F463021

General Info

Members Datasets Scaffolds Average Seq Length
554 256 1108 86

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0767687|Ga0466963_0767687_288_581
Length 97
Sequence MNVLQIIGLVAVVLGGTAVVFTPEALRQTMVLGIYGIALTFLFFVFQAPDVALSEIVVTGLGLPLIVLAALRKIRQQDDRRESGSKAKGEGDRGGDG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 7.76
Rhizosphere 83.21
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0767687 3300044694 Bacteria 680
2 Ga0070658_10763038 3300005327 Bacteria 840
3 Ga0070683_100024404 3300005329 Bacteria 5416
4 Ga0070683_100288971 3300005329 Bacteria 1559
5 Ga0070683_100687422 3300005329 Bacteria 980
6 Ga0070683_101034210 3300005329 Bacteria 789
7 Ga0070683_101470279 3300005329 Unclassified 655
8 Ga0070683_102430454 3300005329 Bacteria 502
9 Ga0070690_100324205 3300005330 Bacteria 1111
10 Ga0068869_100124346 3300005334 Bacteria 1977
11 Ga0068869_101703146 3300005334 Bacteria 563
12 Ga0070680_100000377 3300005336 Bacteria 30109
13 Ga0070680_100868059 3300005336 Bacteria 778
14 Ga0070680_101099194 3300005336 Bacteria 687
15 Ga0070682_100359804 3300005337 Bacteria 1088
16 Ga0070682_100537002 3300005337 Bacteria 913
17 Ga0070682_101401422 3300005337 Bacteria 598
18 Ga0070682_101710992 3300005337 Bacteria 547
19 Ga0068868_100101771 3300005338 Bacteria 2325
20 Ga0068868_100339618 3300005338 Bacteria 1284
21 Ga0070660_100010370 3300005339 Bacteria 6585
22 Ga0070660_100084495 3300005339 Bacteria 2495
23 Ga0070660_100321810 3300005339 Bacteria 1271
24 Ga0070689_100139550 3300005340 Bacteria 1949
25 Ga0070691_10048999 3300005341 Bacteria 2011
26 Ga0070691_10423371 3300005341 Bacteria 755
27 Ga0070687_100044000 3300005343 Bacteria 2273
28 Ga0070661_100021851 3300005344 Bacteria 4576
29 Ga0070692_10126077 3300005345 Bacteria 1434
30 Ga0070692_11372210 3300005345 Bacteria 509
31 Ga0070668_100262460 3300005347 Bacteria 1437
32 Ga0070669_100533480 3300005353 Bacteria 977
33 Ga0070675_101459694 3300005354 Bacteria 631
34 Ga0070674_100426159 3300005356 Bacteria 1090
35 Ga0070659_100025839 3300005366 Bacteria 4516
36 Ga0070659_100880911 3300005366 Unclassified 782
37 Ga0070659_101600901 3300005366 Bacteria 581
38 Ga0070659_101773340 3300005366 Bacteria 553
39 Ga0070667_100599679 3300005367 Bacteria 1015
40 Ga0070703_10194364 3300005406 Bacteria 792
41 Ga0070714_100138658 3300005435 Bacteria 2181
42 Ga0070713_100071206 3300005436 Bacteria 2937
43 Ga0070713_102101469 3300005436 Bacteria 547
44 Ga0070710_10004675 3300005437 Bacteria 6472
45 Ga0070701_11002945 3300005438 Bacteria 582
46 Ga0070711_100010547 3300005439 Bacteria 5721
47 Ga0070711_100071804 3300005439 Bacteria 2441
48 Ga0070705_100078653 3300005440 Bacteria 2018
49 Ga0070700_100028300 3300005441 Bacteria 3331
50 Ga0070700_100872193 3300005441 Bacteria 731
51 Ga0070663_100196372 3300005455 Bacteria 1573
52 Ga0070663_101890931 3300005455 Bacteria 536
53 Ga0070681_10007641 3300005458 Bacteria 10573
54 Ga0068867_100339256 3300005459 Bacteria 1251
55 Ga0070685_10087721 3300005466 Bacteria 1878
56 Ga0070679_100001463 3300005530 Bacteria 20928
57 Ga0070679_101016898 3300005530 Bacteria 773
58 Ga0070684_100006789 3300005535 Bacteria 8876
59 Ga0070684_100165425 3300005535 Bacteria 2007
60 Ga0070684_101096469 3300005535 Bacteria 748
61 Ga0070684_101187224 3300005535 Bacteria 718
62 Ga0068853_100197124 3300005539 Bacteria 1832
63 Ga0068853_100237966 3300005539 Bacteria 1668
64 Ga0070686_100110645 3300005544 Bacteria 1871
65 Ga0070693_100072176 3300005547 Bacteria 2036
66 Ga0070693_100423489 3300005547 Bacteria 928
67 Ga0070693_100684971 3300005547 Bacteria 749
68 Ga0068855_100249735 3300005563 Bacteria 1979
69 Ga0070664_100128553 3300005564 Bacteria 2224
70 Ga0070664_100182115 3300005564 Bacteria 1867
71 Ga0068857_100414959 3300005577 Bacteria 1254
72 Ga0068857_100604842 3300005577 Bacteria 1036
73 Ga0068854_100092402 3300005578 Bacteria 2254
74 Ga0068854_100137348 3300005578 Bacteria 1873
75 Ga0068854_102140307 3300005578 Bacteria 517
76 Ga0068856_100055897 3300005614 Bacteria 3895
77 Ga0068856_100078972 3300005614 Bacteria 3263
78 Ga0068856_100274862 3300005614 Bacteria 1701
79 Ga0068856_101073794 3300005614 Bacteria 823
80 Ga0070702_100034025 3300005615 Bacteria 2806
81 Ga0070702_100288710 3300005615 Bacteria 1129
82 Ga0068852_100025467 3300005616 Bacteria 4794
83 Ga0068852_101064472 3300005616 Bacteria 828
84 Ga0068859_100150312 3300005617 Bacteria 2404
85 Ga0068859_100478932 3300005617 Bacteria 1340
86 Ga0068859_101612477 3300005617 Bacteria 717
87 Ga0068859_101759768 3300005617 Bacteria 684
88 Ga0068864_100540960 3300005618 Bacteria 1125
89 Ga0068864_100683321 3300005618 Bacteria 1001
90 Ga0068866_10270352 3300005718 Bacteria 1049
91 Ga0068861_100115671 3300005719 Bacteria 2155
92 Ga0068861_100971012 3300005719 Bacteria 809
93 Ga0068861_101320502 3300005719 Bacteria 702
94 Ga0068851_10138523 3300005834 Bacteria 1322
95 Ga0068870_10908076 3300005840 Bacteria 623
96 Ga0068870_11077149 3300005840 Bacteria 577
97 Ga0068858_100563250 3300005842 Bacteria 1103
98 Ga0068862_100067889 3300005844 Bacteria 3075
99 Ga0070717_10120327 3300006028 Bacteria 2249
100 Ga0070717_10177834 3300006028 Bacteria 1853
