F462979

General Info

Members Datasets Scaffolds Average Seq Length
554 236 550 299

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10137005|Ga0105241_101370052
Length 323
Sequence MHNVFCSTTLFYIFVPTKKNKPMQQPTLLILAAGMASRYGSMKQIQSFGPGGETIMDYSIYDAIRAGFKKVVFIIRKEFAADFQEIFEPKLKGRVAIDYVYQDLHAFTDGFQVPADRTKPWGTAHAILCAKNAINEPFAVINADDFYGRDAFEKAYEFLTTDCGPKLYSIIGYELLKTLSDNGTVNRGVCQVDAKGNLTAIAERINLSMQKGKIMVDDNQEPKELPLETSVSMNFWCFAPSIFPYTEKLFHTFISKNLSNPKAEFFIPIVADEFISKGDGAIKVIPTSAQWFGVTYKEDAPGVKASLDELVKAGEYPARLWPS

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
3 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
190 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
191 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
208 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
211 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
212 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
213 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
214 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
215 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
221 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 0.54
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000984 3300001979 Bacteria 12737
2 JGI24739J22299_10007020 3300001989 Bacteria 4241
3 JGI24739J22299_10018624 3300001989 Bacteria 2493
4 JGI24751J29686_10003924 3300002459 Bacteria 3004
5 rootH1_10098359 3300003316 Bacteria 2579
6 rootH1_10150810 3300003316 Bacteria 2899
7 rootL2_10058361 3300003322 Bacteria 4028
8 rootL2_10058370 3300003322 Bacteria 4139
9 rootH1_10005105 3300003323 Bacteria 17579
10 rootH1_10188737 3300003323 Bacteria 2065
11 Ga0065714_10070747 3300005288 Bacteria 3775
12 Ga0065712_10079131 3300005290 Bacteria 3255
13 Ga0070658_10077419 3300005327 Unclassified 2728
14 Ga0070658_10122562 3300005327 Bacteria 2161
15 Ga0070676_10021838 3300005328 Bacteria 3585
16 Ga0070676_10067586 3300005328 Bacteria 2137
17 Ga0070676_10115694 3300005328 Bacteria 1676
18 Ga0070676_10141338 3300005328 Unclassified 1533
19 Ga0070683_100000416 3300005329 Bacteria 29488
20 Ga0070683_100000862 3300005329 Bacteria 22425
21 Ga0070670_100034153 3300005331 Bacteria 4378
22 Ga0070670_100064158 3300005331 Bacteria 3152
23 Ga0070670_100077525 3300005331 Bacteria 2855
24 Ga0070670_100096076 3300005331 Bacteria 2549
25 Ga0070677_10014063 3300005333 Bacteria 2810
26 Ga0068869_100027065 3300005334 Bacteria 3995
27 Ga0068869_100027540 3300005334 Bacteria 3963
28 Ga0068869_100061722 3300005334 Unclassified 2750
29 Ga0068869_100061815 3300005334 Unclassified 2748
30 Ga0068869_100072233 3300005334 Unclassified 2557
31 Ga0068869_100310236 3300005334 Bacteria 1277
32 Ga0070666_10000028 3300005335 Bacteria 144796
33 Ga0070666_10008440 3300005335 Bacteria 6397
34 Ga0070666_10043338 3300005335 Unclassified 3013
35 Ga0070680_100015814 3300005336 Bacteria 5923
36 Ga0070680_100053596 3300005336 Bacteria 3293
37 Ga0070682_100016914 3300005337 Bacteria 4244
38 Ga0070682_100036556 3300005337 Bacteria 3003
39 Ga0068868_100001540 3300005338 Bacteria 15748
40 Ga0068868_100004208 3300005338 Bacteria 10068
41 Ga0068868_100027683 3300005338 Unclassified 4325
42 Ga0070660_100001251 3300005339 Bacteria 17279
43 Ga0070660_100027666 3300005339 Bacteria 4234
44 Ga0070660_100097607 3300005339 Bacteria 2324
45 Ga0070660_100176151 3300005339 Bacteria 1730
46 Ga0070689_100046302 3300005340 Unclassified 3351
47 Ga0070687_100168432 3300005343 Bacteria 1302
48 Ga0070661_100001691 3300005344 Bacteria 15284
49 Ga0070661_100041644 3300005344 Bacteria 3351
50 Ga0070661_100049918 3300005344 Bacteria 3063
51 Ga0070668_100046743 3300005347 Bacteria 3325
52 Ga0070668_100143155 3300005347 Bacteria 1928
53 Ga0070668_100144280 3300005347 Bacteria 1920
54 Ga0070669_100040444 3300005353 Unclassified 3389
55 Ga0070675_100027552 3300005354 Unclassified 4566
56 Ga0070675_100128955 3300005354 Bacteria 2154
57 Ga0070675_100229375 3300005354 Bacteria 1619
58 Ga0070675_100298551 3300005354 Unclassified 1419
59 Ga0070671_100041177 3300005355 Unclassified 3839
60 Ga0070671_100159034 3300005355 Unclassified 1909
61 Ga0070671_100197694 3300005355 Bacteria 1705
62 Ga0070671_100410165 3300005355 Unclassified 1160
63 Ga0070674_100003085 3300005356 Bacteria 9270
64 Ga0070674_100157030 3300005356 Bacteria 1722
65 Ga0070673_100018725 3300005364 Bacteria 4955
66 Ga0070673_100103867 3300005364 Bacteria 2345
67 Ga0070673_100197855 3300005364 Unclassified 1730
68 Ga0070688_100227275 3300005365 Unclassified 1318
69 Ga0070659_100025801 3300005366 Bacteria 4519
70 Ga0070659_100030941 3300005366 Bacteria 4143
71 Ga0070659_100210510 3300005366 Bacteria 1602
72 Ga0070667_100026896 3300005367 Bacteria 4787
73 Ga0070667_100329277 3300005367 Bacteria 1380
74 Ga0070667_100553192 3300005367 Bacteria 1058
75 Ga0070713_100059780 3300005436 Bacteria 3184
76 Ga0070700_100062674 3300005441 Bacteria 2350
77 Ga0070663_100133295 3300005455 Bacteria 1889
78 Ga0070678_100008598 3300005456 Bacteria 6121
79 Ga0070662_100205919 3300005457 Unclassified 1563
80 Ga0070681_10293253 3300005458 Bacteria 1536
81 Ga0070681_10293747 3300005458 Bacteria 1535
82 Ga0068867_100066710 3300005459 Bacteria 2681
83 Ga0068867_100120995 3300005459 Unclassified 2023
84 Ga0068867_100137042 3300005459 Unclassified 1909
85 Ga0068867_100211317 3300005459 Bacteria 1558
86 Ga0068867_100343155 3300005459 Bacteria 1244
87 Ga0070679_100003166 3300005530 Bacteria 15042
88 Ga0070679_100008640 3300005530 Bacteria 9598
89 Ga0070679_100036542 3300005530 Bacteria 4874
90 Ga0070679_100233318 3300005530 Unclassified 1799
91 Ga0070679_100321481 3300005530 Bacteria 1497
92 Ga0070684_100010866 3300005535 Bacteria 7235
93 Ga0070684_100060025 3300005535 Bacteria 3325
94 Ga0070684_100132101 3300005535 Unclassified 2252
95 Ga0068853_100001585 3300005539 Bacteria 16590
96 Ga0068853_100005622 3300005539 Bacteria 9849
97 Ga0068853_100031135 3300005539 Bacteria 4512
98 Ga0068853_100079362 3300005539 Bacteria 2870
99 Ga0068853_100089002 3300005539 Unclassified 2711
100 Ga0068853_100209830 3300005539 Bacteria 1775
101 Ga0068853_100311404 3300005539 Bacteria 1457
102 Ga0070672_100018931 3300005543 Bacteria 4988
103 Ga0070672_100102005 3300005543 Unclassified 2328
104 Ga0070672_100269417 3300005543 Bacteria 1437
105 Ga0070665_100229958 3300005548 Bacteria 1854
106 Ga0068855_100000630 3300005563 Bacteria 43230
107 Ga0068855_100008628 3300005563 Bacteria 12313
108 Ga0068855_100024867 3300005563 Bacteria 7166
109 Ga0068855_100038643 3300005563 Bacteria 5670
110 Ga0068855_100077197 3300005563 Bacteria 3864
111 Ga0068855_100114206 3300005563 Bacteria 3096
112 Ga0068855_100227602 3300005563 Bacteria 2089
113 Ga0068855_100748844 3300005563 Bacteria 1042
114 Ga0070664_100009504 3300005564 Bacteria 7883
115 Ga0070664_100024924 3300005564 Bacteria 4956
116 Ga0070664_100164031 3300005564 Bacteria 1968
117 Ga0070664_100263006 3300005564 Bacteria 1553
118 Ga0068857_100029919 3300005577 Bacteria 4806
119 Ga0068857_100052605 3300005577 Bacteria 3613
120 Ga0068857_100266087 3300005577 Bacteria 1575
121 Ga0068854_100032094 3300005578 Bacteria 3652
122 Ga0068856_100027858 3300005614 Bacteria 5512
123 Ga0068856_100094037 3300005614 Bacteria 2984
124 Ga0068856_100351643 3300005614 Bacteria 1492
125 Ga0068852_100004122 3300005616 Bacteria 10232
126 Ga0068852_100004976 3300005616 Bacteria 9451
127 Ga0068852_100019025 3300005616 Bacteria 5426
128 Ga0068852_100030690 3300005616 Bacteria 4428
129 Ga0068852_100096705 3300005616 Bacteria 2655
130 Ga0068852_100124030 3300005616 Bacteria 2369
131 Ga0068852_100164427 3300005616 Bacteria 2075
132 Ga0068852_100358872 3300005616 Bacteria 1425
133 Ga0068859_100000012 3300005617 Bacteria 300376
134 Ga0068859_100008213 3300005617 Bacteria 10591
135 Ga0068859_100020133 3300005617 Bacteria 6699
136 Ga0068859_100041535 3300005617 Unclassified 4619
