
460 3300005444 Ga0070694_100604401 Ga0070694_1006044011 198
461 3300005444 Ga0070694_100666748 Ga0070694_1006667481 198
462 3300005458 Ga0070681_10000257 Ga0070681_1000025732 198
463 3300005458 Ga0070681_10201540 Ga0070681_102015402 198
464 3300005471 Ga0070698_100448231 Ga0070698_1004482312 198
465 3300005536 Ga0070697_100001805 Ga0070697_1000018055 198
466 3300005544 Ga0070686_100154944 Ga0070686_1001549442 198
467 3300005545 Ga0070695_100158687 Ga0070695_1001586872 198
468 3300005546 Ga0070696_100005765 Ga0070696_1000057655 198
469 3300005546 Ga0070696_100130661 Ga0070696_1001306612 198
470 3300005546 Ga0070696_100168607 Ga0070696_1001686072 198
471 3300005546 Ga0070696_100518327 Ga0070696_1005183272 198
472 3300005549 Ga0070704_100009938 Ga0070704_1000099383 198
473 3300005618 Ga0068864_100166248 Ga0068864_1001662482 198
474 3300005843 Ga0068860_100506303 Ga0068860_1005063032 198
475 3300006358 Ga0068871_100232011 Ga0068871_1002320112 198
476 3300006914 Ga0075436_100000050 Ga0075436_10000005039 198
477 3300009094 Ga0111539_10085337 Ga0111539_100853373 198
478 3300009147 Ga0114129_10291815 Ga0114129_102918152 198
479 3300013105 Ga0157369_11102130 Ga0157369_111021302 198
480 3300025905 Ga0207685_10021986 Ga0207685_100219862 198
481 3300025910 Ga0207684_10449199 Ga0207684_104491992 198
482 3300025912 Ga0207707_10005329 Ga0207707_100053294 198
483 3300025912 Ga0207707_10107082 Ga0207707_101070822 198
484 3300025916 Ga0207663_10184505 Ga0207663_101845052 198
485 3300025917 Ga0207660_10173846 Ga0207660_101738462 198
486 3300025922 Ga0207646_10291430 Ga0207646_102914302 198
487 3300025941 Ga0207711_10688435 Ga0207711_106884352 198
488 3300026095 Ga0207676_10097305 Ga0207676_100973052 198
489 3300027671 Ga0209588_1007008 Ga0209588_10070082 198
490 3300027671 Ga0209588_1016176 Ga0209588_10161762 198
491 3300027907 Ga0207428_10494055 Ga0207428_104940551 198
492 3300031548 Ga0307408_100064063 Ga0307408_1000640632 198
493 3300035113 Ga0373936_0047227 Ga0373936_0047227_575_1201 198
494 3300035171 Ga0373946_0182161 Ga0373946_0182161_63_689 198
495 3300035692 Ga0373935_0015429 Ga0373935_0015429_381_1007 198
496 3300035695 Ga0373927_0043694 Ga0373927_0043694_1336_1962 198
497 3300035724 Ga0373933_0474167 Ga0373933_0474167_123_734 198
498 3300036401 Ga0373937_0006721 Ga0373937_0006721_8540_9160 198
499 3300036401 Ga0373937_0018224 Ga0373937_0018224_4918_5529 198
500 3300036401 Ga0373937_0272028 Ga0373937_0272028_246_857 198
501 3300036401 Ga0373937_0390844 Ga0373937_0390844_401_1045 198
502 3300037068 Ga0373925_0022805 Ga0373925_0022805_310_936 198
503 3300042001 Ga0439441_000300 Ga0439441_000300_465_1103 198
504 3300045051 Ga0451576_0043018 Ga0451576_0043018_370_990 198
505 3300045051 Ga0451576_0430506 Ga0451576_0430506_133_753 198
506 3300046454 Ga0495592_0019870 Ga0495592_0019870_3584_4204 198
507 3300046461 Ga0495641_0031513 Ga0495641_0031513_243_863 198
508 3300046462 Ga0495651_0260565 Ga0495651_0260565_393_1013 198
509 3300046475 Ga0495639_0069489 Ga0495639_0069489_601_1221 198
510 3300046476 Ga0495662_0013077 Ga0495662_0013077_3076_3696 198
511 3300046511 Ga0495608_0000913 Ga0495608_0000913_4877_5497 198
512 3300046516 Ga0495628_0004622 Ga0495628_0004622_7832_8452 198
513 3300046516 Ga0495628_0547790 Ga0495628_0547790_155_775 198
514 3300046517 Ga0495630_0035426 Ga0495630_0035426_1131_1751 198
515 3300046517 Ga0495630_0269682 Ga0495630_0269682_78_698 198
516 3300046526 Ga0495666_0177718 Ga0495666_0177718_50_670 198
517 3300046529 Ga0495652_0081831 Ga0495652_0081831_1797_2417 198
518 3300046533 Ga0495640_0001515 Ga0495640_0001515_2279_2899 198
519 3300046535 Ga0495586_0001426 Ga0495586_0001426_1957_2577 198
520 3300046535 Ga0495586_0215998 Ga0495586_0215998_301_921 198
521 3300046543 Ga0495645_0092243 Ga0495645_0092243_601_1221 198
522 3300046559 Ga0495667_0005087 Ga0495667_0005087_1715_2335 198
523 3300046615 Ga0495656_0005519 Ga0495656_0005519_2977_3588 198
524 3300046642 Ga0495634_0036458 Ga0495634_0036458_903_1523 198
525 3300046642 Ga0495634_0420173 Ga0495634_0420173_118_738 198
526 3300046663 Ga0495635_0235012 Ga0495635_0235012_407_1027 198
527 3300046675 Ga0495657_0310915 Ga0495657_0310915_36_647 198
528 3300046683 Ga0495658_0041954 Ga0495658_0041954_1125_1745 198
529 3300046689 Ga0495613_0021648 Ga0495613_0021648_353_973 198
530 3300046690 Ga0495624_0042710 Ga0495624_0042710_2157_2777 198
531 3300046690 Ga0495624_0119077 Ga0495624_0119077_16_636 198
532 3300046809 Ga0495600_0020498 Ga0495600_0020498_2418_3038 198
533 3300047315 Ga0495581_0226858 Ga0495581_0226858_96_716 198
534 3300047318 Ga0495636_0012131 Ga0495636_0012131_2032_2652 198
535 3300047322 Ga0495680_0001187 Ga0495680_0001187_6213_6833 198
536 3300047673 Ga0495593_0043827 Ga0495593_0043827_600_1220 198
537 3300049575 Ga0501039_0243923 Ga0501039_0243923_330_941 198
538 3300049580 Ga0501046_0133856 Ga0501046_0133856_408_1019 198
539 3300049582 Ga0501048_0194391 Ga0501048_0194391_481_1095 198
540 3300049588 Ga0501072_0039983 Ga0501072_0039983_2649_3263 198
541 3300049591 Ga0501075_0221771 Ga0501075_0221771_210_824 198
542 3300049592 Ga0501076_0415795 Ga0501076_0415795_148_762 198
543 3300050507 nmdc:mga05p37_246548_c1 nmdc:mga05p37_246548_c1_716_1336 198
544 3300050509 nmdc:mga0qj67_143171_c1 nmdc:mga0qj67_143171_c1_1119_1730 198
545 3300050511 nmdc:mga08y16_73615_c1 nmdc:mga08y16_73615_c1_2197_2817 198
546 3300050514 nmdc:mga08x19_55_c1 nmdc:mga08x19_55_c1_43592_44194 198
547 3300053077 Ga0495601_0104567 Ga0495601_0104567_1008_1628 198
548 3300053085 Ga0495619_0154357 Ga0495619_0154357_727_1347 198
549 3300006852 Ga0075433_10027271 Ga0075433_100272712 200
550 3300007076 Ga0075435_100002126 Ga0075435_1000021265 200
551 3300050507 nmdc:mga05p37_478462_c1 nmdc:mga05p37_478462_c1_162_770 200
552 3300050514 nmdc:mga08x19_20102_c2 nmdc:mga08x19_20102_c2_2518_3126 200
553 3300050514 nmdc:mga08x19_305277_c1 nmdc:mga08x19_305277_c1_452_1060 200
554 3300003203 JGI25406J46586_10045579 JGI25406J46586_100455792 201
555 3300005985 Ga0081539_10002484 Ga0081539_100024845 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14334

