F462979
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 554 | 236 | 550 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10137005|Ga0105241_101370052 |
| Length | 323 |
| Sequence | MHNVFCSTTLFYIFVPTKKNKPMQQPTLLILAAGMASRYGSMKQIQSFGPGGETIMDYSIYDAIRAGFKKVVFIIRKEFAADFQEIFEPKLKGRVAIDYVYQDLHAFTDGFQVPADRTKPWGTAHAILCAKNAINEPFAVINADDFYGRDAFEKAYEFLTTDCGPKLYSIIGYELLKTLSDNGTVNRGVCQVDAKGNLTAIAERINLSMQKGKIMVDDNQEPKELPLETSVSMNFWCFAPSIFPYTEKLFHTFISKNLSNPKAEFFIPIVADEFISKGDGAIKVIPTSAQWFGVTYKEDAPGVKASLDELVKAGEYPARLWPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 3 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 4 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 166 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 167 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 171 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 190 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 191 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 192 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 193 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 208 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 210 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 211 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 212 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 213 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 216 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 219 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 221 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 225 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 226 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 228 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 229 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 230 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 231 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 232 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 233 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 234 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 235 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 236 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.25 |
| Nodule | 0 |
| Rhizoplane | 0.54 |
| Rhizosphere | 92.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000984 | 3300001979 | Bacteria | 12737 |
| 2 | JGI24739J22299_10007020 | 3300001989 | Bacteria | 4241 |
| 3 | JGI24739J22299_10018624 | 3300001989 | Bacteria | 2493 |
| 4 | JGI24751J29686_10003924 | 3300002459 | Bacteria | 3004 |
| 5 | rootH1_10098359 | 3300003316 | Bacteria | 2579 |
| 6 | rootH1_10150810 | 3300003316 | Bacteria | 2899 |
| 7 | rootL2_10058361 | 3300003322 | Bacteria | 4028 |
| 8 | rootL2_10058370 | 3300003322 | Bacteria | 4139 |
| 9 | rootH1_10005105 | 3300003323 | Bacteria | 17579 |
| 10 | rootH1_10188737 | 3300003323 | Bacteria | 2065 |
| 11 | Ga0065714_10070747 | 3300005288 | Bacteria | 3775 |
| 12 | Ga0065712_10079131 | 3300005290 | Bacteria | 3255 |
| 13 | Ga0070658_10077419 | 3300005327 | Unclassified | 2728 |
| 14 | Ga0070658_10122562 | 3300005327 | Bacteria | 2161 |
| 15 | Ga0070676_10021838 | 3300005328 | Bacteria | 3585 |
| 16 | Ga0070676_10067586 | 3300005328 | Bacteria | 2137 |
| 17 | Ga0070676_10115694 | 3300005328 | Bacteria | 1676 |
| 18 | Ga0070676_10141338 | 3300005328 | Unclassified | 1533 |
| 19 | Ga0070683_100000416 | 3300005329 | Bacteria | 29488 |
| 20 | Ga0070683_100000862 | 3300005329 | Bacteria | 22425 |
| 21 | Ga0070670_100034153 | 3300005331 | Bacteria | 4378 |
| 22 | Ga0070670_100064158 | 3300005331 | Bacteria | 3152 |
| 23 | Ga0070670_100077525 | 3300005331 | Bacteria | 2855 |
| 24 | Ga0070670_100096076 | 3300005331 | Bacteria | 2549 |
| 25 | Ga0070677_10014063 | 3300005333 | Bacteria | 2810 |
| 26 | Ga0068869_100027065 | 3300005334 | Bacteria | 3995 |
| 27 | Ga0068869_100027540 | 3300005334 | Bacteria | 3963 |
| 28 | Ga0068869_100061722 | 3300005334 | Unclassified | 2750 |
| 29 | Ga0068869_100061815 | 3300005334 | Unclassified | 2748 |
| 30 | Ga0068869_100072233 | 3300005334 | Unclassified | 2557 |
| 31 | Ga0068869_100310236 | 3300005334 | Bacteria | 1277 |
| 32 | Ga0070666_10000028 | 3300005335 | Bacteria | 144796 |
| 33 | Ga0070666_10008440 | 3300005335 | Bacteria | 6397 |
| 34 | Ga0070666_10043338 | 3300005335 | Unclassified | 3013 |
| 35 | Ga0070680_100015814 | 3300005336 | Bacteria | 5923 |
| 36 | Ga0070680_100053596 | 3300005336 | Bacteria | 3293 |
| 37 | Ga0070682_100016914 | 3300005337 | Bacteria | 4244 |
| 38 | Ga0070682_100036556 | 3300005337 | Bacteria | 3003 |
| 39 | Ga0068868_100001540 | 3300005338 | Bacteria | 15748 |
| 40 | Ga0068868_100004208 | 3300005338 | Bacteria | 10068 |
| 41 | Ga0068868_100027683 | 3300005338 | Unclassified | 4325 |
| 42 | Ga0070660_100001251 | 3300005339 | Bacteria | 17279 |
| 43 | Ga0070660_100027666 | 3300005339 | Bacteria | 4234 |
| 44 | Ga0070660_100097607 | 3300005339 | Bacteria | 2324 |
| 45 | Ga0070660_100176151 | 3300005339 | Bacteria | 1730 |
| 46 | Ga0070689_100046302 | 3300005340 | Unclassified | 3351 |
| 47 | Ga0070687_100168432 | 3300005343 | Bacteria | 1302 |
| 48 | Ga0070661_100001691 | 3300005344 | Bacteria | 15284 |
| 49 | Ga0070661_100041644 | 3300005344 | Bacteria | 3351 |
| 50 | Ga0070661_100049918 | 3300005344 | Bacteria | 3063 |
| 51 | Ga0070668_100046743 | 3300005347 | Bacteria | 3325 |
| 52 | Ga0070668_100143155 | 3300005347 | Bacteria | 1928 |
| 53 | Ga0070668_100144280 | 3300005347 | Bacteria | 1920 |
| 54 | Ga0070669_100040444 | 3300005353 | Unclassified | 3389 |
| 55 | Ga0070675_100027552 | 3300005354 | Unclassified | 4566 |