137 Ga0068859_100057135 3300005617 Bacteria 3931
138 Ga0068859_100280449 3300005617 Unclassified 1759
139 Ga0068859_100854078 3300005617 Unclassified 996
140 Ga0068864_100007973 3300005618 Bacteria 8728
141 Ga0068864_100012297 3300005618 Bacteria 7074
142 Ga0068864_100044037 3300005618 Bacteria 3823
143 Ga0068864_100071732 3300005618 Bacteria 3017
144 Ga0068864_100307092 3300005618 Bacteria 1486
145 Ga0068866_10010641 3300005718 Bacteria 3951
146 Ga0068861_100010694 3300005719 Bacteria 6376
147 Ga0068861_100081735 3300005719 Bacteria 2530
148 Ga0068851_10046804 3300005834 Bacteria 2189
149 Ga0068863_100002125 3300005841 Bacteria 19657
150 Ga0068863_100009422 3300005841 Bacteria 9532
151 Ga0068863_100436971 3300005841 Bacteria 1283
152 Ga0068863_100621024 3300005841 Bacteria 1071
153 Ga0068858_100004702 3300005842 Bacteria 13379
154 Ga0068858_100324300 3300005842 Bacteria 1472
155 Ga0068860_100000046 3300005843 Bacteria 214800
156 Ga0068860_100007815 3300005843 Bacteria 10678
157 Ga0068860_100012479 3300005843 Bacteria 8368
158 Ga0068860_100020187 3300005843 Bacteria 6457
159 Ga0068860_100063896 3300005843 Bacteria 3496
160 Ga0068862_100008092 3300005844 Bacteria 8701
161 Ga0068862_100378411 3300005844 Unclassified 1320
162 Ga0068862_100683976 3300005844 Unclassified 992
163 Ga0075366_10044041 3300006195 Bacteria 2645
164 Ga0075366_10044467 3300006195 Bacteria 2632
165 Ga0075366_10044732 3300006195 Bacteria 2624
166 Ga0097621_100005734 3300006237 Bacteria 8764
167 Ga0097621_100020920 3300006237 Bacteria 5049
168 Ga0097621_100058596 3300006237 Bacteria 3150
169 Ga0097621_100120499 3300006237 Unclassified 2225
170 Ga0097621_100179577 3300006237 Bacteria 1828
171 Ga0068871_100001400 3300006358 Bacteria 16139
172 Ga0068871_100003922 3300006358 Bacteria 10260
173 Ga0068871_100132921 3300006358 Unclassified 2111
174 Ga0075431_100089555 3300006847 Unclassified 3176
175 Ga0068865_100115537 3300006881 Bacteria 1986
176 Ga0068865_100210844 3300006881 Unclassified 1514
177 Ga0068865_100358562 3300006881 Bacteria 1183
178 Ga0075436_100191241 3300006914 Bacteria 1448
179 Ga0097620_100000012 3300006931 Bacteria 300376
180 Ga0097620_100008213 3300006931 Bacteria 10591
181 Ga0097620_100020133 3300006931 Bacteria 6699
182 Ga0097620_100041533 3300006931 Unclassified 4619
183 Ga0097620_100057136 3300006931 Bacteria 3931
184 Ga0097620_100280441 3300006931 Unclassified 1759
185 Ga0097620_100854109 3300006931 Unclassified 996
186 Ga0105240_10001517 3300009093 Bacteria 39516
187 Ga0105240_10002716 3300009093 Bacteria 28079
188 Ga0105240_10002823 3300009093 Bacteria 27474
189 Ga0105240_10092646 3300009093 Bacteria 3689
190 Ga0105240_10112572 3300009093 Unclassified 3290
191 Ga0105240_10293984 3300009093 Bacteria 1861
192 Ga0105240_10327078 3300009093 Bacteria 1745
193 Ga0105240_10601691 3300009093 Bacteria 1210
194 Ga0111539_10027898 3300009094 Bacteria 6894
195 Ga0111539_10032122 3300009094 Bacteria 6377
196 Ga0105245_10825443 3300009098 Bacteria 966
197 Ga0105247_10089800 3300009101 Unclassified 1949
198 Ga0105247_10229417 3300009101 Unclassified 1260
199 Ga0114129_10022075 3300009147 Bacteria 9032
200 Ga0105241_10000619 3300009174 Bacteria 26737
201 Ga0105241_10007907 3300009174 Bacteria 7818
202 Ga0105241_10137005 3300009174 Bacteria 1989
203 Ga0105242_10035863 3300009176 Bacteria 3977
204 Ga0105242_10081723 3300009176 Bacteria 2702
205 Ga0105242_10167480 3300009176 Unclassified 1928
206 Ga0105248_10434615 3300009177 Bacteria 1478
207 Ga0105237_10007560 3300009545 Bacteria 11876
208 Ga0105237_10020194 3300009545 Bacteria 6875
209 Ga0105237_10041432 3300009545 Bacteria 4644
210 Ga0105237_10052578 3300009545 Bacteria 4088
211 Ga0105237_10435858 3300009545 Unclassified 1316
212 Ga0105238_10136112 3300009551 Unclassified 2434
213 Ga0105249_10000336 3300009553 Bacteria 47472
214 Ga0105249_10002924 3300009553 Bacteria 14735
215 Ga0105249_10029128 3300009553 Bacteria 4986
216 Ga0105249_10062091 3300009553 Bacteria 3430
217 Ga0105249_10077375 3300009553 Bacteria 3085
218 Ga0105239_10008174 3300010375 Bacteria 11935
219 Ga0105239_10014733 3300010375 Bacteria 8672
220 Ga0105239_10035221 3300010375 Bacteria 5498
221 Ga0105239_10203614 3300010375 Bacteria 2217
222 Ga0105239_10728352 3300010375 Unclassified 1135
223 Ga0105246_10046348 3300011119 Bacteria 2965
224 Ga0105246_10096961 3300011119 Bacteria 2138
225 Ga0105246_10241185 3300011119 Bacteria 1429
226 Ga0157373_10001885 3300013100 Bacteria 15908
227 Ga0157373_10022711 3300013100 Bacteria 4550
228 Ga0157373_10188601 3300013100 Bacteria 1453
229 Ga0157373_10411245 3300013100 Unclassified 970
230 Ga0157371_10001002 3300013102 Bacteria 31205
231 Ga0157371_10002977 3300013102 Bacteria 15723
232 Ga0157371_10004296 3300013102 Bacteria 12506
233 Ga0157371_10006866 3300013102 Bacteria 9293
234 Ga0157371_10006988 3300013102 Bacteria 9187
235 Ga0157371_10014226 3300013102 Bacteria 6016
236 Ga0157371_10014774 3300013102 Bacteria 5878
237 Ga0157371_10029414 3300013102 Bacteria 3974
238 Ga0157371_10047724 3300013102 Bacteria 3045
239 Ga0157371_10086943 3300013102 Bacteria 2214
240 Ga0157371_10197804 3300013102 Unclassified 1440
241 Ga0157370_10004047 3300013104 Bacteria 17017
242 Ga0157370_10054899 3300013104 Bacteria 3797
243 Ga0157370_10231376 3300013104 Bacteria 1711
244 Ga0157369_10009715 3300013105 Bacteria 11003
245 Ga0157369_10018160 3300013105 Bacteria 7889
246 Ga0157369_10080099 3300013105 Bacteria 3497
247 Ga0157369_10095435 3300013105 Bacteria 3173
248 Ga0157369_10214197 3300013105 Bacteria 2018
249 Ga0157374_10031789 3300013296 Bacteria 4801
250 Ga0157374_10040796 3300013296 Bacteria 4276
251 Ga0157374_10261725 3300013296 Bacteria 1704
252 Ga0157374_10390963 3300013296 Bacteria 1386
253 Ga0157374_10497550 3300013296 Bacteria 1223
254 Ga0157378_10002969 3300013297 Bacteria 15088
255 Ga0157378_10025960 3300013297 Bacteria 5162
256 Ga0157378_10033991 3300013297 Bacteria 4509
257 Ga0157378_10041279 3300013297 Bacteria 4092
258 Ga0157378_10083364 3300013297 Bacteria 2893
259 Ga0157378_10202627 3300013297 Bacteria 1877
260 Ga0157378_10293679 3300013297 Unclassified 1571
261 Ga0163162_10002326 3300013306 Bacteria 17832
262 Ga0163162_10017671 3300013306 Bacteria 6978
263 Ga0163162_10050840 3300013306 Bacteria 4157
264 Ga0163162_10353766 3300013306 Bacteria 1601
265 Ga0163162_10540856 3300013306 Unclassified 1293
266 Ga0157372_10054066 3300013307 Bacteria 4477
267 Ga0157372_10080094 3300013307 Bacteria 3695
268 Ga0157372_10110017 3300013307 Bacteria 3156
269 Ga0157372_10139008 3300013307 Bacteria 2797
270 Ga0157372_10227461 3300013307 Bacteria 2162
271 Ga0157372_10307524 3300013307 Unclassified 1845
272 Ga0157372_10778967 3300013307 Bacteria 1112
273 Ga0157375_10399131 3300013308 Bacteria 1542
274 Ga0163163_10035920 3300014325 Bacteria 4811
275 Ga0163163_10112099 3300014325 Bacteria 2757
276 Ga0163163_10338101 3300014325 Unclassified 1561
277 Ga0157380_10107218 3300014326 Bacteria 2339
278 Ga0157380_10194326 3300014326 Bacteria 1794
279 Ga0157377_10010450 3300014745 Bacteria 4592
280 Ga0157379_10030191 3300014968 Unclassified 4823
281 Ga0157379_10054417 3300014968 Bacteria 3575
282 Ga0157379_10188186 3300014968 Bacteria 1866
283 Ga0157379_10220949 3300014968 Bacteria 1717
284 Ga0157379_10279260 3300014968 Unclassified 1520
285 Ga0182006_1005135 3300015261 Bacteria 6289
286 Ga0163161_10028064 3300017792 Bacteria 3995
287 Ga0163161_10203979 3300017792 Bacteria 1525
288 Ga0209646_1001411 3300025246 Bacteria 6524
289 Ga0207697_10072834 3300025315 Bacteria 1441
290 Ga0207710_10086013 3300025900 Bacteria 1465
291 Ga0207688_10010428 3300025901 Bacteria 5058
292 Ga0207688_10010984 3300025901 Bacteria 4926
293 Ga0207680_10003326 3300025903 Bacteria 7574
294 Ga0207680_10090125 3300025903 Bacteria 1948
295 Ga0207680_10127486 3300025903 Unclassified 1673