DUF4390

Domain of unknown function (DUF4390)

21

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hs5-assembly2.cif.gz_B frataxin from psychromonas ingrahamii as a model to study stability modulation within cyay protein family 0.6063 72 114
6hej-assembly1.cif.gz_A structure of human usp28 0.5894 61 118
6ah0-assembly1.cif.gz_W the cryo-em structure of the precusor of human pre-catalytic spliceosome (pre-b complex) 0.5877 64 113
4nn5-assembly1.cif.gz_C cytokine receptor complex - crystal form 1a 0.5798 27 181
1px3-assembly1.cif.gz_A e. coli (lacz) beta-galactosidase (g794a) 0.5679 25 181
ID Description Score Start End Superfamily
af_A0A2R8QR54_13_160_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.8526 90 113 1.20.58.1120
af_A0A0P0Y493_607_911_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7214 63 123 3.90.70.10
af_Q9SNC3_28_180_2.30.180.10 Mainly Beta;Roll;FAS1 domain;FAS1 domain 0.6971 89 115 2.30.180.10
af_Q09732_2_101_2.60.40.4370 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6965 88 111 2.60.40.4370
af_Q6NZZ8_274_342_3.10.50.10 Alpha Beta;Roll;Chitinase A; domain 3; 0.6351 90 119 3.10.50.10
ID Description Score Start End GO Terms
AF-A0A6L5JX42-F1-model_v4 DUF4390 domain-containing protein 0.9724 24 182
AF-A0A2A4VVR8-F1-model_v4 DUF4390 domain-containing protein 0.9656 24 179
AF-N6XXX0-F1-model_v4 Proline rich signal peptide protein 0.9623 19 182
AF-A0A431L075-F1-model_v4 DUF4390 domain-containing protein 0.9613 22 181
AF-A0A377RKR6-F1-model_v4 DUF4390 domain-containing protein 0.9606 25 183

Feature Viewer

pLDDT pTM Quality
85.54 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map