| 56 | Ga0070675_100128955 | 3300005354 | Bacteria | 2154 |
| 57 | Ga0070675_100229375 | 3300005354 | Bacteria | 1619 |
| 58 | Ga0070675_100298551 | 3300005354 | Unclassified | 1419 |
| 59 | Ga0070671_100041177 | 3300005355 | Unclassified | 3839 |
| 60 | Ga0070671_100159034 | 3300005355 | Unclassified | 1909 |
| 61 | Ga0070671_100197694 | 3300005355 | Bacteria | 1705 |
| 62 | Ga0070671_100410165 | 3300005355 | Unclassified | 1160 |
| 63 | Ga0070674_100003085 | 3300005356 | Bacteria | 9270 |
| 64 | Ga0070674_100157030 | 3300005356 | Bacteria | 1722 |
| 65 | Ga0070673_100018725 | 3300005364 | Bacteria | 4955 |
| 66 | Ga0070673_100103867 | 3300005364 | Bacteria | 2345 |
| 67 | Ga0070673_100197855 | 3300005364 | Unclassified | 1730 |
| 68 | Ga0070688_100227275 | 3300005365 | Unclassified | 1318 |
| 69 | Ga0070659_100025801 | 3300005366 | Bacteria | 4519 |
| 70 | Ga0070659_100030941 | 3300005366 | Bacteria | 4143 |
| 71 | Ga0070659_100210510 | 3300005366 | Bacteria | 1602 |
| 72 | Ga0070667_100026896 | 3300005367 | Bacteria | 4787 |
| 73 | Ga0070667_100329277 | 3300005367 | Bacteria | 1380 |
| 74 | Ga0070667_100553192 | 3300005367 | Bacteria | 1058 |
| 75 | Ga0070713_100059780 | 3300005436 | Bacteria | 3184 |
| 76 | Ga0070700_100062674 | 3300005441 | Bacteria | 2350 |
| 77 | Ga0070663_100133295 | 3300005455 | Bacteria | 1889 |
| 78 | Ga0070678_100008598 | 3300005456 | Bacteria | 6121 |
| 79 | Ga0070662_100205919 | 3300005457 | Unclassified | 1563 |
| 80 | Ga0070681_10293253 | 3300005458 | Bacteria | 1536 |
| 81 | Ga0070681_10293747 | 3300005458 | Bacteria | 1535 |
| 82 | Ga0068867_100066710 | 3300005459 | Bacteria | 2681 |
| 83 | Ga0068867_100120995 | 3300005459 | Unclassified | 2023 |
| 84 | Ga0068867_100137042 | 3300005459 | Unclassified | 1909 |
| 85 | Ga0068867_100211317 | 3300005459 | Bacteria | 1558 |
| 86 | Ga0068867_100343155 | 3300005459 | Bacteria | 1244 |
| 87 | Ga0070679_100003166 | 3300005530 | Bacteria | 15042 |
| 88 | Ga0070679_100008640 | 3300005530 | Bacteria | 9598 |
| 89 | Ga0070679_100036542 | 3300005530 | Bacteria | 4874 |
| 90 | Ga0070679_100233318 | 3300005530 | Unclassified | 1799 |
| 91 | Ga0070679_100321481 | 3300005530 | Bacteria | 1497 |
| 92 | Ga0070684_100010866 | 3300005535 | Bacteria | 7235 |
| 93 | Ga0070684_100060025 | 3300005535 | Bacteria | 3325 |
| 94 | Ga0070684_100132101 | 3300005535 | Unclassified | 2252 |
| 95 | Ga0068853_100001585 | 3300005539 | Bacteria | 16590 |
| 96 | Ga0068853_100005622 | 3300005539 | Bacteria | 9849 |
| 97 | Ga0068853_100031135 | 3300005539 | Bacteria | 4512 |
| 98 | Ga0068853_100079362 | 3300005539 | Bacteria | 2870 |
| 99 | Ga0068853_100089002 | 3300005539 | Unclassified | 2711 |
| 100 | Ga0068853_100209830 | 3300005539 | Bacteria | 1775 |
| 101 | Ga0068853_100311404 | 3300005539 | Bacteria | 1457 |
| 102 | Ga0070672_100018931 | 3300005543 | Bacteria | 4988 |
| 103 | Ga0070672_100102005 | 3300005543 | Unclassified | 2328 |
| 104 | Ga0070672_100269417 | 3300005543 | Bacteria | 1437 |
| 105 | Ga0070665_100229958 | 3300005548 | Bacteria | 1854 |
| 106 | Ga0068855_100000630 | 3300005563 | Bacteria | 43230 |
| 107 | Ga0068855_100008628 | 3300005563 | Bacteria | 12313 |
| 108 | Ga0068855_100024867 | 3300005563 | Bacteria | 7166 |
| 109 | Ga0068855_100038643 | 3300005563 | Bacteria | 5670 |
| 110 | Ga0068855_100077197 | 3300005563 | Bacteria | 3864 |
| 111 | Ga0068855_100114206 | 3300005563 | Bacteria | 3096 |
| 112 | Ga0068855_100227602 | 3300005563 | Bacteria | 2089 |
| 113 | Ga0068855_100748844 | 3300005563 | Bacteria | 1042 |
| 114 | Ga0070664_100009504 | 3300005564 | Bacteria | 7883 |
| 115 | Ga0070664_100024924 | 3300005564 | Bacteria | 4956 |
| 116 | Ga0070664_100164031 | 3300005564 | Bacteria | 1968 |
| 117 | Ga0070664_100263006 | 3300005564 | Bacteria | 1553 |
| 118 | Ga0068857_100029919 | 3300005577 | Bacteria | 4806 |
| 119 | Ga0068857_100052605 | 3300005577 | Bacteria | 3613 |
| 120 | Ga0068857_100266087 | 3300005577 | Bacteria | 1575 |
| 121 | Ga0068854_100032094 | 3300005578 | Bacteria | 3652 |
| 122 | Ga0068856_100027858 | 3300005614 | Bacteria | 5512 |
| 123 | Ga0068856_100094037 | 3300005614 | Bacteria | 2984 |
| 124 | Ga0068856_100351643 | 3300005614 | Bacteria | 1492 |
| 125 | Ga0068852_100004122 | 3300005616 | Bacteria | 10232 |
| 126 | Ga0068852_100004976 | 3300005616 | Bacteria | 9451 |
| 127 | Ga0068852_100019025 | 3300005616 | Bacteria | 5426 |
| 128 | Ga0068852_100030690 | 3300005616 | Bacteria | 4428 |
| 129 | Ga0068852_100096705 | 3300005616 | Bacteria | 2655 |
| 130 | Ga0068852_100124030 | 3300005616 | Bacteria | 2369 |
| 131 | Ga0068852_100164427 | 3300005616 | Bacteria | 2075 |
| 132 | Ga0068852_100358872 | 3300005616 | Bacteria | 1425 |
| 133 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 134 | Ga0068859_100008213 | 3300005617 | Bacteria | 10591 |
| 135 | Ga0068859_100020133 | 3300005617 | Bacteria | 6699 |
| 136 | Ga0068859_100041535 | 3300005617 | Unclassified | 4619 |
| 137 | Ga0068859_100057135 | 3300005617 | Bacteria | 3931 |
| 138 | Ga0068859_100280449 | 3300005617 | Unclassified | 1759 |
| 139 | Ga0068859_100854078 | 3300005617 | Unclassified | 996 |
| 140 | Ga0068864_100007973 | 3300005618 | Bacteria | 8728 |
| 141 | Ga0068864_100012297 | 3300005618 | Bacteria | 7074 |
| 142 | Ga0068864_100044037 | 3300005618 | Bacteria | 3823 |
| 143 | Ga0068864_100071732 | 3300005618 | Bacteria | 3017 |
| 144 | Ga0068864_100307092 | 3300005618 | Bacteria | 1486 |
| 145 | Ga0068866_10010641 | 3300005718 | Bacteria | 3951 |
| 146 | Ga0068861_100010694 | 3300005719 | Bacteria | 6376 |
| 147 | Ga0068861_100081735 | 3300005719 | Bacteria | 2530 |