101 Ga0070717_10332877 3300006028 Bacteria 1355
102 Ga0070717_10850934 3300006028 Bacteria 830
103 Ga0070715_10550037 3300006163 Bacteria 669
104 Ga0070716_100026941 3300006173 Bacteria 3082
105 Ga0070712_100001049 3300006175 Bacteria 16689
106 Ga0070712_100522651 3300006175 Bacteria 997
107 Ga0070712_100788414 3300006175 Bacteria 815
108 Ga0075367_10498802 3300006178 Bacteria 772
109 Ga0075433_10743893 3300006852 Unclassified 858
110 Ga0075434_101092951 3300006871 Bacteria 811
111 Ga0068865_100095544 3300006881 Bacteria 2166
112 Ga0097620_100150301 3300006931 Bacteria 2404
113 Ga0097620_100478969 3300006931 Bacteria 1340
114 Ga0097620_101612359 3300006931 Bacteria 717
115 Ga0097620_101759860 3300006931 Bacteria 684
116 Ga0105240_10038847 3300009093 Bacteria 6102
117 Ga0105240_10054485 3300009093 Bacteria 5012
118 Ga0111539_10144327 3300009094 Bacteria 2786
119 Ga0105245_10159924 3300009098 Bacteria 2136
120 Ga0105245_10359215 3300009098 Bacteria 1445
121 Ga0105245_10932158 3300009098 Bacteria 911
122 Ga0105247_10098604 3300009101 Bacteria 1865
123 Ga0105243_10129483 3300009148 Bacteria 2139
124 Ga0105243_10356277 3300009148 Bacteria 1345
125 Ga0105243_11043294 3300009148 Bacteria 823
126 Ga0105243_11551821 3300009148 Bacteria 687
127 Ga0105243_12018122 3300009148 Bacteria 611
128 Ga0105241_10122996 3300009174 Bacteria 2092
129 Ga0105242_10611131 3300009176 Bacteria 1054
130 Ga0105237_10085960 3300009545 Bacteria 3135
131 Ga0105237_11571720 3300009545 Bacteria 665
132 Ga0105238_10243228 3300009551 Bacteria 1777
133 Ga0105249_10101999 3300009553 Bacteria 2700
134 Ga0105239_10077235 3300010375 Bacteria 3664
135 Ga0105239_10448547 3300010375 Bacteria 1463
136 Ga0105239_10629189 3300010375 Bacteria 1225
137 Ga0105239_11318941 3300010375 Bacteria 833
138 Ga0105246_10145003 3300011119 Bacteria 1790
139 Ga0105246_10605315 3300011119 Bacteria 948
140 Ga0105246_11320657 3300011119 Bacteria 669
141 Ga0157371_10200022 3300013102 Bacteria 1432
142 Ga0157371_10761702 3300013102 Bacteria 728
143 Ga0157370_10007489 3300013104 Bacteria 11858
144 Ga0157369_10184269 3300013105 Bacteria 2196
145 Ga0157369_10450431 3300013105 Bacteria 1333
146 Ga0157369_11136461 3300013105 Bacteria 798
147 Ga0157374_11554625 3300013296 Unclassified 685
148 Ga0163162_10225461 3300013306 Bacteria 2004
149 Ga0157372_10443821 3300013307 Bacteria 1512
150 Ga0157372_10637564 3300013307 Bacteria 1241
151 Ga0157372_10791207 3300013307 Bacteria 1102
152 Ga0157375_12898145 3300013308 Bacteria 573
153 Ga0163163_10142018 3300014325 Bacteria 2444
154 Ga0163163_10226306 3300014325 Bacteria 1919
155 Ga0157380_11547861 3300014326 Unclassified 717
156 Ga0157377_10106573 3300014745 Bacteria 1679
157 Ga0157377_10329221 3300014745 Bacteria 1018
158 Ga0157379_10435236 3300014968 Bacteria 1209
159 Ga0157376_12774237 3300014969 Unclassified 530
160 Ga0163161_10308000 3300017792 Bacteria 1249
161 Ga0206356_11025128 3300020070 Unclassified 1420
162 Ga0206356_11429330 3300020070 Bacteria 2169
163 Ga0206354_10292968 3300020081 Bacteria 658
164 Ga0206354_10833195 3300020081 Bacteria 992
165 Ga0206353_10946974 3300020082 Bacteria 719
166 Ga0206353_10956369 3300020082 Unclassified 909
167 Ga0213873_10250283 3300021358 Bacteria 561
168 Ga0213874_10188304 3300021377 Bacteria 737
169 Ga0213874_10196133 3300021377 Bacteria 724
170 Ga0213876_10010032 3300021384 Bacteria 5090
171 Ga0213876_10057403 3300021384 Bacteria 2055
172 Ga0213876_10356830 3300021384 Bacteria 778
173 Ga0213876_10556043 3300021384 Bacteria 610
174 Ga0213875_10000131 3300021388 Bacteria 83001
175 Ga0213875_10007903 3300021388 Bacteria 5467
176 Ga0213875_10020237 3300021388 Bacteria 3193
177 Ga0213875_10021989 3300021388 Bacteria 3053
178 Ga0213875_10062777 3300021388 Bacteria 1737
179 Ga0213875_10075021 3300021388 Bacteria 1578
180 Ga0213875_10141333 3300021388 Bacteria 1126
181 Ga0224712_10007891 3300022467 Bacteria 3121
182 Ga0207656_10037337 3300025321 Bacteria 2043
183 Ga0207713_1123132 3300025735 Bacteria 867
184 Ga0207692_10004635 3300025898 Bacteria 5449
185 Ga0207692_10005638 3300025898 Bacteria 5027
186 Ga0207710_10116585 3300025900 Bacteria 1272
187 Ga0207688_10015866 3300025901 Bacteria 4086
188 Ga0207647_10437511 3300025904 Bacteria 734
189 Ga0207685_10409684 3300025905 Bacteria 697
190 Ga0207645_11225511 3300025907 Bacteria 503
191 Ga0207643_10259969 3300025908 Bacteria 1072
192 Ga0207643_10948383 3300025908 Bacteria 557
193 Ga0207654_10458771 3300025911 Bacteria 894
194 Ga0207707_10024986 3300025912 Bacteria 5227
195 Ga0207695_10077200 3300025913 Bacteria 3384
196 Ga0207695_10979677 3300025913 Bacteria 725
197 Ga0207693_10001491 3300025915 Bacteria 20645
198 Ga0207693_10012751 3300025915 Bacteria 6785
199 Ga0207693_10440774 3300025915 Bacteria 1018
200 Ga0207663_10097702 3300025916 Bacteria 1965
201 Ga0207663_10556150 3300025916 Bacteria 897
202 Ga0207660_10022124 3300025917 Bacteria 4282
203 Ga0207660_10433258 3300025917 Bacteria 1062
204 Ga0207662_10070229 3300025918 Bacteria 2118
205 Ga0207657_10027543 3300025919 Bacteria 5203
206 Ga0207657_10041936 3300025919 Bacteria 4042
207 Ga0207649_10013307 3300025920 Bacteria 4590