296 Ga0207680_10258231 3300025903 Unclassified 1205
297 Ga0207647_10006531 3300025904 Bacteria 8473
298 Ga0207647_10022060 3300025904 Bacteria 4236
299 Ga0207647_10041934 3300025904 Bacteria 2874
300 Ga0207645_10000354 3300025907 Bacteria 38157
301 Ga0207645_10007158 3300025907 Bacteria 7912
302 Ga0207645_10160915 3300025907 Unclassified 1469
303 Ga0207645_10212118 3300025907 Bacteria 1276
304 Ga0207643_10003608 3300025908 Bacteria 8342
305 Ga0207705_10002745 3300025909 Bacteria 13489
306 Ga0207705_10131875 3300025909 Bacteria 1860
307 Ga0207654_10000479 3300025911 Bacteria 22913
308 Ga0207654_10015243 3300025911 Bacteria 3985
309 Ga0207654_10240283 3300025911 Bacteria 1210
310 Ga0207707_10108169 3300025912 Bacteria 2431
311 Ga0207707_10251310 3300025912 Bacteria 1536
312 Ga0207695_10000023 3300025913 Bacteria 657903
313 Ga0207695_10000110 3300025913 Bacteria 250079
314 Ga0207695_10000229 3300025913 Bacteria 149313
315 Ga0207695_10009361 3300025913 Bacteria 12113
316 Ga0207695_10016531 3300025913 Bacteria 8626
317 Ga0207695_10267368 3300025913 Bacteria 1606
318 Ga0207671_10005924 3300025914 Bacteria 11082
319 Ga0207671_10048967 3300025914 Unclassified 3127
320 Ga0207671_10225275 3300025914 Bacteria 1470
321 Ga0207671_10406374 3300025914 Bacteria 1083
322 Ga0207660_10006958 3300025917 Bacteria 7325
323 Ga0207660_10036076 3300025917 Unclassified 3436
324 Ga0207657_10022885 3300025919 Bacteria 5832
325 Ga0207657_10032463 3300025919 Bacteria 4717
326 Ga0207657_10042465 3300025919 Unclassified 4012
327 Ga0207657_10092792 3300025919 Bacteria 2516
328 Ga0207657_10343784 3300025919 Bacteria 1177
329 Ga0207649_10024736 3300025920 Bacteria 3494
330 Ga0207649_10130932 3300025920 Bacteria 1703
331 Ga0207652_10000181 3300025921 Bacteria 66711
332 Ga0207652_10004884 3300025921 Bacteria 10845
333 Ga0207652_10009180 3300025921 Bacteria 7960
334 Ga0207681_10174592 3300025923 Bacteria 1632
335 Ga0207681_10382595 3300025923 Unclassified 1133
336 Ga0207650_10003002 3300025925 Bacteria 11627
337 Ga0207650_10196085 3300025925 Bacteria 1615
338 Ga0207659_10127291 3300025926 Bacteria 1961
339 Ga0207659_10263654 3300025926 Unclassified 1403
340 Ga0207664_10201931 3300025929 Bacteria 1716
341 Ga0207644_10021217 3300025931 Bacteria 4422
342 Ga0207644_10111448 3300025931 Unclassified 2070
343 Ga0207644_10129579 3300025931 Unclassified 1930
344 Ga0207690_10071566 3300025932 Bacteria 2392
345 Ga0207690_10255171 3300025932 Bacteria 1356
346 Ga0207706_10306261 3300025933 Bacteria 1384
347 Ga0207706_10386944 3300025933 Unclassified 1213
348 Ga0207686_10278279 3300025934 Bacteria 1234
349 Ga0207670_10040599 3300025936 Bacteria 3054
350 Ga0207669_10188217 3300025937 Bacteria 1486
351 Ga0207704_10090892 3300025938 Bacteria 2005
352 Ga0207691_10003925 3300025940 Bacteria 14448
353 Ga0207691_10008243 3300025940 Bacteria 10005
354 Ga0207691_10037067 3300025940 Bacteria 4516
355 Ga0207691_10063145 3300025940 Unclassified 3360
356 Ga0207691_10089598 3300025940 Unclassified 2758
357 Ga0207689_10001630 3300025942 Bacteria 21256
358 Ga0207689_10003402 3300025942 Bacteria 14529
359 Ga0207689_10010556 3300025942 Bacteria 7952
360 Ga0207689_10028309 3300025942 Bacteria 4688
361 Ga0207689_10039159 3300025942 Unclassified 3925
362 Ga0207689_10095066 3300025942 Bacteria 2447
363 Ga0207661_10000927 3300025944 Bacteria 19231
364 Ga0207661_10017050 3300025944 Bacteria 5366
365 Ga0207679_10012298 3300025945 Bacteria 5577
366 Ga0207679_10048992 3300025945 Bacteria 3079
367 Ga0207679_10174640 3300025945 Unclassified 1772
368 Ga0207679_10355117 3300025945 Bacteria 1279
369 Ga0207667_10000700 3300025949 Bacteria 43461
370 Ga0207667_10002784 3300025949 Bacteria 21649
371 Ga0207667_10021765 3300025949 Bacteria 7101
372 Ga0207667_10024649 3300025949 Bacteria 6601
373 Ga0207651_10029346 3300025960 Bacteria 3484
374 Ga0207651_10383278 3300025960 Bacteria 1192
375 Ga0207712_10011962 3300025961 Bacteria 5537
376 Ga0207712_10030807 3300025961 Bacteria 3608
377 Ga0207712_10031978 3300025961 Bacteria 3548
378 Ga0207712_10044454 3300025961 Bacteria 3070
379 Ga0207712_10128949 3300025961 Bacteria 1924
380 Ga0207668_10206746 3300025972 Bacteria 1567
381 Ga0207668_10493100 3300025972 Bacteria 1052
382 Ga0207640_10093442 3300025981 Bacteria 2090
383 Ga0207640_10350103 3300025981 Bacteria 1187
384 Ga0207640_10503965 3300025981 Bacteria 1009
385 Ga0207658_10072894 3300025986 Unclassified 2605
386 Ga0207658_10112399 3300025986 Bacteria 2156
387 Ga0207658_10227509 3300025986 Bacteria 1572
388 Ga0207658_10243111 3300025986 Unclassified 1526
389 Ga0207658_10267122 3300025986 Unclassified 1460
390 Ga0207677_10010001 3300026023 Bacteria 5353
391 Ga0207677_10035021 3300026023 Bacteria 3256
392 Ga0207677_10119562 3300026023 Unclassified 1979
393 Ga0207677_10165535 3300026023 Unclassified 1723
394 Ga0207703_10004584 3300026035 Bacteria 11320
395 Ga0207703_10342658 3300026035 Unclassified 1374
396 Ga0207703_10404726 3300026035 Unclassified 1267
397 Ga0207639_10010461 3300026041 Bacteria 6427
398 Ga0207639_10043200 3300026041 Unclassified 3382
399 Ga0207639_10051489 3300026041 Bacteria 3132
400 Ga0207639_10159449 3300026041 Unclassified 1900
401 Ga0207708_10115057 3300026075 Bacteria 2091
402 Ga0207702_10078915 3300026078 Bacteria 2851
403 Ga0207702_10093862 3300026078 Bacteria 2632
404 Ga0207702_10111484 3300026078 Bacteria 2433
405 Ga0207702_10567416 3300026078 Bacteria 1111
406 Ga0207641_10000152 3300026088 Bacteria 98311
407 Ga0207641_10160035 3300026088 Unclassified 2046
408 Ga0207641_10282834 3300026088 Bacteria 1561
409 Ga0207648_10000404 3300026089 Bacteria 48036
410 Ga0207648_10006809 3300026089 Bacteria 11325
411 Ga0207648_10210907 3300026089 Unclassified 1724
412 Ga0207676_10022185 3300026095 Bacteria 4668
413 Ga0207676_10042904 3300026095 Bacteria 3479
414 Ga0207676_10203869 3300026095 Unclassified 1749
415 Ga0207674_10002719 3300026116 Bacteria 22062
416 Ga0207674_10048243 3300026116 Bacteria 4359
417 Ga0207674_10055019 3300026116 Bacteria 4049
418 Ga0207674_10396486 3300026116 Bacteria 1334
419 Ga0207675_100136473 3300026118 Bacteria 2328
420 Ga0207675_100637145 3300026118 Unclassified 1071
421 Ga0207683_10021738 3300026121 Bacteria 5499
422 Ga0207698_10012749 3300026142 Bacteria 5517
423 Ga0207698_10031580 3300026142 Bacteria 3825
424 Ga0207698_10090996 3300026142 Bacteria 2496
425 Ga0207698_10332943 3300026142 Bacteria 1427
426 Ga0207428_10374460 3300027907 Bacteria 1045
427 Ga0268266_10115106 3300028379 Unclassified 2387
428 Ga0268266_10220049 3300028379 Bacteria 1745
429 Ga0268265_10073544 3300028380 Bacteria 2670
430 Ga0268265_10312303 3300028380 Bacteria 1420
431 Ga0268264_10000041 3300028381 Bacteria 372501
432 Ga0268264_10003143 3300028381 Bacteria 14302
433 Ga0268264_10010550 3300028381 Bacteria 7639
434 Ga0268264_10018981 3300028381 Bacteria 5622
435 Ga0307515_10000039 3300028794 Bacteria 323229
436 Ga0265327_10085600 3300031251 Bacteria 1548
437 Ga0307513_10033861 3300031456 Bacteria 5738
438 Ga0307513_10035308 3300031456 Bacteria 5595
439 Ga0307513_10280517 3300031456 Bacteria 1444
440 Ga0307509_10116319 3300031507 Bacteria 2664
441 Ga0307509_10121713 3300031507 Bacteria 2586
442 Ga0307516_10000577 3300031730 Bacteria 49482
443 Ga0307516_10048490 3300031730 Bacteria 4179
444 Ga0307410_10079004 3300031852 Bacteria 2304
445 Ga0307407_10114337 3300031903 Unclassified 1700
446 Ga0307510_10000805 3300033180 Bacteria 32598
447 Ga0395899_0023691 3300037312 Bacteria 4646
448 Ga0395899_0033036 3300037312 Bacteria 3887
449 Ga0395899_0059292 3300037312 Bacteria 2821
450 Ga0395900_0007567 3300037418 Bacteria 11217
451 Ga0395900_0017877 3300037418 Bacteria 7237
452 Ga0395900_0040292 3300037418 Bacteria 4813
453 Ga0395900_0082623 3300037418 Bacteria 3300
454 Ga0395900_0268260 3300037418 Bacteria 1702
455 Ga0395898_0001381 3300037466 Bacteria 34756