| 148 | Ga0068851_10046804 | 3300005834 | Bacteria | 2189 |
| 149 | Ga0068863_100002125 | 3300005841 | Bacteria | 19657 |
| 150 | Ga0068863_100009422 | 3300005841 | Bacteria | 9532 |
| 151 | Ga0068863_100436971 | 3300005841 | Bacteria | 1283 |
| 152 | Ga0068863_100621024 | 3300005841 | Bacteria | 1071 |
| 153 | Ga0068858_100004702 | 3300005842 | Bacteria | 13379 |
| 154 | Ga0068858_100324300 | 3300005842 | Bacteria | 1472 |
| 155 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 156 | Ga0068860_100007815 | 3300005843 | Bacteria | 10678 |
| 157 | Ga0068860_100012479 | 3300005843 | Bacteria | 8368 |
| 158 | Ga0068860_100020187 | 3300005843 | Bacteria | 6457 |
| 159 | Ga0068860_100063896 | 3300005843 | Bacteria | 3496 |
| 160 | Ga0068862_100008092 | 3300005844 | Bacteria | 8701 |
| 161 | Ga0068862_100378411 | 3300005844 | Unclassified | 1320 |
| 162 | Ga0068862_100683976 | 3300005844 | Unclassified | 992 |
| 163 | Ga0075366_10044041 | 3300006195 | Bacteria | 2645 |
| 164 | Ga0075366_10044467 | 3300006195 | Bacteria | 2632 |
| 165 | Ga0075366_10044732 | 3300006195 | Bacteria | 2624 |
| 166 | Ga0097621_100005734 | 3300006237 | Bacteria | 8764 |
| 167 | Ga0097621_100020920 | 3300006237 | Bacteria | 5049 |
| 168 | Ga0097621_100058596 | 3300006237 | Bacteria | 3150 |
| 169 | Ga0097621_100120499 | 3300006237 | Unclassified | 2225 |
| 170 | Ga0097621_100179577 | 3300006237 | Bacteria | 1828 |
| 171 | Ga0068871_100001400 | 3300006358 | Bacteria | 16139 |
| 172 | Ga0068871_100003922 | 3300006358 | Bacteria | 10260 |
| 173 | Ga0068871_100132921 | 3300006358 | Unclassified | 2111 |
| 174 | Ga0075431_100089555 | 3300006847 | Unclassified | 3176 |
| 175 | Ga0068865_100115537 | 3300006881 | Bacteria | 1986 |
| 176 | Ga0068865_100210844 | 3300006881 | Unclassified | 1514 |
| 177 | Ga0068865_100358562 | 3300006881 | Bacteria | 1183 |
| 178 | Ga0075436_100191241 | 3300006914 | Bacteria | 1448 |
| 179 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 180 | Ga0097620_100008213 | 3300006931 | Bacteria | 10591 |
| 181 | Ga0097620_100020133 | 3300006931 | Bacteria | 6699 |
| 182 | Ga0097620_100041533 | 3300006931 | Unclassified | 4619 |
| 183 | Ga0097620_100057136 | 3300006931 | Bacteria | 3931 |
| 184 | Ga0097620_100280441 | 3300006931 | Unclassified | 1759 |
| 185 | Ga0097620_100854109 | 3300006931 | Unclassified | 996 |
| 186 | Ga0105240_10001517 | 3300009093 | Bacteria | 39516 |
| 187 | Ga0105240_10002716 | 3300009093 | Bacteria | 28079 |
| 188 | Ga0105240_10002823 | 3300009093 | Bacteria | 27474 |
| 189 | Ga0105240_10092646 | 3300009093 | Bacteria | 3689 |
| 190 | Ga0105240_10112572 | 3300009093 | Unclassified | 3290 |
| 191 | Ga0105240_10293984 | 3300009093 | Bacteria | 1861 |
| 192 | Ga0105240_10327078 | 3300009093 | Bacteria | 1745 |
| 193 | Ga0105240_10601691 | 3300009093 | Bacteria | 1210 |
| 194 | Ga0111539_10027898 | 3300009094 | Bacteria | 6894 |
| 195 | Ga0111539_10032122 | 3300009094 | Bacteria | 6377 |
| 196 | Ga0105245_10825443 | 3300009098 | Bacteria | 966 |
| 197 | Ga0105247_10089800 | 3300009101 | Unclassified | 1949 |
| 198 | Ga0105247_10229417 | 3300009101 | Unclassified | 1260 |
| 199 | Ga0114129_10022075 | 3300009147 | Bacteria | 9032 |
| 200 | Ga0105241_10000619 | 3300009174 | Bacteria | 26737 |
| 201 | Ga0105241_10007907 | 3300009174 | Bacteria | 7818 |
| 202 | Ga0105241_10137005 | 3300009174 | Bacteria | 1989 |
| 203 | Ga0105242_10035863 | 3300009176 | Bacteria | 3977 |
| 204 | Ga0105242_10081723 | 3300009176 | Bacteria | 2702 |
| 205 | Ga0105242_10167480 | 3300009176 | Unclassified | 1928 |
| 206 | Ga0105248_10434615 | 3300009177 | Bacteria | 1478 |
| 207 | Ga0105237_10007560 | 3300009545 | Bacteria | 11876 |
| 208 | Ga0105237_10020194 | 3300009545 | Bacteria | 6875 |
| 209 | Ga0105237_10041432 | 3300009545 | Bacteria | 4644 |
| 210 | Ga0105237_10052578 | 3300009545 | Bacteria | 4088 |
| 211 | Ga0105237_10435858 | 3300009545 | Unclassified | 1316 |
| 212 | Ga0105238_10136112 | 3300009551 | Unclassified | 2434 |
| 213 | Ga0105249_10000336 | 3300009553 | Bacteria | 47472 |
| 214 | Ga0105249_10002924 | 3300009553 | Bacteria | 14735 |
| 215 | Ga0105249_10029128 | 3300009553 | Bacteria | 4986 |
| 216 | Ga0105249_10062091 | 3300009553 | Bacteria | 3430 |
| 217 | Ga0105249_10077375 | 3300009553 | Bacteria | 3085 |
| 218 | Ga0105239_10008174 | 3300010375 | Bacteria | 11935 |
| 219 | Ga0105239_10014733 | 3300010375 | Bacteria | 8672 |
| 220 | Ga0105239_10035221 | 3300010375 | Bacteria | 5498 |
| 221 | Ga0105239_10203614 | 3300010375 | Bacteria | 2217 |
| 222 | Ga0105239_10728352 | 3300010375 | Unclassified | 1135 |
| 223 | Ga0105246_10046348 | 3300011119 | Bacteria | 2965 |
| 224 | Ga0105246_10096961 | 3300011119 | Bacteria | 2138 |
| 225 | Ga0105246_10241185 | 3300011119 | Bacteria | 1429 |
| 226 | Ga0157373_10001885 | 3300013100 | Bacteria | 15908 |
| 227 | Ga0157373_10022711 | 3300013100 | Bacteria | 4550 |
| 228 | Ga0157373_10188601 | 3300013100 | Bacteria | 1453 |
| 229 | Ga0157373_10411245 | 3300013100 | Unclassified | 970 |
| 230 | Ga0157371_10001002 | 3300013102 | Bacteria | 31205 |
| 231 | Ga0157371_10002977 | 3300013102 | Bacteria | 15723 |
| 232 | Ga0157371_10004296 | 3300013102 | Bacteria | 12506 |
| 233 | Ga0157371_10006866 | 3300013102 | Bacteria | 9293 |
| 234 | Ga0157371_10006988 | 3300013102 | Bacteria | 9187 |
| 235 | Ga0157371_10014226 | 3300013102 | Bacteria | 6016 |
| 236 | Ga0157371_10014774 | 3300013102 | Bacteria | 5878 |
| 237 | Ga0157371_10029414 | 3300013102 | Bacteria | 3974 |
| 238 | Ga0157371_10047724 | 3300013102 | Bacteria | 3045 |
| 239 | Ga0157371_10086943 | 3300013102 | Bacteria | 2214 |