208 Ga0207652_10024941 3300025921 Bacteria 4965
209 Ga0207681_10325996 3300025923 Bacteria 1223
210 Ga0207694_10098186 3300025924 Bacteria 2318
211 Ga0207659_10036084 3300025926 Bacteria 3422
212 Ga0207687_10469893 3300025927 Bacteria 1046
213 Ga0207687_10977635 3300025927 Unclassified 726
214 Ga0207687_11042471 3300025927 Bacteria 702
215 Ga0207700_10094099 3300025928 Bacteria 2373
216 Ga0207700_10415284 3300025928 Bacteria 1181
217 Ga0207700_11890251 3300025928 Bacteria 523
218 Ga0207664_10048782 3300025929 Bacteria 3331
219 Ga0207664_10108483 3300025929 Bacteria 2305
220 Ga0207664_10774067 3300025929 Unclassified 863
221 Ga0207644_10042440 3300025931 Bacteria 3224
222 Ga0207644_10854937 3300025931 Bacteria 762
223 Ga0207690_10028749 3300025932 Bacteria 3526
224 Ga0207690_10335980 3300025932 Bacteria 1191
225 Ga0207690_10365560 3300025932 Bacteria 1143
226 Ga0207706_10158304 3300025933 Bacteria 1991
227 Ga0207686_10129101 3300025934 Bacteria 1731
228 Ga0207686_10993935 3300025934 Bacteria 681
229 Ga0207709_10452400 3300025935 Bacteria 993
230 Ga0207670_10441039 3300025936 Bacteria 1048
231 Ga0207669_10062709 3300025937 Bacteria 2291
232 Ga0207704_10198876 3300025938 Bacteria 1465
233 Ga0207665_10033719 3300025939 Bacteria 3396
234 Ga0207665_11070262 3300025939 Unclassified 642
235 Ga0207691_11431728 3300025940 Bacteria 567
236 Ga0207689_10051464 3300025942 Bacteria 3395
237 Ga0207661_10016335 3300025944 Bacteria 5475
238 Ga0207661_10503139 3300025944 Bacteria 1107
239 Ga0207661_10565919 3300025944 Bacteria 1042
240 Ga0207661_10691666 3300025944 Bacteria 938
241 Ga0207661_10881473 3300025944 Bacteria 824
242 Ga0207679_10045598 3300025945 Bacteria 3172
243 Ga0207679_10530833 3300025945 Unclassified 1054
244 Ga0207667_11555432 3300025949 Unclassified 631
245 Ga0207667_12027023 3300025949 Unclassified 535
246 Ga0207651_11094811 3300025960 Unclassified 714
247 Ga0207712_10370406 3300025961 Bacteria 1196
248 Ga0207668_11652941 3300025972 Bacteria 578
249 Ga0207640_10071910 3300025981 Bacteria 2331
250 Ga0207640_10453675 3300025981 Bacteria 1057
251 Ga0207658_10114837 3300025986 Bacteria 2136
252 Ga0207677_10163299 3300026023 Bacteria 1733
253 Ga0207677_10892928 3300026023 Bacteria 801
254 Ga0207677_10956332 3300026023 Bacteria 775
255 Ga0207677_12261393 3300026023 Bacteria 506
256 Ga0207703_10076075 3300026035 Bacteria 2784
257 Ga0207639_10809338 3300026041 Bacteria 873
258 Ga0207678_10030770 3300026067 Bacteria 4686
259 Ga0207678_11802622 3300026067 Bacteria 536
260 Ga0207708_10028240 3300026075 Bacteria 4248
261 Ga0207708_10624960 3300026075 Bacteria 914
262 Ga0207702_10057967 3300026078 Bacteria 3294
263 Ga0207702_10069970 3300026078 Bacteria 3017
264 Ga0207702_10121545 3300026078 Bacteria 2338
265 Ga0207702_10208016 3300026078 Bacteria 1818
266 Ga0207702_10469507 3300026078 Bacteria 1223
267 Ga0207648_10124750 3300026089 Bacteria 2265
268 Ga0207676_10067927 3300026095 Bacteria 2849
269 Ga0207674_10475500 3300026116 Bacteria 1208
270 Ga0207675_100181279 3300026118 Bacteria 2017
271 Ga0207675_100187628 3300026118 Bacteria 1982
272 Ga0207675_100631326 3300026118 Bacteria 1076
273 Ga0207683_10166468 3300026121 Bacteria 1995
274 Ga0207428_10898812 3300027907 Bacteria 626
275 Ga0268266_10327699 3300028379 Bacteria 1435
276 Ga0268265_10175744 3300028380 Bacteria 1835
277 Ga0268265_10492631 3300028380 Unclassified 1153
278 Ga0307413_11491177 3300031824 Bacteria 598
279 Ga0307409_101697035 3300031995 Bacteria 660
280 Ga0307416_100842068 3300032002 Bacteria 1015
281 Ga0307414_11581097 3300032004 Bacteria 611
282 Ga0307411_11586834 3300032005 Bacteria 603
283 Ga0373953_0513478 3300035117 Archaea 531
284 Ga0373961_0279801 3300035241 Unclassified 612
285 Ga0373924_0310306 3300035410 Unclassified 701
286 Ga0373931_1035521 3300035691 Bacteria 557
287 Ga0373947_0751182 3300035725 Unclassified 666
288 Ga0373937_0243508 3300036401 Unclassified 1694
289 Ga0395900_0090069 3300037418 Bacteria 3153
290 Ga0395898_0068222 3300037466 Bacteria 3441
291 Ga0436364_0202973 3300037853 Bacteria 18671
292 Ga0436364_0207633 3300037853 Bacteria 3002
293 Ga0436364_0344208 3300037853 Bacteria 2965
294 Ga0436364_0354286 3300037853 Bacteria 2422
295 Ga0436364_0598509 3300037853 Bacteria 4358
296 Ga0436364_0674823 3300037853 Bacteria 1124
297 Ga0436364_0746030 3300037853 Bacteria 86955
298 Ga0436364_0758998 3300037853 Bacteria 29208
299 Ga0436364_0934832 3300037853 Bacteria 2948
300 Ga0436364_0964327 3300037853 Bacteria 1843
301 Ga0436364_1084332 3300037853 Bacteria 12843
302 Ga0436364_1170690 3300037853 Unclassified 1716
303 Ga0436364_1292357 3300037853 Bacteria 644
304 Ga0395901_0329781 3300038443 Bacteria 1578
305 Ga0395901_1291052 3300038443 Bacteria 692
306 Ga0436365_0074905 3300039437 Bacteria 1898
307 Ga0436365_0136387 3300039437 Bacteria 5285
308 Ga0436365_0227488 3300039437 Bacteria 6740
309 Ga0436365_0435734 3300039437 Bacteria 2035
310 Ga0436365_1068362 3300039437 Bacteria 1832
311 Ga0436365_1085223 3300039437 Bacteria 3240
312 Ga0436365_1107926 3300039437 Unclassified 739
313 Ga0436365_1386106 3300039437 Bacteria 701
314 Ga0436365_1429493 3300039437 Bacteria 6046
315 Ga0436360_0505369 3300039438 Bacteria 1316