456 Ga0395898_0003360 3300037466 Bacteria 17943
457 Ga0395898_0042155 3300037466 Bacteria 4505
458 Ga0395898_0154572 3300037466 Bacteria 2194
459 Ga0395905_0103398 3300037471 Bacteria 2674
460 Ga0395901_0012942 3300038443 Bacteria 8465
461 Ga0395901_0041303 3300038443 Bacteria 4779
462 Ga0439436_0009107 3300041404 Bacteria 3045
463 Ga0439439_0013442 3300041406 Bacteria 1984
464 Ga0439439_0026591 3300041406 Bacteria 1459
465 Ga0451795_0953208 3300041456 Bacteria 1861
466 Ga0451843_0685672 3300041509 Bacteria 1507
467 Ga0451853_2186550 3300041512 Bacteria 961
468 Ga0439449_0017974 3300042007 Bacteria 2654
469 Ga0439457_000707 3300042014 Bacteria 9880
470 Ga0439457_014159 3300042014 Bacteria 1787
471 Ga0451577_0311814 3300042876 Unclassified 1426
472 Ga0466969_0000182 3300044656 Bacteria 33828
473 Ga0466972_0003013 3300044658 Bacteria 8349
474 Ga0466972_0020761 3300044658 Bacteria 3280
475 Ga0466972_0028475 3300044658 Unclassified 2755
476 Ga0466965_0176656 3300044683 Bacteria 1125
477 Ga0466966_0002356 3300044684 Bacteria 12337
478 Ga0453684_0190650 3300044712 Bacteria 2398
479 Ga0466971_0083026 3300044719 Bacteria 1463
480 Ga0466968_0021860 3300044735 Bacteria 2594
481 Ga0466968_0159273 3300044735 Bacteria 1041
482 Ga0466957_0012368 3300044842 Bacteria 4941
483 Ga0466957_0033803 3300044842 Bacteria 3068
484 Ga0466959_0000056 3300045049 Bacteria 78465
485 Ga0495638_0023198 3300046460 Bacteria 4063
486 Ga0495650_0033545 3300046471 Bacteria 2284
487 Ga0495632_0074992 3300046519 Bacteria 1620
488 Ga0495632_0117974 3300046519 Unclassified 1242
489 Ga0495648_0001994 3300046524 Bacteria 19331
490 Ga0495668_0001941 3300046616 Bacteria 18402
491 Ga0495668_0076915 3300046616 Bacteria 1832
492 Ga0495686_0000004 3300047472 Bacteria 869019
493 Ga0496110_0039739 3300048913 Bacteria 4097
494 Ga0496110_0514358 3300048913 Unclassified 1089
495 Ga0501290_002692 3300049513 Unclassified 2278
496 Ga0501296_000745 3300049519 Unclassified 3230
497 Ga0501297_001875 3300049520 Unclassified 1987
498 Ga0501298_001632 3300049521 Unclassified 3322
499 Ga0501299_000376 3300049522 Bacteria 5270
500 Ga0501031_0003126 3300049568 Bacteria 10612
501 Ga0501033_0209318 3300049570 Bacteria 1391
502 Ga0501034_0168910 3300049571 Unclassified 2155
503 Ga0501036_0018517 3300049572 Bacteria 5837
504 Ga0501037_0187002 3300049573 Unclassified 1467
505 Ga0501038_0006153 3300049574 Bacteria 11107
506 Ga0501043_0238588 3300049579 Bacteria 1403
507 Ga0501047_0056300 3300049581 Bacteria 3802
508 Ga0501048_0151809 3300049582 Bacteria 1639
509 Ga0501068_0403905 3300049584 Unclassified 881
510 Ga0501070_0033866 3300049586 Bacteria 4274
511 Ga0501072_0154018 3300049588 Bacteria 1833
512 Ga0501073_0351667 3300049589 Unclassified 1017
513 Ga0501198_000760 3300049649 Unclassified 4029
514 Ga0501201_000177 3300049651 Bacteria 5604
515 Ga0501202_000044 3300049652 Bacteria 12530
516 Ga0501206_003258 3300049653 Unclassified 2061
517 Ga0501209_051941 3300049656 Unclassified 1121
518 Ga0501217_000584 3300049661 Bacteria 6142
519 Ga0501223_001942 3300049663 Bacteria 4646
520 Ga0501224_001879 3300049664 Unclassified 2835
521 Ga0501242_002238 3300049674 Unclassified 2022
522 Ga0501259_000788 3300049688 Bacteria 5184
523 Ga0501261_000428 3300049690 Bacteria 5494
524 Ga0501219_000074 3300049703 Bacteria 17135
525 Ga0501225_0003441 3300049705 Bacteria 4795
526 Ga0501225_0004929 3300049705 Bacteria 3944
527 Ga0501245_000377 3300049708 Bacteria 5341
528 Ga0501279_003545 3300049775 Unclassified 2035
529 Ga0501035_0028141 3300049822 Bacteria 5133
530 Ga0501044_0008339 3300049823 Bacteria 11357
531 Ga0501044_0037968 3300049823 Bacteria 5032
532 Ga0501044_0063747 3300049823 Bacteria 3764
533 Ga0501044_0264558 3300049823 Unclassified 1657
534 Ga0501284_00052 3300050005 Bacteria 43054
535 nmdc:mga0k408_4024_c1 3300050493 Bacteria 7803
536 nmdc:mga0k408_73834_c1 3300050493 Bacteria 1992
537 nmdc:mga05p37_16027_c1 3300050507 Bacteria 7915
538 Ga0500578_0000150 3300053086 Bacteria 83541
539 Ga0500578_0184274 3300053086 Bacteria 1285
540 Ga0500646_0070504 3300053090 Bacteria 1047
541 Ga0500583_0009104 3300053092 Bacteria 3609
542 Ga0500583_0015169 3300053092 Bacteria 3040
543 Ga0500650_0099596 3300053098 Bacteria 1360
544 Ga0500642_0002202 3300053130 Bacteria 5668
545 Ga0500577_0089424 3300053142 Bacteria 1242
546 Ga0500588_0025343 3300053146 Bacteria 1648
547 Ga0500589_040460 3300053147 Bacteria 2176
548 Ga0500622_0000900 3300053156 Bacteria 25309
549 Ga0500611_000028 3300053727 Bacteria 93696
550 Ga0500611_016148 3300053727 Bacteria 1336

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025900 Ga0207710_10086013 Ga0207710_100860131 250
2 3300041509 Ga0451843_0685672 Ga0451843_0685672_687_1487 266
3 3300009094 Ga0111539_10032122 Ga0111539_100321222 267
4 3300026041 Ga0207639_10051489 Ga0207639_100514892 267
5 3300046519 Ga0495632_0117974 Ga0495632_0117974_27_830 267
6 3300005288 Ga0065714_10070747 Ga0065714_100707471 277
7 3300005331 Ga0070670_100034153 Ga0070670_1000341536 279
8 3300031507 Ga0307509_10121713 Ga0307509_101217132 279
9 3300005459 Ga0068867_100343155 Ga0068867_1003431551 280
10 3300009093 Ga0105240_10001517 Ga0105240_1000151710 280
11 3300013100 Ga0157373_10188601 Ga0157373_101886012 280
12 3300013105 Ga0157369_10009715 Ga0157369_100097159 280
13 3300046460 Ga0495638_0023198 Ga0495638_0023198_642_1484 280
14 3300046524 Ga0495648_0001994 Ga0495648_0001994_9419_10261 280
15 3300049584 Ga0501068_0403905 Ga0501068_0403905_20_862 280
16 3300053130 Ga0500642_0002202 Ga0500642_0002202_4324_5166 280
17 3300053156 Ga0500622_0000900 Ga0500622_0000900_22166_23008 280
18 3300053090 Ga0500646_0070504 Ga0500646_0070504_19_864 281
19 3300005334 Ga0068869_100061722 Ga0068869_1000617223 282
20 3300005335 Ga0070666_10000028 Ga0070666_1000002845 282
21 3300005355 Ga0070671_100410165 Ga0070671_1004101651 282
22 3300005616 Ga0068852_100004976 Ga0068852_10000497611 282
23 3300005617 Ga0068859_100000012 Ga0068859_100000012227 282
24 3300005617 Ga0068859_100008213 Ga0068859_1000082131 282
25 3300005618 Ga0068864_100007973 Ga0068864_1000079732 282
26 3300005834 Ga0068851_10046804 Ga0068851_100468042 282
27 3300005841 Ga0068863_100009422 Ga0068863_1000094225 282
28 3300005842 Ga0068858_100004702 Ga0068858_1000047028 282
29 3300006237 Ga0097621_100179577 Ga0097621_1001795772 282
30 3300006931 Ga0097620_100000012 Ga0097620_100000012227 282
31 3300006931 Ga0097620_100008213 Ga0097620_10000821312 282
32 3300009101 Ga0105247_10089800 Ga0105247_100898001 282
33 3300009174 Ga0105241_10000619 Ga0105241_100006194 282
34 3300009545 Ga0105237_10007560 Ga0105237_100075605 282
35 3300009553 Ga0105249_10029128 Ga0105249_100291285 282
36 3300013297 Ga0157378_10083364 Ga0157378_100833644 282
37 3300013306 Ga0163162_10050840 Ga0163162_100508402 282
38 3300014968 Ga0157379_10054417 Ga0157379_100544172 282
39 3300025903 Ga0207680_10003326 Ga0207680_100033265 282
40 3300025911 Ga0207654_10000479 Ga0207654_100004793 282
41 3300025914 Ga0207671_10005924 Ga0207671_1000592410 282
42 3300025942 Ga0207689_10001630 Ga0207689_1000163021 282
43 3300025961 Ga0207712_10044454 Ga0207712_100444541 282
44 3300025986 Ga0207658_10227509 Ga0207658_102275092 282
45 3300026023 Ga0207677_10119562 Ga0207677_101195622 282
46 3300026035 Ga0207703_10004584 Ga0207703_100045844 282
47 3300026088 Ga0207641_10000152 Ga0207641_1000015212 282
48 3300026095 Ga0207676_10042904 Ga0207676_100429042 282
49 3300026142 Ga0207698_10012749 Ga0207698_100127496 282
50 3300028380 Ga0268265_10312303 Ga0268265_103123032 282
51 3300005539 Ga0068853_100089002 Ga0068853_1000890022 286
52 3300005347 Ga0070668_100144280 Ga0070668_1001442802 287
53 3300031730 Ga0307516_10000577 Ga0307516_1000057728 287
54 3300006237 Ga0097621_100058596 Ga0097621_1000585964 288
55 3300006358 Ga0068871_100003922 Ga0068871_1000039222 288
56 3300009545 Ga0105237_10041432 Ga0105237_100414326 288