| 240 | Ga0157371_10197804 | 3300013102 | Unclassified | 1440 |
| 241 | Ga0157370_10004047 | 3300013104 | Bacteria | 17017 |
| 242 | Ga0157370_10054899 | 3300013104 | Bacteria | 3797 |
| 243 | Ga0157370_10231376 | 3300013104 | Bacteria | 1711 |
| 244 | Ga0157369_10009715 | 3300013105 | Bacteria | 11003 |
| 245 | Ga0157369_10018160 | 3300013105 | Bacteria | 7889 |
| 246 | Ga0157369_10080099 | 3300013105 | Bacteria | 3497 |
| 247 | Ga0157369_10095435 | 3300013105 | Bacteria | 3173 |
| 248 | Ga0157369_10214197 | 3300013105 | Bacteria | 2018 |
| 249 | Ga0157374_10031789 | 3300013296 | Bacteria | 4801 |
| 250 | Ga0157374_10040796 | 3300013296 | Bacteria | 4276 |
| 251 | Ga0157374_10261725 | 3300013296 | Bacteria | 1704 |
| 252 | Ga0157374_10390963 | 3300013296 | Bacteria | 1386 |
| 253 | Ga0157374_10497550 | 3300013296 | Bacteria | 1223 |
| 254 | Ga0157378_10002969 | 3300013297 | Bacteria | 15088 |
| 255 | Ga0157378_10025960 | 3300013297 | Bacteria | 5162 |
| 256 | Ga0157378_10033991 | 3300013297 | Bacteria | 4509 |
| 257 | Ga0157378_10041279 | 3300013297 | Bacteria | 4092 |
| 258 | Ga0157378_10083364 | 3300013297 | Bacteria | 2893 |
| 259 | Ga0157378_10202627 | 3300013297 | Bacteria | 1877 |
| 260 | Ga0157378_10293679 | 3300013297 | Unclassified | 1571 |
| 261 | Ga0163162_10002326 | 3300013306 | Bacteria | 17832 |
| 262 | Ga0163162_10017671 | 3300013306 | Bacteria | 6978 |
| 263 | Ga0163162_10050840 | 3300013306 | Bacteria | 4157 |
| 264 | Ga0163162_10353766 | 3300013306 | Bacteria | 1601 |
| 265 | Ga0163162_10540856 | 3300013306 | Unclassified | 1293 |
| 266 | Ga0157372_10054066 | 3300013307 | Bacteria | 4477 |
| 267 | Ga0157372_10080094 | 3300013307 | Bacteria | 3695 |
| 268 | Ga0157372_10110017 | 3300013307 | Bacteria | 3156 |
| 269 | Ga0157372_10139008 | 3300013307 | Bacteria | 2797 |
| 270 | Ga0157372_10227461 | 3300013307 | Bacteria | 2162 |
| 271 | Ga0157372_10307524 | 3300013307 | Unclassified | 1845 |
| 272 | Ga0157372_10778967 | 3300013307 | Bacteria | 1112 |
| 273 | Ga0157375_10399131 | 3300013308 | Bacteria | 1542 |
| 274 | Ga0163163_10035920 | 3300014325 | Bacteria | 4811 |
| 275 | Ga0163163_10112099 | 3300014325 | Bacteria | 2757 |
| 276 | Ga0163163_10338101 | 3300014325 | Unclassified | 1561 |
| 277 | Ga0157380_10107218 | 3300014326 | Bacteria | 2339 |
| 278 | Ga0157380_10194326 | 3300014326 | Bacteria | 1794 |
| 279 | Ga0157377_10010450 | 3300014745 | Bacteria | 4592 |
| 280 | Ga0157379_10030191 | 3300014968 | Unclassified | 4823 |
| 281 | Ga0157379_10054417 | 3300014968 | Bacteria | 3575 |
| 282 | Ga0157379_10188186 | 3300014968 | Bacteria | 1866 |
| 283 | Ga0157379_10220949 | 3300014968 | Bacteria | 1717 |
| 284 | Ga0157379_10279260 | 3300014968 | Unclassified | 1520 |
| 285 | Ga0182006_1005135 | 3300015261 | Bacteria | 6289 |
| 286 | Ga0163161_10028064 | 3300017792 | Bacteria | 3995 |
| 287 | Ga0163161_10203979 | 3300017792 | Bacteria | 1525 |
| 288 | Ga0209646_1001411 | 3300025246 | Bacteria | 6524 |
| 289 | Ga0207697_10072834 | 3300025315 | Bacteria | 1441 |
| 290 | Ga0207710_10086013 | 3300025900 | Bacteria | 1465 |
| 291 | Ga0207688_10010428 | 3300025901 | Bacteria | 5058 |
| 292 | Ga0207688_10010984 | 3300025901 | Bacteria | 4926 |
| 293 | Ga0207680_10003326 | 3300025903 | Bacteria | 7574 |
| 294 | Ga0207680_10090125 | 3300025903 | Bacteria | 1948 |
| 295 | Ga0207680_10127486 | 3300025903 | Unclassified | 1673 |
| 296 | Ga0207680_10258231 | 3300025903 | Unclassified | 1205 |
| 297 | Ga0207647_10006531 | 3300025904 | Bacteria | 8473 |
| 298 | Ga0207647_10022060 | 3300025904 | Bacteria | 4236 |
| 299 | Ga0207647_10041934 | 3300025904 | Bacteria | 2874 |
| 300 | Ga0207645_10000354 | 3300025907 | Bacteria | 38157 |
| 301 | Ga0207645_10007158 | 3300025907 | Bacteria | 7912 |
| 302 | Ga0207645_10160915 | 3300025907 | Unclassified | 1469 |
| 303 | Ga0207645_10212118 | 3300025907 | Bacteria | 1276 |
| 304 | Ga0207643_10003608 | 3300025908 | Bacteria | 8342 |
| 305 | Ga0207705_10002745 | 3300025909 | Bacteria | 13489 |
| 306 | Ga0207705_10131875 | 3300025909 | Bacteria | 1860 |
| 307 | Ga0207654_10000479 | 3300025911 | Bacteria | 22913 |
| 308 | Ga0207654_10015243 | 3300025911 | Bacteria | 3985 |
| 309 | Ga0207654_10240283 | 3300025911 | Bacteria | 1210 |
| 310 | Ga0207707_10108169 | 3300025912 | Bacteria | 2431 |
| 311 | Ga0207707_10251310 | 3300025912 | Bacteria | 1536 |
| 312 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 313 | Ga0207695_10000110 | 3300025913 | Bacteria | 250079 |
| 314 | Ga0207695_10000229 | 3300025913 | Bacteria | 149313 |
| 315 | Ga0207695_10009361 | 3300025913 | Bacteria | 12113 |
| 316 | Ga0207695_10016531 | 3300025913 | Bacteria | 8626 |
| 317 | Ga0207695_10267368 | 3300025913 | Bacteria | 1606 |
| 318 | Ga0207671_10005924 | 3300025914 | Bacteria | 11082 |
| 319 | Ga0207671_10048967 | 3300025914 | Unclassified | 3127 |
| 320 | Ga0207671_10225275 | 3300025914 | Bacteria | 1470 |
| 321 | Ga0207671_10406374 | 3300025914 | Bacteria | 1083 |
| 322 | Ga0207660_10006958 | 3300025917 | Bacteria | 7325 |
| 323 | Ga0207660_10036076 | 3300025917 | Unclassified | 3436 |
| 324 | Ga0207657_10022885 | 3300025919 | Bacteria | 5832 |
| 325 | Ga0207657_10032463 | 3300025919 | Bacteria | 4717 |
| 326 | Ga0207657_10042465 | 3300025919 | Unclassified | 4012 |
| 327 | Ga0207657_10092792 | 3300025919 | Bacteria | 2516 |
| 328 | Ga0207657_10343784 | 3300025919 | Bacteria | 1177 |
| 329 | Ga0207649_10024736 | 3300025920 | Bacteria | 3494 |
| 330 | Ga0207649_10130932 | 3300025920 | Bacteria | 1703 |
| 331 | Ga0207652_10000181 | 3300025921 | Bacteria | 66711 |