316 Ga0436360_0923038 3300039438 Bacteria 592
317 Ga0436360_0935517 3300039438 Bacteria 594
318 Ga0436363_0080677 3300039450 Unclassified 1129
319 Ga0436363_0096649 3300039450 Bacteria 756
320 Ga0436363_0133312 3300039450 Bacteria 1480
321 Ga0436363_0194097 3300039450 Unclassified 668
322 Ga0436363_0207162 3300039450 Bacteria 866
323 Ga0436363_0329294 3300039450 Archaea 513
324 Ga0436363_0349849 3300039450 Bacteria 8979
325 Ga0436363_0579610 3300039450 Bacteria 1800
326 Ga0436363_0875822 3300039450 Bacteria 1022
327 Ga0436363_0898429 3300039450 Bacteria 2148
328 Ga0436363_1041829 3300039450 Bacteria 2863
329 Ga0436363_1248452 3300039450 Bacteria 1320
330 Ga0436363_1444466 3300039450 Bacteria 1548
331 Ga0436362_0129652 3300039453 Bacteria 955
332 Ga0436362_0216629 3300039453 Unclassified 1492
333 Ga0436362_0340001 3300039453 Bacteria 1927
334 Ga0436362_0352632 3300039453 Unclassified 1654
335 Ga0436362_0701385 3300039453 Bacteria 5698
336 Ga0436362_0872203 3300039453 Bacteria 1151
337 Ga0436362_1046245 3300039453 Bacteria 3163
338 Ga0466969_0015397 3300044656 Bacteria 4009
339 Ga0466969_0051100 3300044656 Bacteria 2036
340 Ga0466969_0206762 3300044656 Bacteria 895
341 Ga0466969_0552456 3300044656 Bacteria 527
342 Ga0466965_0290234 3300044683 Unclassified 885
343 Ga0466965_0382389 3300044683 Bacteria 775
344 Ga0466965_0485551 3300044683 Bacteria 691
345 Ga0466966_0077759 3300044684 Unclassified 2070
346 Ga0466966_0096207 3300044684 Bacteria 1834
347 Ga0466966_0392843 3300044684 Bacteria 833
348 Ga0466966_0733088 3300044684 Bacteria 596
349 Ga0466961_0001948 3300044693 Bacteria 12866
350 Ga0466961_0004692 3300044693 Bacteria 8590
351 Ga0466961_0005025 3300044693 Bacteria 8317
352 Ga0466961_0493144 3300044693 Unclassified 740
353 Ga0466961_0943936 3300044693 Bacteria 513
354 Ga0466963_0000011 3300044694 Bacteria 65918
355 Ga0466963_0008429 3300044694 Bacteria 6176
356 Ga0466963_0039157 3300044694 Unclassified 3103
357 Ga0466963_0062239 3300044694 Bacteria 2496
358 Ga0466963_0086017 3300044694 Bacteria 2135
359 Ga0466963_0476458 3300044694 Bacteria 881
360 Ga0466963_0638545 3300044694 Bacteria 751
361 Ga0466963_0784685 3300044694 Unclassified 672
362 Ga0466964_0456781 3300044706 Unclassified 678
363 Ga0466964_0602533 3300044706 Bacteria 603
364 Ga0466971_0013411 3300044719 Bacteria 3600
365 Ga0466971_0161736 3300044719 Bacteria 1048
366 Ga0466968_0005881 3300044735 Unclassified 4605
367 Ga0466968_0020501 3300044735 Bacteria 2669
368 Ga0466968_0036775 3300044735 Bacteria 2052
369 Ga0466968_0056315 3300044735 Bacteria 1689
370 Ga0466968_0250023 3300044735 Bacteria 842
371 Ga0466970_0163993 3300044765 Bacteria 1230
372 Ga0466970_0272284 3300044765 Bacteria 951
373 Ga0466970_0307837 3300044765 Bacteria 894
374 Ga0466970_0351768 3300044765 Bacteria 836
375 Ga0466970_0366272 3300044765 Bacteria 819
376 Ga0466957_0006318 3300044842 Bacteria 6683
377 Ga0466957_0032422 3300044842 Bacteria 3128
378 Ga0466957_0045525 3300044842 Bacteria 2661
379 Ga0466957_0111365 3300044842 Bacteria 1736
380 Ga0466957_0118158 3300044842 Unclassified 1688
381 Ga0466957_0281201 3300044842 Bacteria 1114
382 Ga0466957_0321785 3300044842 Bacteria 1044
383 Ga0466957_0339518 3300044842 Bacteria 1017
384 Ga0466960_0127947 3300044901 Bacteria 1337
385 Ga0466960_0242450 3300044901 Bacteria 998
386 Ga0466960_0422376 3300044901 Bacteria 771
387 Ga0466960_0486948 3300044901 Bacteria 721
388 Ga0466960_0705695 3300044901 Bacteria 605
389 Ga0466960_0995127 3300044901 Bacteria 515
390 Ga0466959_0002058 3300045049 Bacteria 12722
391 Ga0466959_0012804 3300045049 Bacteria 6068
392 Ga0466959_0035887 3300045049 Bacteria 3663
393 Ga0466959_0108460 3300045049 Bacteria 1983
394 Ga0466959_0108885 3300045049 Bacteria 1979
395 Ga0466959_0127317 3300045049 Bacteria 1807
396 Ga0466959_0132659 3300045049 Bacteria 1765
397 Ga0466959_0210838 3300045049 Bacteria 1350
398 Ga0466959_0365155 3300045049 Bacteria 983
399 Ga0466959_0388052 3300045049 Bacteria 950
400 Ga0466959_0782140 3300045049 Bacteria 638
401 Ga0466959_0818846 3300045049 Bacteria 622
402 Ga0466959_1061594 3300045049 Bacteria 539
403 Ga0466958_0000348 3300045836 Bacteria 18581
404 Ga0466958_0000658 3300045836 Bacteria 14922
405 Ga0466958_0013101 3300045836 Bacteria 4713
406 Ga0466958_0026952 3300045836 Bacteria 3398
407 Ga0466958_0027409 3300045836 Bacteria 3372
408 Ga0466958_0040288 3300045836 Bacteria 2808
409 Ga0466958_0041197 3300045836 Bacteria 2778
410 Ga0466958_0058857 3300045836 Bacteria 2337
411 Ga0466958_0066428 3300045836 Bacteria 2202
412 Ga0466958_0184629 3300045836 Bacteria 1324
413 Ga0466958_0217666 3300045836 Bacteria 1218
414 Ga0466958_0244985 3300045836 Unclassified 1146
415 Ga0466958_0253974 3300045836 Bacteria 1125
416 Ga0466958_1021792 3300045836 Bacteria 539
417 Ga0466958_1174247 3300045836 Unclassified 501
418 Ga0466967_0023932 3300045976 Bacteria 5013
419 Ga0466967_0025085 3300045976 Bacteria 4911
420 Ga0466967_0036863 3300045976 Bacteria 4178
421 Ga0466967_0071131 3300045976 Bacteria 3114
422 Ga0466967_0083564 3300045976 Bacteria 2888
423 Ga0466967_0136927 3300045976 Bacteria 2278
424 Ga0466967_0297707 3300045976 Bacteria 1551