57 3300013297 Ga0157378_10202627 Ga0157378_102026272 288
58 3300025914 Ga0207671_10048967 Ga0207671_100489674 288
59 3300025938 Ga0207704_10090892 Ga0207704_100908922 288
60 3300049703 Ga0501219_000074 Ga0501219_000074_13388_14260 290
61 3300050005 Ga0501284_00052 Ga0501284_00052_2068_2940 290
62 3300005327 Ga0070658_10077419 Ga0070658_100774193 291
63 3300013307 Ga0157372_10110017 Ga0157372_101100172 291
64 3300025909 Ga0207705_10131875 Ga0207705_101318753 291
65 3300013306 Ga0163162_10017671 Ga0163162_100176715 292
66 3300031730 Ga0307516_10048490 Ga0307516_100484903 292
67 3300042007 Ga0439449_0017974 Ga0439449_0017974_120_998 292
68 3300042014 Ga0439457_014159 Ga0439457_014159_49_927 292
69 3300053092 Ga0500583_0015169 Ga0500583_0015169_2151_3029 292
70 3300005458 Ga0070681_10293253 Ga0070681_102932531 293
71 3300009093 Ga0105240_10092646 Ga0105240_100926463 293
72 3300009545 Ga0105237_10052578 Ga0105237_100525781 293
73 3300013102 Ga0157371_10086943 Ga0157371_100869432 293
74 3300013105 Ga0157369_10095435 Ga0157369_100954352 293
75 3300013307 Ga0157372_10139008 Ga0157372_101390082 293
76 3300025913 Ga0207695_10009361 Ga0207695_100093615 293
77 3300025914 Ga0207671_10225275 Ga0207671_102252752 293
78 3300049513 Ga0501290_002692 Ga0501290_002692_639_1526 293
79 3300049519 Ga0501296_000745 Ga0501296_000745_1651_2538 293
80 3300049520 Ga0501297_001875 Ga0501297_001875_1077_1964 293
81 3300049521 Ga0501298_001632 Ga0501298_001632_1373_2260 293
82 3300049522 Ga0501299_000376 Ga0501299_000376_1799_2686 293
83 3300049649 Ga0501198_000760 Ga0501198_000760_1827_2714 293
84 3300049651 Ga0501201_000177 Ga0501201_000177_1798_2685 293
85 3300049652 Ga0501202_000044 Ga0501202_000044_1171_2058 293
86 3300049661 Ga0501217_000584 Ga0501217_000584_4440_5327 293
87 3300049663 Ga0501223_001942 Ga0501223_001942_2608_3495 293
88 3300049664 Ga0501224_001879 Ga0501224_001879_1436_2323 293
89 3300049674 Ga0501242_002238 Ga0501242_002238_799_1686 293
90 3300049688 Ga0501259_000788 Ga0501259_000788_3567_4454 293
91 3300049690 Ga0501261_000428 Ga0501261_000428_845_1732 293
92 3300049705 Ga0501225_0003441 Ga0501225_0003441_2984_3871 293
93 3300049708 Ga0501245_000377 Ga0501245_000377_891_1778 293
94 3300049775 Ga0501279_003545 Ga0501279_003545_221_1108 293
95 3300005337 Ga0070682_100016914 Ga0070682_1000169141 294
96 3300005530 Ga0070679_100036542 Ga0070679_1000365422 294
97 3300005539 Ga0068853_100311404 Ga0068853_1003114042 294
98 3300005563 Ga0068855_100077197 Ga0068855_1000771974 294
99 3300005616 Ga0068852_100019025 Ga0068852_1000190253 294
100 3300009174 Ga0105241_10007907 Ga0105241_100079075 294
101 3300010375 Ga0105239_10014733 Ga0105239_100147337 294
102 3300025911 Ga0207654_10015243 Ga0207654_100152432 294
103 3300025912 Ga0207707_10108169 Ga0207707_101081692 294
104 3300026078 Ga0207702_10093862 Ga0207702_100938622 294
105 3300026142 Ga0207698_10090996 Ga0207698_100909962 294
106 iso_pu_bacteria 2738541278 2738726452 294
107 iso_pu_bacteria 2883068021 2883072673 295
108 iso_pu_bacteria 2896085136 2896087836 295
109 iso_pu_bacteria 2896109856 2896112440 295
110 3300005338 Ga0068868_100004208 Ga0068868_1000042083 297
111 3300005354 Ga0070675_100128955 Ga0070675_1001289552 297
112 3300005364 Ga0070673_100103867 Ga0070673_1001038671 297
113 3300005367 Ga0070667_100329277 Ga0070667_1003292771 297
114 3300005459 Ga0068867_100066710 Ga0068867_1000667102 297
115 3300005564 Ga0070664_100164031 Ga0070664_1001640312 297
116 3300005616 Ga0068852_100030690 Ga0068852_1000306904 297
117 3300005842 Ga0068858_100324300 Ga0068858_1003243002 297
118 3300006881 Ga0068865_100358562 Ga0068865_1003585621 297
119 3300009098 Ga0105245_10825443 Ga0105245_108254431 297
120 3300013296 Ga0157374_10497550 Ga0157374_104975501 297
121 3300013297 Ga0157378_10025960 Ga0157378_100259606 297
122 3300013306 Ga0163162_10002326 Ga0163162_1000232618 297
123 3300025926 Ga0207659_10127291 Ga0207659_101272912 297
124 3300025942 Ga0207689_10095066 Ga0207689_100950663 297
125 3300025945 Ga0207679_10048992 Ga0207679_100489924 297
126 3300026023 Ga0207677_10035021 Ga0207677_100350212 297
127 3300026089 Ga0207648_10210907 Ga0207648_102109072 297
128 3300003316 rootH1_10150810 rootH1_101508101 298
129 3300005328 Ga0070676_10021838 Ga0070676_100218384 298
130 3300005328 Ga0070676_10067586 Ga0070676_100675862 298
131 3300005328 Ga0070676_10115694 Ga0070676_101156942 298
132 3300005328 Ga0070676_10141338 Ga0070676_101413381 298
133 3300005329 Ga0070683_100000416 Ga0070683_10000041619 298
134 3300005329 Ga0070683_100000862 Ga0070683_10000086218 298
135 3300005331 Ga0070670_100064158 Ga0070670_1000641584 298
136 3300005334 Ga0068869_100027540 Ga0068869_1000275404 298
137 3300005334 Ga0068869_100061815 Ga0068869_1000618152 298
138 3300005334 Ga0068869_100072233 Ga0068869_1000722332 298
139 3300005334 Ga0068869_100310236 Ga0068869_1003102362 298
140 3300005335 Ga0070666_10008440 Ga0070666_100084404 298
141 3300005335 Ga0070666_10043338 Ga0070666_100433383 298
142 3300005338 Ga0068868_100027683 Ga0068868_1000276833 298
143 3300005339 Ga0070660_100001251 Ga0070660_10000125111 298
144 3300005340 Ga0070689_100046302 Ga0070689_1000463023 298
145 3300005344 Ga0070661_100001691 Ga0070661_10000169116 298
146 3300005344 Ga0070661_100041644 Ga0070661_1000416442 298
147 3300005344 Ga0070661_100049918 Ga0070661_1000499183 298
148 3300005347 Ga0070668_100046743 Ga0070668_1000467433 298
149 3300005347 Ga0070668_100143155 Ga0070668_1001431552 298
150 3300005353 Ga0070669_100040444 Ga0070669_1000404442 298
151 3300005354 Ga0070675_100027552 Ga0070675_1000275522 298
152 3300005354 Ga0070675_100298551 Ga0070675_1002985512 298
153 3300005355 Ga0070671_100197694 Ga0070671_1001976942 298
154 3300005356 Ga0070674_100003085 Ga0070674_1000030852 298
155 3300005356 Ga0070674_100157030 Ga0070674_1001570302 298
156 3300005364 Ga0070673_100018725 Ga0070673_1000187255 298
157 3300005364 Ga0070673_100197855 Ga0070673_1001978551 298
158 3300005365 Ga0070688_100227275 Ga0070688_1002272752 298
159 3300005367 Ga0070667_100553192 Ga0070667_1005531921 298
160 3300005436 Ga0070713_100059780 Ga0070713_1000597803 298
161 3300005456 Ga0070678_100008598 Ga0070678_1000085985 298
162 3300005457 Ga0070662_100205919 Ga0070662_1002059191 298
163 3300005459 Ga0068867_100120995 Ga0068867_1001209952 298
164 3300005459 Ga0068867_100137042 Ga0068867_1001370422 298
165 3300005459 Ga0068867_100211317 Ga0068867_1002113171 298
166 3300005535 Ga0070684_100010866 Ga0070684_1000108668 298
167 3300005535 Ga0070684_100060025 Ga0070684_1000600254 298
168 3300005535 Ga0070684_100132101 Ga0070684_1001321012 298
169 3300005539 Ga0068853_100005622 Ga0068853_1000056227 298
170 3300005539 Ga0068853_100079362 Ga0068853_1000793623 298
171 3300005543 Ga0070672_100018931 Ga0070672_1000189316 298
172 3300005563 Ga0068855_100000630 Ga0068855_10000063031 298
173 3300005563 Ga0068855_100227602 Ga0068855_1002276022 298
174 3300005564 Ga0070664_100009504 Ga0070664_1000095047 298
175 3300005564 Ga0070664_100024924 Ga0070664_1000249245 298
176 3300005564 Ga0070664_100263006 Ga0070664_1002630061 298
177 3300005577 Ga0068857_100029919 Ga0068857_1000299195 298
178 3300005616 Ga0068852_100096705 Ga0068852_1000967051 298
179 3300005616 Ga0068852_100124030 Ga0068852_1001240302 298
180 3300005617 Ga0068859_100020133 Ga0068859_1000201335 298
181 3300005617 Ga0068859_100041535 Ga0068859_1000415355 298
182 3300005617 Ga0068859_100057135 Ga0068859_1000571354 298
183 3300005618 Ga0068864_100012297 Ga0068864_1000122976 298
184 3300005618 Ga0068864_100044037 Ga0068864_1000440372 298
185 3300005718 Ga0068866_10010641 Ga0068866_100106414 298
186 3300005719 Ga0068861_100010694 Ga0068861_1000106942 298
187 3300005719 Ga0068861_100081735 Ga0068861_1000817352 298
188 3300005841 Ga0068863_100436971 Ga0068863_1004369711 298