| 332 | Ga0207652_10004884 | 3300025921 | Bacteria | 10845 |
| 333 | Ga0207652_10009180 | 3300025921 | Bacteria | 7960 |
| 334 | Ga0207681_10174592 | 3300025923 | Bacteria | 1632 |
| 335 | Ga0207681_10382595 | 3300025923 | Unclassified | 1133 |
| 336 | Ga0207650_10003002 | 3300025925 | Bacteria | 11627 |
| 337 | Ga0207650_10196085 | 3300025925 | Bacteria | 1615 |
| 338 | Ga0207659_10127291 | 3300025926 | Bacteria | 1961 |
| 339 | Ga0207659_10263654 | 3300025926 | Unclassified | 1403 |
| 340 | Ga0207664_10201931 | 3300025929 | Bacteria | 1716 |
| 341 | Ga0207644_10021217 | 3300025931 | Bacteria | 4422 |
| 342 | Ga0207644_10111448 | 3300025931 | Unclassified | 2070 |
| 343 | Ga0207644_10129579 | 3300025931 | Unclassified | 1930 |
| 344 | Ga0207690_10071566 | 3300025932 | Bacteria | 2392 |
| 345 | Ga0207690_10255171 | 3300025932 | Bacteria | 1356 |
| 346 | Ga0207706_10306261 | 3300025933 | Bacteria | 1384 |
| 347 | Ga0207706_10386944 | 3300025933 | Unclassified | 1213 |
| 348 | Ga0207686_10278279 | 3300025934 | Bacteria | 1234 |
| 349 | Ga0207670_10040599 | 3300025936 | Bacteria | 3054 |
| 350 | Ga0207669_10188217 | 3300025937 | Bacteria | 1486 |
| 351 | Ga0207704_10090892 | 3300025938 | Bacteria | 2005 |
| 352 | Ga0207691_10003925 | 3300025940 | Bacteria | 14448 |
| 353 | Ga0207691_10008243 | 3300025940 | Bacteria | 10005 |
| 354 | Ga0207691_10037067 | 3300025940 | Bacteria | 4516 |
| 355 | Ga0207691_10063145 | 3300025940 | Unclassified | 3360 |
| 356 | Ga0207691_10089598 | 3300025940 | Unclassified | 2758 |
| 357 | Ga0207689_10001630 | 3300025942 | Bacteria | 21256 |
| 358 | Ga0207689_10003402 | 3300025942 | Bacteria | 14529 |
| 359 | Ga0207689_10010556 | 3300025942 | Bacteria | 7952 |
| 360 | Ga0207689_10028309 | 3300025942 | Bacteria | 4688 |
| 361 | Ga0207689_10039159 | 3300025942 | Unclassified | 3925 |
| 362 | Ga0207689_10095066 | 3300025942 | Bacteria | 2447 |
| 363 | Ga0207661_10000927 | 3300025944 | Bacteria | 19231 |
| 364 | Ga0207661_10017050 | 3300025944 | Bacteria | 5366 |
| 365 | Ga0207679_10012298 | 3300025945 | Bacteria | 5577 |
| 366 | Ga0207679_10048992 | 3300025945 | Bacteria | 3079 |
| 367 | Ga0207679_10174640 | 3300025945 | Unclassified | 1772 |
| 368 | Ga0207679_10355117 | 3300025945 | Bacteria | 1279 |
| 369 | Ga0207667_10000700 | 3300025949 | Bacteria | 43461 |
| 370 | Ga0207667_10002784 | 3300025949 | Bacteria | 21649 |
| 371 | Ga0207667_10021765 | 3300025949 | Bacteria | 7101 |
| 372 | Ga0207667_10024649 | 3300025949 | Bacteria | 6601 |
| 373 | Ga0207651_10029346 | 3300025960 | Bacteria | 3484 |
| 374 | Ga0207651_10383278 | 3300025960 | Bacteria | 1192 |
| 375 | Ga0207712_10011962 | 3300025961 | Bacteria | 5537 |
| 376 | Ga0207712_10030807 | 3300025961 | Bacteria | 3608 |
| 377 | Ga0207712_10031978 | 3300025961 | Bacteria | 3548 |
| 378 | Ga0207712_10044454 | 3300025961 | Bacteria | 3070 |
| 379 | Ga0207712_10128949 | 3300025961 | Bacteria | 1924 |
| 380 | Ga0207668_10206746 | 3300025972 | Bacteria | 1567 |
| 381 | Ga0207668_10493100 | 3300025972 | Bacteria | 1052 |
| 382 | Ga0207640_10093442 | 3300025981 | Bacteria | 2090 |
| 383 | Ga0207640_10350103 | 3300025981 | Bacteria | 1187 |
| 384 | Ga0207640_10503965 | 3300025981 | Bacteria | 1009 |
| 385 | Ga0207658_10072894 | 3300025986 | Unclassified | 2605 |
| 386 | Ga0207658_10112399 | 3300025986 | Bacteria | 2156 |
| 387 | Ga0207658_10227509 | 3300025986 | Bacteria | 1572 |
| 388 | Ga0207658_10243111 | 3300025986 | Unclassified | 1526 |
| 389 | Ga0207658_10267122 | 3300025986 | Unclassified | 1460 |
| 390 | Ga0207677_10010001 | 3300026023 | Bacteria | 5353 |
| 391 | Ga0207677_10035021 | 3300026023 | Bacteria | 3256 |
| 392 | Ga0207677_10119562 | 3300026023 | Unclassified | 1979 |
| 393 | Ga0207677_10165535 | 3300026023 | Unclassified | 1723 |
| 394 | Ga0207703_10004584 | 3300026035 | Bacteria | 11320 |
| 395 | Ga0207703_10342658 | 3300026035 | Unclassified | 1374 |
| 396 | Ga0207703_10404726 | 3300026035 | Unclassified | 1267 |
| 397 | Ga0207639_10010461 | 3300026041 | Bacteria | 6427 |
| 398 | Ga0207639_10043200 | 3300026041 | Unclassified | 3382 |
| 399 | Ga0207639_10051489 | 3300026041 | Bacteria | 3132 |
| 400 | Ga0207639_10159449 | 3300026041 | Unclassified | 1900 |
| 401 | Ga0207708_10115057 | 3300026075 | Bacteria | 2091 |
| 402 | Ga0207702_10078915 | 3300026078 | Bacteria | 2851 |
| 403 | Ga0207702_10093862 | 3300026078 | Bacteria | 2632 |
| 404 | Ga0207702_10111484 | 3300026078 | Bacteria | 2433 |
| 405 | Ga0207702_10567416 | 3300026078 | Bacteria | 1111 |
| 406 | Ga0207641_10000152 | 3300026088 | Bacteria | 98311 |
| 407 | Ga0207641_10160035 | 3300026088 | Unclassified | 2046 |
| 408 | Ga0207641_10282834 | 3300026088 | Bacteria | 1561 |
| 409 | Ga0207648_10000404 | 3300026089 | Bacteria | 48036 |
| 410 | Ga0207648_10006809 | 3300026089 | Bacteria | 11325 |
| 411 | Ga0207648_10210907 | 3300026089 | Unclassified | 1724 |
| 412 | Ga0207676_10022185 | 3300026095 | Bacteria | 4668 |
| 413 | Ga0207676_10042904 | 3300026095 | Bacteria | 3479 |
| 414 | Ga0207676_10203869 | 3300026095 | Unclassified | 1749 |
| 415 | Ga0207674_10002719 | 3300026116 | Bacteria | 22062 |
| 416 | Ga0207674_10048243 | 3300026116 | Bacteria | 4359 |
| 417 | Ga0207674_10055019 | 3300026116 | Bacteria | 4049 |
| 418 | Ga0207674_10396486 | 3300026116 | Bacteria | 1334 |
| 419 | Ga0207675_100136473 | 3300026118 | Bacteria | 2328 |
| 420 | Ga0207675_100637145 | 3300026118 | Unclassified | 1071 |
| 421 | Ga0207683_10021738 | 3300026121 | Bacteria | 5499 |
| 422 | Ga0207698_10012749 | 3300026142 | Bacteria | 5517 |
| 423 | Ga0207698_10031580 | 3300026142 | Bacteria | 3825 |