425 Ga0466967_0454807 3300045976 Unclassified 1252
426 Ga0466967_0512936 3300045976 Bacteria 1177
427 Ga0466967_0567109 3300045976 Unclassified 1118
428 Ga0466967_0577429 3300045976 Unclassified 1108
429 Ga0466967_0633668 3300045976 Bacteria 1056
430 Ga0466967_0870991 3300045976 Bacteria 895
431 Ga0466967_1053990 3300045976 Bacteria 810
432 Ga0466967_1064541 3300045976 Bacteria 806
433 Ga0466967_1971828 3300045976 Bacteria 580
434 Ga0495592_0067671 3300046454 Unclassified 2609
435 Ga0495629_0479421 3300046459 Archaea 840
436 Ga0495651_0021472 3300046462 Bacteria 5018
437 Ga0495664_0359367 3300046477 Unclassified 876
438 Ga0495608_0009066 3300046511 Bacteria 6958
439 Ga0495628_0207520 3300046516 Unclassified 1474
440 Ga0495630_1443231 3300046517 Unclassified 517
441 Ga0495652_0048691 3300046529 Bacteria 3630
442 Ga0495640_0133466 3300046533 Bacteria 1605
443 Ga0495667_0022017 3300046559 Bacteria 4297
444 Ga0495635_0033134 3300046663 Bacteria 3583
445 Ga0495623_0464418 3300046679 Archaea 672
446 Ga0495646_0168233 3300046680 Bacteria 1209
447 Ga0495658_0303602 3300046683 Bacteria 1010
448 Ga0495613_0115841 3300046689 Unclassified 1928
449 Ga0495671_0456215 3300046692 Bacteria 611
450 Ga0495600_0081260 3300046809 Bacteria 2115
451 Ga0495604_0034729 3300047317 Bacteria 3988
452 Ga0495674_0397144 3300047319 Unclassified 1113
453 Ga0495676_0692542 3300047321 Unclassified 660
454 Ga0495684_0163978 3300047471 Unclassified 1656
455 Ga0495593_0097753 3300047673 Unclassified 1508
456 Ga0495602_0052321 3300048088 Bacteria 3628
457 Ga0496100_0331980 3300048903 Bacteria 1145
458 Ga0496100_0775400 3300048903 Bacteria 751
459 Ga0496100_0941036 3300048903 Bacteria 679
460 Ga0496101_0271336 3300048904 Bacteria 1324
461 Ga0496101_0663329 3300048904 Bacteria 824
462 Ga0496101_1048525 3300048904 Bacteria 641
463 Ga0496102_0653787 3300048905 Bacteria 974
464 Ga0496102_1089993 3300048905 Bacteria 718
465 Ga0496102_1248568 3300048905 Bacteria 662
466 Ga0496104_0178368 3300048907 Bacteria 2034
467 Ga0496104_0292489 3300048907 Bacteria 1541
468 Ga0496105_0051922 3300048908 Bacteria 3385
469 Ga0496105_0360231 3300048908 Bacteria 1160
470 Ga0496105_1105276 3300048908 Bacteria 588
471 Ga0496106_0112045 3300048909 Bacteria 2125
472 Ga0496106_1107501 3300048909 Unclassified 620
473 Ga0496107_0111774 3300048910 Bacteria 2008
474 Ga0496107_0363638 3300048910 Bacteria 1077
475 Ga0496108_0264256 3300048911 Bacteria 1497
476 Ga0496108_0583992 3300048911 Bacteria 974
477 Ga0496108_0826729 3300048911 Bacteria 798
478 Ga0496109_0020926 3300048912 Bacteria 5782
479 Ga0496109_0538135 3300048912 Unclassified 1102
480 Ga0496109_0637445 3300048912 Bacteria 1002
481 Ga0496109_1501050 3300048912 Bacteria 609
482 Ga0496110_0045916 3300048913 Bacteria 3820
483 Ga0496110_0902811 3300048913 Bacteria 789
484 Ga0496110_0969438 3300048913 Bacteria 757
485 Ga0496110_1606701 3300048913 Bacteria 560
486 Ga0496111_0880981 3300048914 Unclassified 645
487 Ga0496112_0010051 3300048915 Bacteria 8567
488 Ga0496112_0120664 3300048915 Bacteria 2591
489 Ga0496112_0141510 3300048915 Bacteria 2375
490 Ga0496112_0225346 3300048915 Bacteria 1830
491 Ga0496112_0743136 3300048915 Bacteria 908
492 Ga0496113_0050913 3300048916 Bacteria 3089
493 Ga0496113_0254131 3300048916 Bacteria 1403
494 Ga0496113_0483565 3300048916 Bacteria 994
495 Ga0496113_1589309 3300048916 Bacteria 503
496 Ga0496114_0707616 3300048917 Bacteria 883
497 Ga0496115_0150736 3300048918 Bacteria 1920
498 Ga0496115_0475820 3300048918 Bacteria 1006
499 Ga0496115_0728880 3300048918 Bacteria 777
500 Ga0501031_0372140 3300049568 Bacteria 924
501 Ga0501032_0004941 3300049569 Bacteria 9970
502 Ga0501032_0046393 3300049569 Bacteria 2937
503 Ga0501033_0100452 3300049570 Bacteria 2111
504 Ga0501034_0125180 3300049571 Bacteria 2555
505 Ga0501034_0368629 3300049571 Bacteria 1362
506 Ga0501036_0003782 3300049572 Bacteria 12132
507 Ga0501036_0128318 3300049572 Bacteria 2141
508 Ga0501037_0099921 3300049573 Bacteria 2095
509 Ga0501037_0311356 3300049573 Bacteria 1091
510 Ga0501038_0030105 3300049574 Bacteria 4806
511 Ga0501038_0267319 3300049574 Bacteria 1349
512 Ga0501039_0130398 3300049575 Bacteria 1973
513 Ga0501042_0959646 3300049578 Bacteria 623
514 Ga0501043_0045172 3300049579 Bacteria 3464
515 Ga0501046_0051023 3300049580 Bacteria 3266
516 Ga0501046_0212574 3300049580 Bacteria 1435
517 Ga0501047_0005931 3300049581 Bacteria 11491
518 Ga0501047_0222049 3300049581 Bacteria 1745
519 Ga0501047_1070030 3300049581 Bacteria 620
520 Ga0501067_0237601 3300049583 Bacteria 1014
521 Ga0501067_0748344 3300049583 Bacteria 550
522 Ga0501068_0204722 3300049584 Bacteria 1252
523 Ga0501069_0581602 3300049585 Bacteria 671
524 Ga0501070_0002273 3300049586 Bacteria 16892
525 Ga0501070_0046945 3300049586 Bacteria 3592
526 Ga0501070_0203304 3300049586 Bacteria 1626
527 Ga0501072_0070608 3300049588 Bacteria 2759
528 Ga0501073_0002560 3300049589 Bacteria 13587
529 Ga0501073_0968552 3300049589 Bacteria 585
530 Ga0501074_0036660 3300049590 Bacteria 3552
531 Ga0501074_0734478 3300049590 Bacteria 696
532 Ga0501076_1214947 3300049592 Unclassified 620
533 Ga0501079_0946595 3300049741 Bacteria 678