189 3300005841 Ga0068863_100621024 Ga0068863_1006210241 298
190 3300005843 Ga0068860_100000046 Ga0068860_100000046105 298
191 3300005843 Ga0068860_100012479 Ga0068860_1000124795 298
192 3300005843 Ga0068860_100063896 Ga0068860_1000638961 298
193 3300005844 Ga0068862_100378411 Ga0068862_1003784112 298
194 3300005844 Ga0068862_100683976 Ga0068862_1006839761 298
195 3300006237 Ga0097621_100005734 Ga0097621_1000057346 298
196 3300006237 Ga0097621_100020920 Ga0097621_1000209203 298
197 3300006237 Ga0097621_100120499 Ga0097621_1001204992 298
198 3300006358 Ga0068871_100001400 Ga0068871_1000014004 298
199 3300006881 Ga0068865_100115537 Ga0068865_1001155372 298
200 3300006881 Ga0068865_100210844 Ga0068865_1002108442 298
201 3300006914 Ga0075436_100191241 Ga0075436_1001912412 298
202 3300006931 Ga0097620_100020133 Ga0097620_1000201333 298
203 3300006931 Ga0097620_100041533 Ga0097620_1000415335 298
204 3300006931 Ga0097620_100057136 Ga0097620_1000571364 298
205 3300009094 Ga0111539_10027898 Ga0111539_100278988 298
206 3300009176 Ga0105242_10035863 Ga0105242_100358632 298
207 3300009176 Ga0105242_10081723 Ga0105242_100817233 298
208 3300009176 Ga0105242_10167480 Ga0105242_101674802 298
209 3300009177 Ga0105248_10434615 Ga0105248_104346152 298
210 3300009553 Ga0105249_10000336 Ga0105249_1000033635 298
211 3300009553 Ga0105249_10062091 Ga0105249_100620914 298
212 3300009553 Ga0105249_10077375 Ga0105249_100773754 298
213 3300010375 Ga0105239_10728352 Ga0105239_107283522 298
214 3300011119 Ga0105246_10046348 Ga0105246_100463482 298
215 3300011119 Ga0105246_10096961 Ga0105246_100969612 298
216 3300013100 Ga0157373_10411245 Ga0157373_104112451 298
217 3300013296 Ga0157374_10031789 Ga0157374_100317892 298
218 3300013296 Ga0157374_10261725 Ga0157374_102617252 298
219 3300013297 Ga0157378_10033991 Ga0157378_100339912 298
220 3300013297 Ga0157378_10041279 Ga0157378_100412791 298
221 3300013306 Ga0163162_10540856 Ga0163162_105408562 298
222 3300014325 Ga0163163_10338101 Ga0163163_103381012 298
223 3300014326 Ga0157380_10194326 Ga0157380_101943262 298
224 3300014745 Ga0157377_10010450 Ga0157377_100104502 298
225 3300014968 Ga0157379_10030191 Ga0157379_100301912 298
226 3300014968 Ga0157379_10220949 Ga0157379_102209491 298
227 3300014968 Ga0157379_10279260 Ga0157379_102792602 298
228 3300017792 Ga0163161_10028064 Ga0163161_100280643 298
229 3300025315 Ga0207697_10072834 Ga0207697_100728341 298
230 3300025901 Ga0207688_10010428 Ga0207688_100104282 298
231 3300025901 Ga0207688_10010984 Ga0207688_100109842 298
232 3300025903 Ga0207680_10090125 Ga0207680_100901251 298
233 3300025903 Ga0207680_10127486 Ga0207680_101274862 298
234 3300025903 Ga0207680_10258231 Ga0207680_102582311 298
235 3300025907 Ga0207645_10000354 Ga0207645_1000035434 298
236 3300025907 Ga0207645_10007158 Ga0207645_100071585 298
237 3300025907 Ga0207645_10160915 Ga0207645_101609152 298
238 3300025907 Ga0207645_10212118 Ga0207645_102121181 298
239 3300025908 Ga0207643_10003608 Ga0207643_100036082 298
240 3300025911 Ga0207654_10240283 Ga0207654_102402831 298
241 3300025913 Ga0207695_10000110 Ga0207695_10000110178 298
242 3300025919 Ga0207657_10022885 Ga0207657_100228854 298
243 3300025920 Ga0207649_10024736 Ga0207649_100247365 298
244 3300025920 Ga0207649_10130932 Ga0207649_101309322 298
245 3300025923 Ga0207681_10174592 Ga0207681_101745923 298
246 3300025923 Ga0207681_10382595 Ga0207681_103825951 298
247 3300025926 Ga0207659_10263654 Ga0207659_102636542 298
248 3300025931 Ga0207644_10111448 Ga0207644_101114482 298
249 3300025931 Ga0207644_10129579 Ga0207644_101295792 298
250 3300025933 Ga0207706_10306261 Ga0207706_103062611 298
251 3300025934 Ga0207686_10278279 Ga0207686_102782792 298
252 3300025936 Ga0207670_10040599 Ga0207670_100405992 298
253 3300025937 Ga0207669_10188217 Ga0207669_101882171 298
254 3300025940 Ga0207691_10008243 Ga0207691_100082436 298
255 3300025940 Ga0207691_10063145 Ga0207691_100631452 298
256 3300025942 Ga0207689_10003402 Ga0207689_100034024 298
257 3300025942 Ga0207689_10010556 Ga0207689_100105568 298
258 3300025942 Ga0207689_10028309 Ga0207689_100283092 298
259 3300025942 Ga0207689_10039159 Ga0207689_100391593 298
260 3300025944 Ga0207661_10000927 Ga0207661_1000092717 298
261 3300025944 Ga0207661_10017050 Ga0207661_100170506 298
262 3300025945 Ga0207679_10012298 Ga0207679_100122982 298
263 3300025945 Ga0207679_10174640 Ga0207679_101746402 298
264 3300025945 Ga0207679_10355117 Ga0207679_103551172 298
265 3300025949 Ga0207667_10000700 Ga0207667_100007004 298
266 3300025960 Ga0207651_10029346 Ga0207651_100293462 298
267 3300025961 Ga0207712_10011962 Ga0207712_100119625 298
268 3300025961 Ga0207712_10031978 Ga0207712_100319785 298
269 3300025961 Ga0207712_10128949 Ga0207712_101289492 298
270 3300025972 Ga0207668_10206746 Ga0207668_102067462 298
271 3300025972 Ga0207668_10493100 Ga0207668_104931001 298
272 3300025986 Ga0207658_10072894 Ga0207658_100728943 298
273 3300025986 Ga0207658_10112399 Ga0207658_101123992 298
274 3300025986 Ga0207658_10243111 Ga0207658_102431112 298
275 3300026023 Ga0207677_10165535 Ga0207677_101655352 298
276 3300026035 Ga0207703_10342658 Ga0207703_103426582 298
277 3300026041 Ga0207639_10010461 Ga0207639_100104612 298
278 3300026041 Ga0207639_10159449 Ga0207639_101594492 298
279 3300026088 Ga0207641_10282834 Ga0207641_102828342 298
280 3300026089 Ga0207648_10000404 Ga0207648_1000040439 298
281 3300026089 Ga0207648_10006809 Ga0207648_1000680910 298
282 3300026095 Ga0207676_10203869 Ga0207676_102038692 298
283 3300026116 Ga0207674_10002719 Ga0207674_1000271920 298
284 3300026116 Ga0207674_10396486 Ga0207674_103964862 298
285 3300026118 Ga0207675_100136473 Ga0207675_1001364733 298
286 3300026118 Ga0207675_100637145 Ga0207675_1006371451 298
287 3300026121 Ga0207683_10021738 Ga0207683_100217383 298
288 3300026142 Ga0207698_10031580 Ga0207698_100315805 298
289 3300027907 Ga0207428_10374460 Ga0207428_103744601 298
290 3300028379 Ga0268266_10115106 Ga0268266_101151062 298
291 3300028380 Ga0268265_10073544 Ga0268265_100735442 298
292 3300028381 Ga0268264_10000041 Ga0268264_10000041222 298
293 3300031852 Ga0307410_10079004 Ga0307410_100790042 298
294 3300044658 Ga0466972_0028475 Ga0466972_0028475_66_962 298
295 3300044719 Ga0466971_0083026 Ga0466971_0083026_94_990 298
296 3300044842 Ga0466957_0012368 Ga0466957_0012368_324_1220 298
297 3300046471 Ga0495650_0033545 Ga0495650_0033545_1087_1998 298
298 3300046616 Ga0495668_0001941 Ga0495668_0001941_11498_12397 298
299 3300048913 Ga0496110_0039739 Ga0496110_0039739_2659_3582 298
300 3300048913 Ga0496110_0514358 Ga0496110_0514358_138_1055 298
301 3300049568 Ga0501031_0003126 Ga0501031_0003126_47_943 298
302 3300049572 Ga0501036_0018517 Ga0501036_0018517_4850_5746 298
303 3300049574 Ga0501038_0006153 Ga0501038_0006153_6140_7114 298
304 3300049588 Ga0501072_0154018 Ga0501072_0154018_869_1765 298
305 3300049589 Ga0501073_0351667 Ga0501073_0351667_81_977 298
306 3300049656 Ga0501209_051941 Ga0501209_051941_23_919 298
307 3300049823 Ga0501044_0008339 Ga0501044_0008339_8991_9965 298
308 3300053727 Ga0500611_000028 Ga0500611_000028_24661_25557 298
309 3300002459 JGI24751J29686_10003924 JGI24751J29686_100039242 299
310 3300003323 rootH1_10005105 rootH1_1000510517 299
311 3300003323 rootH1_10188737 rootH1_101887372 299
312 3300005327 Ga0070658_10122562 Ga0070658_101225622 299
313 3300005331 Ga0070670_100077525 Ga0070670_1000775252 299
314 3300005331 Ga0070670_100096076 Ga0070670_1000960762 299
315 3300005333 Ga0070677_10014063 Ga0070677_100140631 299
316 3300005334 Ga0068869_100027065 Ga0068869_1000270652 299
317 3300005336 Ga0070680_100015814 Ga0070680_1000158144 299
318 3300005336 Ga0070680_100053596 Ga0070680_1000535962 299
319 3300005337 Ga0070682_100036556 Ga0070682_1000365561 299
320 3300005338 Ga0068868_100001540 Ga0068868_1000015407 299