| 424 | Ga0207698_10090996 | 3300026142 | Bacteria | 2496 |
| 425 | Ga0207698_10332943 | 3300026142 | Bacteria | 1427 |
| 426 | Ga0207428_10374460 | 3300027907 | Bacteria | 1045 |
| 427 | Ga0268266_10115106 | 3300028379 | Unclassified | 2387 |
| 428 | Ga0268266_10220049 | 3300028379 | Bacteria | 1745 |
| 429 | Ga0268265_10073544 | 3300028380 | Bacteria | 2670 |
| 430 | Ga0268265_10312303 | 3300028380 | Bacteria | 1420 |
| 431 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 432 | Ga0268264_10003143 | 3300028381 | Bacteria | 14302 |
| 433 | Ga0268264_10010550 | 3300028381 | Bacteria | 7639 |
| 434 | Ga0268264_10018981 | 3300028381 | Bacteria | 5622 |
| 435 | Ga0307515_10000039 | 3300028794 | Bacteria | 323229 |
| 436 | Ga0265327_10085600 | 3300031251 | Bacteria | 1548 |
| 437 | Ga0307513_10033861 | 3300031456 | Bacteria | 5738 |
| 438 | Ga0307513_10035308 | 3300031456 | Bacteria | 5595 |
| 439 | Ga0307513_10280517 | 3300031456 | Bacteria | 1444 |
| 440 | Ga0307509_10116319 | 3300031507 | Bacteria | 2664 |
| 441 | Ga0307509_10121713 | 3300031507 | Bacteria | 2586 |
| 442 | Ga0307516_10000577 | 3300031730 | Bacteria | 49482 |
| 443 | Ga0307516_10048490 | 3300031730 | Bacteria | 4179 |
| 444 | Ga0307410_10079004 | 3300031852 | Bacteria | 2304 |
| 445 | Ga0307407_10114337 | 3300031903 | Unclassified | 1700 |
| 446 | Ga0307510_10000805 | 3300033180 | Bacteria | 32598 |
| 447 | Ga0395899_0023691 | 3300037312 | Bacteria | 4646 |
| 448 | Ga0395899_0033036 | 3300037312 | Bacteria | 3887 |
| 449 | Ga0395899_0059292 | 3300037312 | Bacteria | 2821 |
| 450 | Ga0395900_0007567 | 3300037418 | Bacteria | 11217 |
| 451 | Ga0395900_0017877 | 3300037418 | Bacteria | 7237 |
| 452 | Ga0395900_0040292 | 3300037418 | Bacteria | 4813 |
| 453 | Ga0395900_0082623 | 3300037418 | Bacteria | 3300 |
| 454 | Ga0395900_0268260 | 3300037418 | Bacteria | 1702 |
| 455 | Ga0395898_0001381 | 3300037466 | Bacteria | 34756 |
| 456 | Ga0395898_0003360 | 3300037466 | Bacteria | 17943 |
| 457 | Ga0395898_0042155 | 3300037466 | Bacteria | 4505 |
| 458 | Ga0395898_0154572 | 3300037466 | Bacteria | 2194 |
| 459 | Ga0395905_0103398 | 3300037471 | Bacteria | 2674 |
| 460 | Ga0395901_0012942 | 3300038443 | Bacteria | 8465 |
| 461 | Ga0395901_0041303 | 3300038443 | Bacteria | 4779 |
| 462 | Ga0439436_0009107 | 3300041404 | Bacteria | 3045 |
| 463 | Ga0439439_0013442 | 3300041406 | Bacteria | 1984 |
| 464 | Ga0439439_0026591 | 3300041406 | Bacteria | 1459 |
| 465 | Ga0451795_0953208 | 3300041456 | Bacteria | 1861 |
| 466 | Ga0451843_0685672 | 3300041509 | Bacteria | 1507 |
| 467 | Ga0451853_2186550 | 3300041512 | Bacteria | 961 |
| 468 | Ga0439449_0017974 | 3300042007 | Bacteria | 2654 |
| 469 | Ga0439457_000707 | 3300042014 | Bacteria | 9880 |
| 470 | Ga0439457_014159 | 3300042014 | Bacteria | 1787 |
| 471 | Ga0451577_0311814 | 3300042876 | Unclassified | 1426 |
| 472 | Ga0466969_0000182 | 3300044656 | Bacteria | 33828 |
| 473 | Ga0466972_0003013 | 3300044658 | Bacteria | 8349 |
| 474 | Ga0466972_0020761 | 3300044658 | Bacteria | 3280 |
| 475 | Ga0466972_0028475 | 3300044658 | Unclassified | 2755 |
| 476 | Ga0466965_0176656 | 3300044683 | Bacteria | 1125 |
| 477 | Ga0466966_0002356 | 3300044684 | Bacteria | 12337 |
| 478 | Ga0453684_0190650 | 3300044712 | Bacteria | 2398 |
| 479 | Ga0466971_0083026 | 3300044719 | Bacteria | 1463 |
| 480 | Ga0466968_0021860 | 3300044735 | Bacteria | 2594 |
| 481 | Ga0466968_0159273 | 3300044735 | Bacteria | 1041 |
| 482 | Ga0466957_0012368 | 3300044842 | Bacteria | 4941 |
| 483 | Ga0466957_0033803 | 3300044842 | Bacteria | 3068 |
| 484 | Ga0466959_0000056 | 3300045049 | Bacteria | 78465 |
| 485 | Ga0495638_0023198 | 3300046460 | Bacteria | 4063 |
| 486 | Ga0495650_0033545 | 3300046471 | Bacteria | 2284 |
| 487 | Ga0495632_0074992 | 3300046519 | Bacteria | 1620 |
| 488 | Ga0495632_0117974 | 3300046519 | Unclassified | 1242 |
| 489 | Ga0495648_0001994 | 3300046524 | Bacteria | 19331 |
| 490 | Ga0495668_0001941 | 3300046616 | Bacteria | 18402 |
| 491 | Ga0495668_0076915 | 3300046616 | Bacteria | 1832 |
| 492 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 493 | Ga0496110_0039739 | 3300048913 | Bacteria | 4097 |
| 494 | Ga0496110_0514358 | 3300048913 | Unclassified | 1089 |
| 495 | Ga0501290_002692 | 3300049513 | Unclassified | 2278 |
| 496 | Ga0501296_000745 | 3300049519 | Unclassified | 3230 |
| 497 | Ga0501297_001875 | 3300049520 | Unclassified | 1987 |
| 498 | Ga0501298_001632 | 3300049521 | Unclassified | 3322 |
| 499 | Ga0501299_000376 | 3300049522 | Bacteria | 5270 |
| 500 | Ga0501031_0003126 | 3300049568 | Bacteria | 10612 |
| 501 | Ga0501033_0209318 | 3300049570 | Bacteria | 1391 |
| 502 | Ga0501034_0168910 | 3300049571 | Unclassified | 2155 |
| 503 | Ga0501036_0018517 | 3300049572 | Bacteria | 5837 |
| 504 | Ga0501037_0187002 | 3300049573 | Unclassified | 1467 |
| 505 | Ga0501038_0006153 | 3300049574 | Bacteria | 11107 |
| 506 | Ga0501043_0238588 | 3300049579 | Bacteria | 1403 |
| 507 | Ga0501047_0056300 | 3300049581 | Bacteria | 3802 |
| 508 | Ga0501048_0151809 | 3300049582 | Bacteria | 1639 |
| 509 | Ga0501068_0403905 | 3300049584 | Unclassified | 881 |
| 510 | Ga0501070_0033866 | 3300049586 | Bacteria | 4274 |
| 511 | Ga0501072_0154018 | 3300049588 | Bacteria | 1833 |
| 512 | Ga0501073_0351667 | 3300049589 | Unclassified | 1017 |
| 513 | Ga0501198_000760 | 3300049649 | Unclassified | 4029 |
| 514 | Ga0501201_000177 | 3300049651 | Bacteria | 5604 |
| 515 | Ga0501202_000044 | 3300049652 | Bacteria | 12530 |
| 516 | Ga0501206_003258 | 3300049653 | Unclassified | 2061 |
| 517 | Ga0501209_051941 | 3300049656 | Unclassified | 1121 |