534 Ga0501080_0048044 3300049742 Bacteria 3973
535 Ga0501083_0523994 3300049744 Bacteria 771
536 Ga0501035_0005413 3300049822 Bacteria 12068
537 Ga0501035_0340446 3300049822 Bacteria 1257
538 Ga0501044_0006374 3300049823 Bacteria 13045
539 Ga0501044_0172753 3300049823 Bacteria 2131
540 Ga0501045_0573705 3300049824 Bacteria 836
541 nmdc:mga03n38_782946_c1 3300050490 Bacteria 554
542 nmdc:mga08y16_335726_c1 3300050511 Bacteria 1554
543 Ga0495601_0580645 3300053077 Archaea 720
544 Ga0495612_0101583 3300053078 Unclassified 1225
545 Ga0495595_0065235 3300053084 Bacteria 1712
546 Ga0495619_0172109 3300053085 Unclassified 1497
547 Ga0501082_0095654 3300060353 Bacteria 2567
548 Ga0466962_0003722 3300061719 Bacteria 7277
549 Ga0466962_0053088 3300061719 Bacteria 1937
550 Ga0466962_0065618 3300061719 Unclassified 1733
551 Ga0466962_0075843 3300061719 Bacteria 1607
552 Ga0466962_0259436 3300061719 Bacteria 855
553 Ga0466962_0531822 3300061719 Bacteria 596
554 Ga0466962_0673421 3300061719 Bacteria 530
555 Ga0466963_0767687
556 Ga0070658_10763038
557 Ga0070683_100024404
558 Ga0070683_100288971
559 Ga0070683_100687422
560 Ga0070683_101034210
561 Ga0070683_101470279
562 Ga0070683_102430454
563 Ga0070690_100324205
564 Ga0068869_100124346
565 Ga0068869_101703146
566 Ga0070680_100000377
567 Ga0070680_100868059
568 Ga0070680_101099194
569 Ga0070682_100359804
570 Ga0070682_100537002
571 Ga0070682_101401422
572 Ga0070682_101710992
573 Ga0068868_100101771
574 Ga0068868_100339618
575 Ga0070660_100010370
576 Ga0070660_100084495
577 Ga0070660_100321810
578 Ga0070689_100139550
579 Ga0070691_10048999
580 Ga0070691_10423371
581 Ga0070687_100044000
582 Ga0070661_100021851
583 Ga0070692_10126077
584 Ga0070692_11372210
585 Ga0070668_100262460
586 Ga0070669_100533480
587 Ga0070675_101459694
588 Ga0070674_100426159
589 Ga0070659_100025839
590 Ga0070659_100880911
591 Ga0070659_101600901
592 Ga0070659_101773340
593 Ga0070667_100599679
594 Ga0070703_10194364
595 Ga0070714_100138658
596 Ga0070713_100071206
597 Ga0070713_102101469
598 Ga0070710_10004675
599 Ga0070701_11002945
600 Ga0070711_100010547
601 Ga0070711_100071804
602 Ga0070705_100078653
603 Ga0070700_100028300
604 Ga0070700_100872193
605 Ga0070663_100196372
606 Ga0070663_101890931
607 Ga0070681_10007641
608 Ga0068867_100339256
609 Ga0070685_10087721
610 Ga0070679_100001463
611 Ga0070679_101016898
612 Ga0070684_100006789
613 Ga0070684_100165425
614 Ga0070684_101096469
615 Ga0070684_101187224
616 Ga0068853_100197124
617 Ga0068853_100237966
618 Ga0070686_100110645
619 Ga0070693_100072176
620 Ga0070693_100423489
621 Ga0070693_100684971
622 Ga0068855_100249735
623 Ga0070664_100128553
624 Ga0070664_100182115
625 Ga0068857_100414959
626 Ga0068857_100604842
627 Ga0068854_100092402
628 Ga0068854_100137348
629 Ga0068854_102140307
630 Ga0068856_100055897
631 Ga0068856_100078972
632 Ga0068856_100274862
633 Ga0068856_101073794
634 Ga0070702_100034025
635 Ga0070702_100288710
636 Ga0068852_100025467
637 Ga0068852_101064472
638 Ga0068859_100150312
639 Ga0068859_100478932
640 Ga0068859_101612477
641 Ga0068859_101759768
642 Ga0068864_100540960
643 Ga0068864_100683321
644 Ga0068866_10270352
645 Ga0068861_100115671
646 Ga0068861_100971012
647 Ga0068861_101320502
648 Ga0068851_10138523
649 Ga0068870_10908076
650 Ga0068870_11077149
651 Ga0068858_100563250
652 Ga0068862_100067889
653 Ga0070717_10120327
654 Ga0070717_10177834
655 Ga0070717_10332877
656 Ga0070717_10850934
657 Ga0070715_10550037
658 Ga0070716_100026941
659 Ga0070712_100001049
660 Ga0070712_100522651
661 Ga0070712_100788414
662 Ga0075367_10498802
663 Ga0075433_10743893
664 Ga0075434_101092951
665 Ga0068865_100095544
666 Ga0097620_100150301
667 Ga0097620_100478969
668 Ga0097620_101612359
669 Ga0097620_101759860
670 Ga0105240_10038847
671 Ga0105240_10054485
672 Ga0111539_10144327
673 Ga0105245_10159924
674 Ga0105245_10359215
675 Ga0105245_10932158
676 Ga0105247_10098604
677 Ga0105243_10129483
678 Ga0105243_10356277
679 Ga0105243_11043294
680 Ga0105243_11551821
681 Ga0105243_12018122
682 Ga0105241_10122996
683 Ga0105242_10611131
684 Ga0105237_10085960
685 Ga0105237_11571720
686 Ga0105238_10243228
687 Ga0105249_10101999
688 Ga0105239_10077235
689 Ga0105239_10448547
690 Ga0105239_10629189
691 Ga0105239_11318941
692 Ga0105246_10145003
693 Ga0105246_10605315
694 Ga0105246_11320657
695 Ga0157371_10200022
696 Ga0157371_10761702
697 Ga0157370_10007489
698 Ga0157369_10184269
699 Ga0157369_10450431
700 Ga0157369_11136461
701 Ga0157374_11554625
702 Ga0163162_10225461
703 Ga0157372_10443821
704 Ga0157372_10637564
705 Ga0157372_10791207
706 Ga0157375_12898145
707 Ga0163163_10142018
708 Ga0163163_10226306
709 Ga0157380_11547861
710 Ga0157377_10106573
711 Ga0157377_10329221
712 Ga0157379_10435236
713 Ga0157376_12774237
714 Ga0163161_10308000
715 Ga0206356_11025128
716 Ga0206356_11429330
717 Ga0206354_10292968
718 Ga0206354_10833195
719 Ga0206353_10946974
720 Ga0206353_10956369
721 Ga0213873_10250283
722 Ga0213874_10188304
723 Ga0213874_10196133
724 Ga0213876_10010032
725 Ga0213876_10057403
726 Ga0213876_10356830
727 Ga0213876_10556043
728 Ga0213875_10000131
729 Ga0213875_10007903
730 Ga0213875_10020237