321 3300005339 Ga0070660_100027666 Ga0070660_1000276662 299
322 3300005339 Ga0070660_100097607 Ga0070660_1000976071 299
323 3300005343 Ga0070687_100168432 Ga0070687_1001684321 299
324 3300005354 Ga0070675_100229375 Ga0070675_1002293752 299
325 3300005355 Ga0070671_100041177 Ga0070671_1000411772 299
326 3300005355 Ga0070671_100159034 Ga0070671_1001590341 299
327 3300005366 Ga0070659_100025801 Ga0070659_1000258012 299
328 3300005366 Ga0070659_100210510 Ga0070659_1002105102 299
329 3300005367 Ga0070667_100026896 Ga0070667_1000268963 299
330 3300005441 Ga0070700_100062674 Ga0070700_1000626743 299
331 3300005455 Ga0070663_100133295 Ga0070663_1001332952 299
332 3300005458 Ga0070681_10293747 Ga0070681_102937472 299
333 3300005530 Ga0070679_100003166 Ga0070679_1000031665 299
334 3300005530 Ga0070679_100008640 Ga0070679_10000864010 299
335 3300005530 Ga0070679_100233318 Ga0070679_1002333182 299
336 3300005530 Ga0070679_100321481 Ga0070679_1003214812 299
337 3300005539 Ga0068853_100001585 Ga0068853_1000015852 299
338 3300005539 Ga0068853_100031135 Ga0068853_1000311354 299
339 3300005539 Ga0068853_100209830 Ga0068853_1002098301 299
340 3300005543 Ga0070672_100102005 Ga0070672_1001020052 299
341 3300005543 Ga0070672_100269417 Ga0070672_1002694172 299
342 3300005548 Ga0070665_100229958 Ga0070665_1002299582 299
343 3300005563 Ga0068855_100008628 Ga0068855_1000086282 299
344 3300005563 Ga0068855_100024867 Ga0068855_1000248677 299
345 3300005563 Ga0068855_100038643 Ga0068855_1000386432 299
346 3300005563 Ga0068855_100114206 Ga0068855_1001142062 299
347 3300005563 Ga0068855_100748844 Ga0068855_1007488441 299
348 3300005577 Ga0068857_100052605 Ga0068857_1000526053 299
349 3300005577 Ga0068857_100266087 Ga0068857_1002660872 299
350 3300005578 Ga0068854_100032094 Ga0068854_1000320944 299
351 3300005614 Ga0068856_100027858 Ga0068856_1000278584 299
352 3300005614 Ga0068856_100094037 Ga0068856_1000940373 299
353 3300005614 Ga0068856_100351643 Ga0068856_1003516431 299
354 3300005616 Ga0068852_100004122 Ga0068852_1000041229 299
355 3300005616 Ga0068852_100164427 Ga0068852_1001644272 299
356 3300005616 Ga0068852_100358872 Ga0068852_1003588722 299
357 3300005617 Ga0068859_100280449 Ga0068859_1002804492 299
358 3300005617 Ga0068859_100854078 Ga0068859_1008540781 299
359 3300005618 Ga0068864_100071732 Ga0068864_1000717323 299
360 3300005618 Ga0068864_100307092 Ga0068864_1003070921 299
361 3300005841 Ga0068863_100002125 Ga0068863_10000212518 299
362 3300005843 Ga0068860_100007815 Ga0068860_1000078155 299
363 3300005843 Ga0068860_100020187 Ga0068860_1000201875 299
364 3300005844 Ga0068862_100008092 Ga0068862_1000080929 299
365 3300006195 Ga0075366_10044041 Ga0075366_100440412 299
366 3300006195 Ga0075366_10044467 Ga0075366_100444672 299
367 3300006195 Ga0075366_10044732 Ga0075366_100447322 299
368 3300006358 Ga0068871_100132921 Ga0068871_1001329213 299
369 3300006847 Ga0075431_100089555 Ga0075431_1000895552 299
370 3300006931 Ga0097620_100280441 Ga0097620_1002804412 299
371 3300006931 Ga0097620_100854109 Ga0097620_1008541091 299
372 3300009093 Ga0105240_10002716 Ga0105240_100027164 299
373 3300009093 Ga0105240_10002823 Ga0105240_1000282325 299
374 3300009093 Ga0105240_10112572 Ga0105240_101125723 299
375 3300009093 Ga0105240_10293984 Ga0105240_102939842 299
376 3300009093 Ga0105240_10327078 Ga0105240_103270782 299
377 3300009093 Ga0105240_10601691 Ga0105240_106016911 299
378 3300009101 Ga0105247_10229417 Ga0105247_102294171 299
379 3300009147 Ga0114129_10022075 Ga0114129_100220758 299
380 3300009174 Ga0105241_10137005 Ga0105241_101370052 299
381 3300009545 Ga0105237_10020194 Ga0105237_100201943 299
382 3300009545 Ga0105237_10435858 Ga0105237_104358581 299
383 3300009551 Ga0105238_10136112 Ga0105238_101361123 299
384 3300009553 Ga0105249_10002924 Ga0105249_1000292412 299
385 3300010375 Ga0105239_10008174 Ga0105239_100081742 299
386 3300010375 Ga0105239_10035221 Ga0105239_100352212 299
387 3300010375 Ga0105239_10203614 Ga0105239_102036143 299
388 3300011119 Ga0105246_10241185 Ga0105246_102411852 299
389 3300013100 Ga0157373_10001885 Ga0157373_1000188511 299
390 3300013100 Ga0157373_10022711 Ga0157373_100227115 299
391 3300013102 Ga0157371_10001002 Ga0157371_1000100231 299
392 3300013102 Ga0157371_10002977 Ga0157371_1000297712 299
393 3300013102 Ga0157371_10004296 Ga0157371_100042964 299
394 3300013102 Ga0157371_10006866 Ga0157371_100068667 299
395 3300013102 Ga0157371_10006988 Ga0157371_100069888 299
396 3300013102 Ga0157371_10014226 Ga0157371_100142262 299
397 3300013102 Ga0157371_10014774 Ga0157371_100147745 299
398 3300013102 Ga0157371_10029414 Ga0157371_100294142 299
399 3300013102 Ga0157371_10047724 Ga0157371_100477242 299
400 3300013102 Ga0157371_10197804 Ga0157371_101978042 299
401 3300013104 Ga0157370_10004047 Ga0157370_100040476 299
402 3300013104 Ga0157370_10054899 Ga0157370_100548992 299
403 3300013104 Ga0157370_10231376 Ga0157370_102313762 299
404 3300013105 Ga0157369_10018160 Ga0157369_100181602 299
405 3300013105 Ga0157369_10080099 Ga0157369_100800991 299
406 3300013296 Ga0157374_10040796 Ga0157374_100407962 299
407 3300013296 Ga0157374_10390963 Ga0157374_103909631 299
408 3300013297 Ga0157378_10002969 Ga0157378_1000296913 299
409 3300013297 Ga0157378_10293679 Ga0157378_102936791 299
410 3300013306 Ga0163162_10353766 Ga0163162_103537662 299
411 3300013307 Ga0157372_10054066 Ga0157372_100540666 299
412 3300013307 Ga0157372_10080094 Ga0157372_100800942 299
413 3300013307 Ga0157372_10227461 Ga0157372_102274611 299
414 3300013307 Ga0157372_10307524 Ga0157372_103075242 299
415 3300013307 Ga0157372_10778967 Ga0157372_107789671 299
416 3300013308 Ga0157375_10399131 Ga0157375_103991312 299
417 3300014325 Ga0163163_10035920 Ga0163163_100359202 299
418 3300014325 Ga0163163_10112099 Ga0163163_101120993 299
419 3300014326 Ga0157380_10107218 Ga0157380_101072182 299
420 3300014968 Ga0157379_10188186 Ga0157379_101881862 299
421 3300015261 Ga0182006_1005135 Ga0182006_10051354 299
422 3300017792 Ga0163161_10203979 Ga0163161_102039792 299
423 3300025246 Ga0209646_1001411 Ga0209646_10014116 299
424 3300025904 Ga0207647_10022060 Ga0207647_100220604 299
425 3300025904 Ga0207647_10041934 Ga0207647_100419342 299
426 3300025909 Ga0207705_10002745 Ga0207705_100027454 299
427 3300025912 Ga0207707_10251310 Ga0207707_102513102 299
428 3300025913 Ga0207695_10000023 Ga0207695_1000002334 299
429 3300025913 Ga0207695_10000229 Ga0207695_10000229107 299
430 3300025913 Ga0207695_10016531 Ga0207695_100165317 299
431 3300025913 Ga0207695_10267368 Ga0207695_102673682 299
432 3300025914 Ga0207671_10406374 Ga0207671_104063741 299
433 3300025917 Ga0207660_10006958 Ga0207660_100069584 299
434 3300025917 Ga0207660_10036076 Ga0207660_100360764 299
435 3300025919 Ga0207657_10032463 Ga0207657_100324633 299
436 3300025919 Ga0207657_10042465 Ga0207657_100424653 299
437 3300025919 Ga0207657_10092792 Ga0207657_100927921 299
438 3300025919 Ga0207657_10343784 Ga0207657_103437841 299
439 3300025921 Ga0207652_10000181 Ga0207652_1000018160 299
440 3300025921 Ga0207652_10004884 Ga0207652_100048849 299
441 3300025921 Ga0207652_10009180 Ga0207652_100091806 299
442 3300025925 Ga0207650_10003002 Ga0207650_100030028 299
443 3300025925 Ga0207650_10196085 Ga0207650_101960852 299
444 3300025929 Ga0207664_10201931 Ga0207664_102019312 299
445 3300025931 Ga0207644_10021217 Ga0207644_100212172 299
446 3300025932 Ga0207690_10255171 Ga0207690_102551711 299
447 3300025933 Ga0207706_10386944 Ga0207706_103869441 299
448 3300025940 Ga0207691_10003925 Ga0207691_1000392510 299
449 3300025940 Ga0207691_10037067 Ga0207691_100370672 299
450 3300025940 Ga0207691_10089598 Ga0207691_100895983 299
451 3300025949 Ga0207667_10002784 Ga0207667_1000278411 299
452 3300025949 Ga0207667_10021765 Ga0207667_100217656 299
453 3300025949 Ga0207667_10024649 Ga0207667_100246496 299