| 518 | Ga0501217_000584 | 3300049661 | Bacteria | 6142 |
| 519 | Ga0501223_001942 | 3300049663 | Bacteria | 4646 |
| 520 | Ga0501224_001879 | 3300049664 | Unclassified | 2835 |
| 521 | Ga0501242_002238 | 3300049674 | Unclassified | 2022 |
| 522 | Ga0501259_000788 | 3300049688 | Bacteria | 5184 |
| 523 | Ga0501261_000428 | 3300049690 | Bacteria | 5494 |
| 524 | Ga0501219_000074 | 3300049703 | Bacteria | 17135 |
| 525 | Ga0501225_0003441 | 3300049705 | Bacteria | 4795 |
| 526 | Ga0501225_0004929 | 3300049705 | Bacteria | 3944 |
| 527 | Ga0501245_000377 | 3300049708 | Bacteria | 5341 |
| 528 | Ga0501279_003545 | 3300049775 | Unclassified | 2035 |
| 529 | Ga0501035_0028141 | 3300049822 | Bacteria | 5133 |
| 530 | Ga0501044_0008339 | 3300049823 | Bacteria | 11357 |
| 531 | Ga0501044_0037968 | 3300049823 | Bacteria | 5032 |
| 532 | Ga0501044_0063747 | 3300049823 | Bacteria | 3764 |
| 533 | Ga0501044_0264558 | 3300049823 | Unclassified | 1657 |
| 534 | Ga0501284_00052 | 3300050005 | Bacteria | 43054 |
| 535 | nmdc:mga0k408_4024_c1 | 3300050493 | Bacteria | 7803 |
| 536 | nmdc:mga0k408_73834_c1 | 3300050493 | Bacteria | 1992 |
| 537 | nmdc:mga05p37_16027_c1 | 3300050507 | Bacteria | 7915 |
| 538 | Ga0500578_0000150 | 3300053086 | Bacteria | 83541 |
| 539 | Ga0500578_0184274 | 3300053086 | Bacteria | 1285 |
| 540 | Ga0500646_0070504 | 3300053090 | Bacteria | 1047 |
| 541 | Ga0500583_0009104 | 3300053092 | Bacteria | 3609 |
| 542 | Ga0500583_0015169 | 3300053092 | Bacteria | 3040 |
| 543 | Ga0500650_0099596 | 3300053098 | Bacteria | 1360 |
| 544 | Ga0500642_0002202 | 3300053130 | Bacteria | 5668 |
| 545 | Ga0500577_0089424 | 3300053142 | Bacteria | 1242 |
| 546 | Ga0500588_0025343 | 3300053146 | Bacteria | 1648 |
| 547 | Ga0500589_040460 | 3300053147 | Bacteria | 2176 |
| 548 | Ga0500622_0000900 | 3300053156 | Bacteria | 25309 |
| 549 | Ga0500611_000028 | 3300053727 | Bacteria | 93696 |
| 550 | Ga0500611_016148 | 3300053727 | Bacteria | 1336 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025900 | Ga0207710_10086013 | Ga0207710_100860131 | 250 |
| 2 | 3300041509 | Ga0451843_0685672 | Ga0451843_0685672_687_1487 | 266 |
| 3 | 3300009094 | Ga0111539_10032122 | Ga0111539_100321222 | 267 |
| 4 | 3300026041 | Ga0207639_10051489 | Ga0207639_100514892 | 267 |
| 5 | 3300046519 | Ga0495632_0117974 | Ga0495632_0117974_27_830 | 267 |
| 6 | 3300005288 | Ga0065714_10070747 | Ga0065714_100707471 | 277 |
| 7 | 3300005331 | Ga0070670_100034153 | Ga0070670_1000341536 | 279 |
| 8 | 3300031507 | Ga0307509_10121713 | Ga0307509_101217132 | 279 |
| 9 | 3300005459 | Ga0068867_100343155 | Ga0068867_1003431551 | 280 |
| 10 | 3300009093 | Ga0105240_10001517 | Ga0105240_1000151710 | 280 |
| 11 | 3300013100 | Ga0157373_10188601 | Ga0157373_101886012 | 280 |
| 12 | 3300013105 | Ga0157369_10009715 | Ga0157369_100097159 | 280 |
| 13 | 3300046460 | Ga0495638_0023198 | Ga0495638_0023198_642_1484 | 280 |
| 14 | 3300046524 | Ga0495648_0001994 | Ga0495648_0001994_9419_10261 | 280 |
| 15 | 3300049584 | Ga0501068_0403905 | Ga0501068_0403905_20_862 | 280 |
| 16 | 3300053130 | Ga0500642_0002202 | Ga0500642_0002202_4324_5166 | 280 |
| 17 | 3300053156 | Ga0500622_0000900 | Ga0500622_0000900_22166_23008 | 280 |
| 18 | 3300053090 | Ga0500646_0070504 | Ga0500646_0070504_19_864 | 281 |
| 19 | 3300005334 | Ga0068869_100061722 | Ga0068869_1000617223 | 282 |
| 20 | 3300005335 | Ga0070666_10000028 | Ga0070666_1000002845 | 282 |
| 21 | 3300005355 | Ga0070671_100410165 | Ga0070671_1004101651 | 282 |
| 22 | 3300005616 | Ga0068852_100004976 | Ga0068852_10000497611 | 282 |
| 23 | 3300005617 | Ga0068859_100000012 | Ga0068859_100000012227 | 282 |
| 24 | 3300005617 | Ga0068859_100008213 | Ga0068859_1000082131 | 282 |
| 25 | 3300005618 | Ga0068864_100007973 | Ga0068864_1000079732 | 282 |
| 26 | 3300005834 | Ga0068851_10046804 | Ga0068851_100468042 | 282 |
| 27 | 3300005841 | Ga0068863_100009422 | Ga0068863_1000094225 | 282 |
| 28 | 3300005842 | Ga0068858_100004702 | Ga0068858_1000047028 | 282 |
| 29 | 3300006237 | Ga0097621_100179577 | Ga0097621_1001795772 | 282 |
| 30 | 3300006931 | Ga0097620_100000012 | Ga0097620_100000012227 | 282 |
| 31 | 3300006931 | Ga0097620_100008213 | Ga0097620_10000821312 | 282 |
| 32 | 3300009101 | Ga0105247_10089800 | Ga0105247_100898001 | 282 |
| 33 | 3300009174 | Ga0105241_10000619 | Ga0105241_100006194 | 282 |
| 34 | 3300009545 | Ga0105237_10007560 | Ga0105237_100075605 | 282 |
| 35 | 3300009553 | Ga0105249_10029128 | Ga0105249_100291285 | 282 |
| 36 | 3300013297 | Ga0157378_10083364 | Ga0157378_100833644 | 282 |
| 37 | 3300013306 | Ga0163162_10050840 | Ga0163162_100508402 | 282 |
| 38 | 3300014968 | Ga0157379_10054417 | Ga0157379_100544172 | 282 |
| 39 | 3300025903 | Ga0207680_10003326 | Ga0207680_100033265 | 282 |
| 40 | 3300025911 | Ga0207654_10000479 | Ga0207654_100004793 | 282 |
| 41 | 3300025914 | Ga0207671_10005924 | Ga0207671_1000592410 | 282 |
| 42 | 3300025942 | Ga0207689_10001630 | Ga0207689_1000163021 | 282 |
| 43 | 3300025961 | Ga0207712_10044454 | Ga0207712_100444541 | 282 |
| 44 | 3300025986 | Ga0207658_10227509 | Ga0207658_102275092 | 282 |
| 45 | 3300026023 | Ga0207677_10119562 | Ga0207677_101195622 | 282 |
| 46 | 3300026035 | Ga0207703_10004584 | Ga0207703_100045844 | 282 |
| 47 | 3300026088 | Ga0207641_10000152 | Ga0207641_1000015212 | 282 |
| 48 | 3300026095 | Ga0207676_10042904 | Ga0207676_100429042 | 282 |
| 49 | 3300026142 | Ga0207698_10012749 | Ga0207698_100127496 | 282 |
| 50 | 3300028380 | Ga0268265_10312303 | Ga0268265_103123032 | 282 |
| 51 | 3300005539 | Ga0068853_100089002 | Ga0068853_1000890022 | 286 |