731 Ga0213875_10021989
732 Ga0213875_10062777
733 Ga0213875_10075021
734 Ga0213875_10141333
735 Ga0224712_10007891
736 Ga0207656_10037337
737 Ga0207713_1123132
738 Ga0207692_10004635
739 Ga0207692_10005638
740 Ga0207710_10116585
741 Ga0207688_10015866
742 Ga0207647_10437511
743 Ga0207685_10409684
744 Ga0207645_11225511
745 Ga0207643_10259969
746 Ga0207643_10948383
747 Ga0207654_10458771
748 Ga0207707_10024986
749 Ga0207695_10077200
750 Ga0207695_10979677
751 Ga0207693_10001491
752 Ga0207693_10012751
753 Ga0207693_10440774
754 Ga0207663_10097702
755 Ga0207663_10556150
756 Ga0207660_10022124
757 Ga0207660_10433258
758 Ga0207662_10070229
759 Ga0207657_10027543
760 Ga0207657_10041936
761 Ga0207649_10013307
762 Ga0207652_10024941
763 Ga0207681_10325996
764 Ga0207694_10098186
765 Ga0207659_10036084
766 Ga0207687_10469893
767 Ga0207687_10977635
768 Ga0207687_11042471
769 Ga0207700_10094099
770 Ga0207700_10415284
771 Ga0207700_11890251
772 Ga0207664_10048782
773 Ga0207664_10108483
774 Ga0207664_10774067
775 Ga0207644_10042440
776 Ga0207644_10854937
777 Ga0207690_10028749
778 Ga0207690_10335980
779 Ga0207690_10365560
780 Ga0207706_10158304
781 Ga0207686_10129101
782 Ga0207686_10993935
783 Ga0207709_10452400
784 Ga0207670_10441039
785 Ga0207669_10062709
786 Ga0207704_10198876
787 Ga0207665_10033719
788 Ga0207665_11070262
789 Ga0207691_11431728
790 Ga0207689_10051464
791 Ga0207661_10016335
792 Ga0207661_10503139
793 Ga0207661_10565919
794 Ga0207661_10691666
795 Ga0207661_10881473
796 Ga0207679_10045598
797 Ga0207679_10530833
798 Ga0207667_11555432
799 Ga0207667_12027023
800 Ga0207651_11094811
801 Ga0207712_10370406
802 Ga0207668_11652941
803 Ga0207640_10071910
804 Ga0207640_10453675
805 Ga0207658_10114837
806 Ga0207677_10163299
807 Ga0207677_10892928
808 Ga0207677_10956332
809 Ga0207677_12261393
810 Ga0207703_10076075
811 Ga0207639_10809338
812 Ga0207678_10030770
813 Ga0207678_11802622
814 Ga0207708_10028240
815 Ga0207708_10624960
816 Ga0207702_10057967
817 Ga0207702_10069970
818 Ga0207702_10121545
819 Ga0207702_10208016
820 Ga0207702_10469507
821 Ga0207648_10124750
822 Ga0207676_10067927
823 Ga0207674_10475500
824 Ga0207675_100181279
825 Ga0207675_100187628
826 Ga0207675_100631326
827 Ga0207683_10166468
828 Ga0207428_10898812
829 Ga0268266_10327699
830 Ga0268265_10175744
831 Ga0268265_10492631
832 Ga0307413_11491177
833 Ga0307409_101697035
834 Ga0307416_100842068
835 Ga0307414_11581097
836 Ga0307411_11586834
837 Ga0373953_0513478
838 Ga0373961_0279801
839 Ga0373924_0310306
840 Ga0373931_1035521
841 Ga0373947_0751182
842 Ga0373937_0243508
843 Ga0395900_0090069
844 Ga0395898_0068222
845 Ga0436364_0202973
846 Ga0436364_0207633
847 Ga0436364_0344208
848 Ga0436364_0354286
849 Ga0436364_0598509
850 Ga0436364_0674823
851 Ga0436364_0746030
852 Ga0436364_0758998
853 Ga0436364_0934832
854 Ga0436364_0964327
855 Ga0436364_1084332
856 Ga0436364_1170690
857 Ga0436364_1292357
858 Ga0395901_0329781
859 Ga0395901_1291052
860 Ga0436365_0074905
861 Ga0436365_0136387
862 Ga0436365_0227488
863 Ga0436365_0435734
864 Ga0436365_1068362
865 Ga0436365_1085223
866 Ga0436365_1107926
867 Ga0436365_1386106
868 Ga0436365_1429493
869 Ga0436360_0505369
870 Ga0436360_0923038
871 Ga0436360_0935517
872 Ga0436363_0080677
873 Ga0436363_0096649
874 Ga0436363_0133312
875 Ga0436363_0194097
876 Ga0436363_0207162
877 Ga0436363_0329294
878 Ga0436363_0349849
879 Ga0436363_0579610
880 Ga0436363_0875822
881 Ga0436363_0898429
882 Ga0436363_1041829
883 Ga0436363_1248452
884 Ga0436363_1444466
885 Ga0436362_0129652
886 Ga0436362_0216629
887 Ga0436362_0340001
888 Ga0436362_0352632
889 Ga0436362_0701385
890 Ga0436362_0872203
891 Ga0436362_1046245
892 Ga0466969_0015397
893 Ga0466969_0051100
894 Ga0466969_0206762
895 Ga0466969_0552456
896 Ga0466965_0290234
897 Ga0466965_0382389
898 Ga0466965_0485551
899 Ga0466966_0077759
900 Ga0466966_0096207
901 Ga0466966_0392843
902 Ga0466966_0733088
903 Ga0466961_0001948
904 Ga0466961_0004692
905 Ga0466961_0005025
906 Ga0466961_0493144
907 Ga0466961_0943936
908 Ga0466963_0000011
909 Ga0466963_0008429
910 Ga0466963_0039157
911 Ga0466963_0062239
912 Ga0466963_0086017
913 Ga0466963_0476458
914 Ga0466963_0638545
915 Ga0466963_0784685
916 Ga0466964_0456781
917 Ga0466964_0602533
918 Ga0466971_0013411
919 Ga0466971_0161736
920 Ga0466968_0005881
921 Ga0466968_0020501
922 Ga0466968_0036775
923 Ga0466968_0056315
924 Ga0466968_0250023
925 Ga0466970_0163993
926 Ga0466970_0272284
927 Ga0466970_0307837
928 Ga0466970_0351768
929 Ga0466970_0366272
930 Ga0466957_0006318
931 Ga0466957_0032422
932 Ga0466957_0045525
933 Ga0466957_0111365
934 Ga0466957_0118158
935 Ga0466957_0281201
936 Ga0466957_0321785
937 Ga0466957_0339518
938 Ga0466960_0127947
939 Ga0466960_0242450
940 Ga0466960_0422376
941 Ga0466960_0486948
942 Ga0466960_0705695
943 Ga0466960_0995127
944 Ga0466959_0002058
945 Ga0466959_0012804
946 Ga0466959_0035887
947 Ga0466959_0108460
948 Ga0466959_0108885
949 Ga0466959_0127317
950 Ga0466959_0132659
951 Ga0466959_0210838
952 Ga0466959_0365155
953 Ga0466959_0388052
954 Ga0466959_0782140
955 Ga0466959_0818846
956 Ga0466959_1061594
957 Ga0466958_0000348
958 Ga0466958_0000658
959 Ga0466958_0013101
960 Ga0466958_0026952