454 3300025960 Ga0207651_10383278 Ga0207651_103832782 299
455 3300025961 Ga0207712_10030807 Ga0207712_100308075 299
456 3300025981 Ga0207640_10093442 Ga0207640_100934422 299
457 3300025981 Ga0207640_10350103 Ga0207640_103501032 299
458 3300025981 Ga0207640_10503965 Ga0207640_105039651 299
459 3300025986 Ga0207658_10267122 Ga0207658_102671222 299
460 3300026023 Ga0207677_10010001 Ga0207677_100100011 299
461 3300026035 Ga0207703_10404726 Ga0207703_104047261 299
462 3300026041 Ga0207639_10043200 Ga0207639_100432002 299
463 3300026075 Ga0207708_10115057 Ga0207708_101150572 299
464 3300026078 Ga0207702_10078915 Ga0207702_100789153 299
465 3300026078 Ga0207702_10111484 Ga0207702_101114842 299
466 3300026078 Ga0207702_10567416 Ga0207702_105674161 299
467 3300026088 Ga0207641_10160035 Ga0207641_101600352 299
468 3300026095 Ga0207676_10022185 Ga0207676_100221852 299
469 3300026116 Ga0207674_10048243 Ga0207674_100482434 299
470 3300026116 Ga0207674_10055019 Ga0207674_100550192 299
471 3300026142 Ga0207698_10332943 Ga0207698_103329431 299
472 3300028379 Ga0268266_10220049 Ga0268266_102200492 299
473 3300028381 Ga0268264_10003143 Ga0268264_1000314310 299
474 3300028381 Ga0268264_10010550 Ga0268264_100105505 299
475 3300028381 Ga0268264_10018981 Ga0268264_100189812 299
476 3300028794 Ga0307515_10000039 Ga0307515_10000039159 299
477 3300031251 Ga0265327_10085600 Ga0265327_100856002 299
478 3300031456 Ga0307513_10033861 Ga0307513_100338611 299
479 3300031456 Ga0307513_10035308 Ga0307513_100353084 299
480 3300031456 Ga0307513_10280517 Ga0307513_102805171 299
481 3300031507 Ga0307509_10116319 Ga0307509_101163192 299
482 3300031903 Ga0307407_10114337 Ga0307407_101143372 299
483 3300033180 Ga0307510_10000805 Ga0307510_1000080510 299
484 3300037312 Ga0395899_0023691 Ga0395899_0023691_2599_3516 299
485 3300037312 Ga0395899_0033036 Ga0395899_0033036_832_1740 299
486 3300037312 Ga0395899_0059292 Ga0395899_0059292_647_1555 299
487 3300037418 Ga0395900_0007567 Ga0395900_0007567_3229_4146 299
488 3300037418 Ga0395900_0017877 Ga0395900_0017877_4454_5371 299
489 3300037418 Ga0395900_0040292 Ga0395900_0040292_2209_3117 299
490 3300037418 Ga0395900_0082623 Ga0395900_0082623_2031_2948 299
491 3300037418 Ga0395900_0268260 Ga0395900_0268260_355_1272 299
492 3300037466 Ga0395898_0001381 Ga0395898_0001381_4895_5812 299
493 3300037466 Ga0395898_0003360 Ga0395898_0003360_14567_15475 299
494 3300037466 Ga0395898_0042155 Ga0395898_0042155_2653_3570 299
495 3300037466 Ga0395898_0154572 Ga0395898_0154572_298_1206 299
496 3300037471 Ga0395905_0103398 Ga0395905_0103398_389_1297 299
497 3300038443 Ga0395901_0012942 Ga0395901_0012942_6442_7359 299
498 3300038443 Ga0395901_0041303 Ga0395901_0041303_1130_2038 299
499 3300041404 Ga0439436_0009107 Ga0439436_0009107_193_1092 299
500 3300041406 Ga0439439_0013442 Ga0439439_0013442_662_1561 299
501 3300041456 Ga0451795_0953208 Ga0451795_0953208_619_1518 299
502 3300041512 Ga0451853_2186550 Ga0451853_2186550_35_934 299
503 3300042014 Ga0439457_000707 Ga0439457_000707_2679_3578 299
504 3300042876 Ga0451577_0311814 Ga0451577_0311814_348_1247 299
505 3300044656 Ga0466969_0000182 Ga0466969_0000182_30607_31506 299
506 3300044658 Ga0466972_0003013 Ga0466972_0003013_7003_7908 299
507 3300044658 Ga0466972_0020761 Ga0466972_0020761_2333_3238 299
508 3300044683 Ga0466965_0176656 Ga0466965_0176656_91_990 299
509 3300044684 Ga0466966_0002356 Ga0466966_0002356_10793_11692 299
510 3300044712 Ga0453684_0190650 Ga0453684_0190650_745_1656 299
511 3300044735 Ga0466968_0021860 Ga0466968_0021860_28_930 299
512 3300044735 Ga0466968_0159273 Ga0466968_0159273_63_962 299
513 3300044842 Ga0466957_0033803 Ga0466957_0033803_2029_2934 299
514 3300045049 Ga0466959_0000056 Ga0466959_0000056_32363_33262 299
515 3300046519 Ga0495632_0074992 Ga0495632_0074992_551_1450 299
516 3300046616 Ga0495668_0076915 Ga0495668_0076915_327_1226 299
517 3300047472 Ga0495686_0000004 Ga0495686_0000004_481447_482346 299
518 3300049570 Ga0501033_0209318 Ga0501033_0209318_59_958 299
519 3300049571 Ga0501034_0168910 Ga0501034_0168910_471_1370 299
520 3300049573 Ga0501037_0187002 Ga0501037_0187002_309_1208 299
521 3300049579 Ga0501043_0238588 Ga0501043_0238588_88_987 299
522 3300049581 Ga0501047_0056300 Ga0501047_0056300_152_1051 299
523 3300049582 Ga0501048_0151809 Ga0501048_0151809_35_934 299
524 3300049586 Ga0501070_0033866 Ga0501070_0033866_346_1245 299
525 3300049705 Ga0501225_0004929 Ga0501225_0004929_964_1863 299
526 3300049822 Ga0501035_0028141 Ga0501035_0028141_122_1021 299
527 3300049823 Ga0501044_0037968 Ga0501044_0037968_2237_3136 299
528 3300049823 Ga0501044_0063747 Ga0501044_0063747_1657_2556 299
529 3300049823 Ga0501044_0264558 Ga0501044_0264558_470_1369 299
530 3300050493 nmdc:mga0k408_4024_c1 nmdc:mga0k408_4024_c1_6036_6935 299
531 3300050493 nmdc:mga0k408_73834_c1 nmdc:mga0k408_73834_c1_235_1134 299
532 3300050507 nmdc:mga05p37_16027_c1 nmdc:mga05p37_16027_c1_5566_6465 299
533 3300053086 Ga0500578_0000150 Ga0500578_0000150_70583_71488 299
534 3300053086 Ga0500578_0184274 Ga0500578_0184274_53_958 299
535 3300053092 Ga0500583_0009104 Ga0500583_0009104_2638_3537 299
536 3300053098 Ga0500650_0099596 Ga0500650_0099596_301_1200 299
537 3300053142 Ga0500577_0089424 Ga0500577_0089424_291_1190 299
538 3300053146 Ga0500588_0025343 Ga0500588_0025343_714_1613 299
539 3300053147 Ga0500589_040460 Ga0500589_040460_1082_1981 299
540 3300053727 Ga0500611_016148 Ga0500611_016148_161_1060 299
541 3300001979 JGI24740J21852_10000984 JGI24740J21852_100009842 300
542 3300001989 JGI24739J22299_10007020 JGI24739J22299_100070202 300
543 3300001989 JGI24739J22299_10018624 JGI24739J22299_100186242 300
544 3300003316 rootH1_10098359 rootH1_100983591 300
545 3300003322 rootL2_10058361 rootL2_100583613 300
546 3300003322 rootL2_10058370 rootL2_100583704 300
547 3300005290 Ga0065712_10079131 Ga0065712_100791312 300
548 3300005339 Ga0070660_100176151 Ga0070660_1001761511 300
549 3300005366 Ga0070659_100030941 Ga0070659_1000309412 300
550 3300013105 Ga0157369_10214197 Ga0157369_102141972 300
551 3300025904 Ga0207647_10006531 Ga0207647_100065318 300
552 3300025932 Ga0207690_10071566 Ga0207690_100715662 300
553 3300041406 Ga0439439_0026591 Ga0439439_0026591_325_1227 300
554 3300049653 Ga0501206_003258 Ga0501206_003258_957_1865 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

28

291

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnn-assembly1.cif.gz_A the crystal structure of a glycosyltransferase from porphyromonas gingivalis w83 0.9484 1 298
3pnn-assembly1.cif.gz_A the crystal structure of a glycosyltransferase from porphyromonas gingivalis w83 0.9392 1 298
5z0a-assembly1.cif.gz_E-2 st0452(y97n)-glcnac binding form 0.8263 4 284
6t37-assembly2.cif.gz_C-3 pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.7947 2 293
6tqg-assembly1.cif.gz_D pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.7862 4 293
ID Description Score Start End Superfamily
3pnnA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9463 1 298 3.90.550.10
3pnnA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9401 1 298 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7984 4 272 3.90.550.10
4jd0A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7969 2 289 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.796 1 292 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V5PCX8-F1-model_v4 Nucleotidyltransferase 0.9832 1 300
AF-A0A2T5C410-F1-model_v4 Nucleotidyltransferase-like protein 0.9831 1 299 GO:0009058
GO:0016779
AF-A0A6C0GHB8-F1-model_v4 Nucleotidyltransferase 0.9829 1 300 GO:0009058
GO:0016740
AF-A0A7X7Y0R1-F1-model_v4 Nucleotidyltransferase 0.9801 1 300 GO:0009058
GO:0016779
AF-A0A2T5C410-F1-model_v4 Nucleotidyltransferase-like protein 0.9799 1 299 GO:0009058
GO:0016779

Feature Viewer

pLDDT pTM Quality
90.73 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map