961 Ga0466958_0027409
962 Ga0466958_0040288
963 Ga0466958_0041197
964 Ga0466958_0058857
965 Ga0466958_0066428
966 Ga0466958_0184629
967 Ga0466958_0217666
968 Ga0466958_0244985
969 Ga0466958_0253974
970 Ga0466958_1021792
971 Ga0466958_1174247
972 Ga0466967_0023932
973 Ga0466967_0025085
974 Ga0466967_0036863
975 Ga0466967_0071131
976 Ga0466967_0083564
977 Ga0466967_0136927
978 Ga0466967_0297707
979 Ga0466967_0454807
980 Ga0466967_0512936
981 Ga0466967_0567109
982 Ga0466967_0577429
983 Ga0466967_0633668
984 Ga0466967_0870991
985 Ga0466967_1053990
986 Ga0466967_1064541
987 Ga0466967_1971828
988 Ga0495592_0067671
989 Ga0495629_0479421
990 Ga0495651_0021472
991 Ga0495664_0359367
992 Ga0495608_0009066
993 Ga0495628_0207520
994 Ga0495630_1443231
995 Ga0495652_0048691
996 Ga0495640_0133466
997 Ga0495667_0022017
998 Ga0495635_0033134
999 Ga0495623_0464418
1000 Ga0495646_0168233
1001 Ga0495658_0303602
1002 Ga0495613_0115841
1003 Ga0495671_0456215
1004 Ga0495600_0081260
1005 Ga0495604_0034729
1006 Ga0495674_0397144
1007 Ga0495676_0692542
1008 Ga0495684_0163978
1009 Ga0495593_0097753
1010 Ga0495602_0052321
1011 Ga0496100_0331980
1012 Ga0496100_0775400
1013 Ga0496100_0941036
1014 Ga0496101_0271336
1015 Ga0496101_0663329
1016 Ga0496101_1048525
1017 Ga0496102_0653787
1018 Ga0496102_1089993
1019 Ga0496102_1248568
1020 Ga0496104_0178368
1021 Ga0496104_0292489
1022 Ga0496105_0051922
1023 Ga0496105_0360231
1024 Ga0496105_1105276
1025 Ga0496106_0112045
1026 Ga0496106_1107501
1027 Ga0496107_0111774
1028 Ga0496107_0363638
1029 Ga0496108_0264256
1030 Ga0496108_0583992
1031 Ga0496108_0826729
1032 Ga0496109_0020926
1033 Ga0496109_0538135
1034 Ga0496109_0637445
1035 Ga0496109_1501050
1036 Ga0496110_0045916
1037 Ga0496110_0902811
1038 Ga0496110_0969438
1039 Ga0496110_1606701
1040 Ga0496111_0880981
1041 Ga0496112_0010051
1042 Ga0496112_0120664
1043 Ga0496112_0141510
1044 Ga0496112_0225346
1045 Ga0496112_0743136
1046 Ga0496113_0050913
1047 Ga0496113_0254131
1048 Ga0496113_0483565
1049 Ga0496113_1589309
1050 Ga0496114_0707616
1051 Ga0496115_0150736
1052 Ga0496115_0475820
1053 Ga0496115_0728880
1054 Ga0501031_0372140
1055 Ga0501032_0004941
1056 Ga0501032_0046393
1057 Ga0501033_0100452
1058 Ga0501034_0125180
1059 Ga0501034_0368629
1060 Ga0501036_0003782
1061 Ga0501036_0128318
1062 Ga0501037_0099921
1063 Ga0501037_0311356
1064 Ga0501038_0030105
1065 Ga0501038_0267319
1066 Ga0501039_0130398
1067 Ga0501042_0959646
1068 Ga0501043_0045172
1069 Ga0501046_0051023
1070 Ga0501046_0212574
1071 Ga0501047_0005931
1072 Ga0501047_0222049
1073 Ga0501047_1070030
1074 Ga0501067_0237601
1075 Ga0501067_0748344
1076 Ga0501068_0204722
1077 Ga0501069_0581602
1078 Ga0501070_0002273
1079 Ga0501070_0046945
1080 Ga0501070_0203304
1081 Ga0501072_0070608
1082 Ga0501073_0002560
1083 Ga0501073_0968552
1084 Ga0501074_0036660
1085 Ga0501074_0734478
1086 Ga0501076_1214947
1087 Ga0501079_0946595
1088 Ga0501080_0048044
1089 Ga0501083_0523994
1090 Ga0501035_0005413
1091 Ga0501035_0340446
1092 Ga0501044_0006374
1093 Ga0501044_0172753
1094 Ga0501045_0573705
1095 nmdc:mga03n38_782946_c1
1096 nmdc:mga08y16_335726_c1
1097 Ga0495601_0580645
1098 Ga0495612_0101583
1099 Ga0495595_0065235
1100 Ga0495619_0172109
1101 Ga0501082_0095654
1102 Ga0466962_0003722
1103 Ga0466962_0053088
1104 Ga0466962_0065618
1105 Ga0466962_0075843
1106 Ga0466962_0259436
1107 Ga0466962_0531822
1108 Ga0466962_0673421

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13244

MbhD

MBH, subunit D

10

76

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6srb-assembly1.cif.gz_B crystal structure of glutathione transferase omega 3c from trametes versicolor 0.9865 11 42
6srb-assembly1.cif.gz_A crystal structure of glutathione transferase omega 3c from trametes versicolor 0.9547 11 42
8cdv-assembly1.cif.gz_S rnase r bound to a 30s degradation intermediate (state ii) 0.8369 3 55
7rwv-assembly1.cif.gz_D crystal structure of a metal-free ridc1 variant 0.7916 6 43
7r44-assembly1.cif.gz_L bovine complex i in the presence of im1761092, active class iv (composite map) 0.7482 8 51
ID Description Score Start End Superfamily
af_Q94CK3_29_166_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9716 12 39 1.25.40.10
af_I1JBT3_87_230_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9603 11 39 1.20.1050.10
af_Q9LQ48_89_229_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9366 15 46 1.20.1050.10
af_Q6NMS0_118_254_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9245 11 47 1.20.1050.10
af_Q9FUT1_90_229_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9042 11 42 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2S7P3N6-F1-model_v4 Tetratricopeptide-like helical protein 0.914 1 51
AF-A0A1P8CZ14-F1-model_v4 NADH:ubiquinone reductase (H(+)-translocating) (EC 7.1.1.2) (NADH dehydrogenase subunit 5) 0.7762 6 51 GO:0003954
GO:0005739
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A3D5VJ18-F1-model_v4 Monovalent cation/H+ antiporter subunit D family protein 0.7699 8 52 GO:0005886
GO:0008137
GO:0042773
AF-A0A7W8CVU8-F1-model_v4 Uncharacterized protein 0.764 8 56
AF-A0A0B8NKU3-F1-model_v4 Na(+) H(+) antiporter subunit D 0.7618 7 81 GO:0005886

Map