| 52 | 3300005347 | Ga0070668_100144280 | Ga0070668_1001442802 | 287 |
| 53 | 3300031730 | Ga0307516_10000577 | Ga0307516_1000057728 | 287 |
| 54 | 3300006237 | Ga0097621_100058596 | Ga0097621_1000585964 | 288 |
| 55 | 3300006358 | Ga0068871_100003922 | Ga0068871_1000039222 | 288 |
| 56 | 3300009545 | Ga0105237_10041432 | Ga0105237_100414326 | 288 |
| 57 | 3300013297 | Ga0157378_10202627 | Ga0157378_102026272 | 288 |
| 58 | 3300025914 | Ga0207671_10048967 | Ga0207671_100489674 | 288 |
| 59 | 3300025938 | Ga0207704_10090892 | Ga0207704_100908922 | 288 |
| 60 | 3300049703 | Ga0501219_000074 | Ga0501219_000074_13388_14260 | 290 |
| 61 | 3300050005 | Ga0501284_00052 | Ga0501284_00052_2068_2940 | 290 |
| 62 | 3300005327 | Ga0070658_10077419 | Ga0070658_100774193 | 291 |
| 63 | 3300013307 | Ga0157372_10110017 | Ga0157372_101100172 | 291 |
| 64 | 3300025909 | Ga0207705_10131875 | Ga0207705_101318753 | 291 |
| 65 | 3300013306 | Ga0163162_10017671 | Ga0163162_100176715 | 292 |
| 66 | 3300031730 | Ga0307516_10048490 | Ga0307516_100484903 | 292 |
| 67 | 3300042007 | Ga0439449_0017974 | Ga0439449_0017974_120_998 | 292 |
| 68 | 3300042014 | Ga0439457_014159 | Ga0439457_014159_49_927 | 292 |
| 69 | 3300053092 | Ga0500583_0015169 | Ga0500583_0015169_2151_3029 | 292 |
| 70 | 3300005458 | Ga0070681_10293253 | Ga0070681_102932531 | 293 |
| 71 | 3300009093 | Ga0105240_10092646 | Ga0105240_100926463 | 293 |
| 72 | 3300009545 | Ga0105237_10052578 | Ga0105237_100525781 | 293 |
| 73 | 3300013102 | Ga0157371_10086943 | Ga0157371_100869432 | 293 |
| 74 | 3300013105 | Ga0157369_10095435 | Ga0157369_100954352 | 293 |
| 75 | 3300013307 | Ga0157372_10139008 | Ga0157372_101390082 | 293 |
| 76 | 3300025913 | Ga0207695_10009361 | Ga0207695_100093615 | 293 |
| 77 | 3300025914 | Ga0207671_10225275 | Ga0207671_102252752 | 293 |
| 78 | 3300049513 | Ga0501290_002692 | Ga0501290_002692_639_1526 | 293 |
| 79 | 3300049519 | Ga0501296_000745 | Ga0501296_000745_1651_2538 | 293 |
| 80 | 3300049520 | Ga0501297_001875 | Ga0501297_001875_1077_1964 | 293 |
| 81 | 3300049521 | Ga0501298_001632 | Ga0501298_001632_1373_2260 | 293 |
| 82 | 3300049522 | Ga0501299_000376 | Ga0501299_000376_1799_2686 | 293 |
| 83 | 3300049649 | Ga0501198_000760 | Ga0501198_000760_1827_2714 | 293 |
| 84 | 3300049651 | Ga0501201_000177 | Ga0501201_000177_1798_2685 | 293 |
| 85 | 3300049652 | Ga0501202_000044 | Ga0501202_000044_1171_2058 | 293 |
| 86 | 3300049661 | Ga0501217_000584 | Ga0501217_000584_4440_5327 | 293 |
| 87 | 3300049663 | Ga0501223_001942 | Ga0501223_001942_2608_3495 | 293 |
| 88 | 3300049664 | Ga0501224_001879 | Ga0501224_001879_1436_2323 | 293 |
| 89 | 3300049674 | Ga0501242_002238 | Ga0501242_002238_799_1686 | 293 |
| 90 | 3300049688 | Ga0501259_000788 | Ga0501259_000788_3567_4454 | 293 |
| 91 | 3300049690 | Ga0501261_000428 | Ga0501261_000428_845_1732 | 293 |
| 92 | 3300049705 | Ga0501225_0003441 | Ga0501225_0003441_2984_3871 | 293 |
| 93 | 3300049708 | Ga0501245_000377 | Ga0501245_000377_891_1778 | 293 |
| 94 | 3300049775 | Ga0501279_003545 | Ga0501279_003545_221_1108 | 293 |
| 95 | 3300005337 | Ga0070682_100016914 | Ga0070682_1000169141 | 294 |
| 96 | 3300005530 | Ga0070679_100036542 | Ga0070679_1000365422 | 294 |
| 97 | 3300005539 | Ga0068853_100311404 | Ga0068853_1003114042 | 294 |
| 98 | 3300005563 | Ga0068855_100077197 | Ga0068855_1000771974 | 294 |
| 99 | 3300005616 | Ga0068852_100019025 | Ga0068852_1000190253 | 294 |
| 100 | 3300009174 | Ga0105241_10007907 | Ga0105241_100079075 | 294 |
| 101 | 3300010375 | Ga0105239_10014733 | Ga0105239_100147337 | 294 |
| 102 | 3300025911 | Ga0207654_10015243 | Ga0207654_100152432 | 294 |
| 103 | 3300025912 | Ga0207707_10108169 | Ga0207707_101081692 | 294 |
| 104 | 3300026078 | Ga0207702_10093862 | Ga0207702_100938622 | 294 |
| 105 | 3300026142 | Ga0207698_10090996 | Ga0207698_100909962 | 294 |
| 106 | iso_pu_bacteria | 2738541278 | 2738726452 | 294 |
| 107 | iso_pu_bacteria | 2883068021 | 2883072673 | 295 |
| 108 | iso_pu_bacteria | 2896085136 | 2896087836 | 295 |
| 109 | iso_pu_bacteria | 2896109856 | 2896112440 | 295 |
| 110 | 3300005338 | Ga0068868_100004208 | Ga0068868_1000042083 | 297 |
| 111 | 3300005354 | Ga0070675_100128955 | Ga0070675_1001289552 | 297 |
| 112 | 3300005364 | Ga0070673_100103867 | Ga0070673_1001038671 | 297 |
| 113 | 3300005367 | Ga0070667_100329277 | Ga0070667_1003292771 | 297 |
| 114 | 3300005459 | Ga0068867_100066710 | Ga0068867_1000667102 | 297 |
| 115 | 3300005564 | Ga0070664_100164031 | Ga0070664_1001640312 | 297 |
| 116 | 3300005616 | Ga0068852_100030690 | Ga0068852_1000306904 | 297 |
| 117 | 3300005842 | Ga0068858_100324300 | Ga0068858_1003243002 | 297 |
| 118 | 3300006881 | Ga0068865_100358562 | Ga0068865_1003585621 | 297 |
| 119 | 3300009098 | Ga0105245_10825443 | Ga0105245_108254431 | 297 |
| 120 | 3300013296 | Ga0157374_10497550 | Ga0157374_104975501 | 297 |
| 121 | 3300013297 | Ga0157378_10025960 | Ga0157378_100259606 | 297 |
| 122 | 3300013306 | Ga0163162_10002326 | Ga0163162_1000232618 | 297 |
| 123 | 3300025926 | Ga0207659_10127291 | Ga0207659_101272912 | 297 |
| 124 | 3300025942 | Ga0207689_10095066 | Ga0207689_100950663 | 297 |
| 125 | 3300025945 | Ga0207679_10048992 | Ga0207679_100489924 | 297 |
| 126 | 3300026023 | Ga0207677_10035021 | Ga0207677_100350212 | 297 |
| 127 | 3300026089 | Ga0207648_10210907 | Ga0207648_102109072 | 297 |
| 128 | 3300003316 | rootH1_10150810 | rootH1_101508101 | 298 |
| 129 | 3300005328 | Ga0070676_10021838 | Ga0070676_100218384 | 298 |
| 130 | 3300005328 | Ga0070676_10067586 | Ga0070676_100675862 | 298 |
| 131 | 3300005328 | Ga0070676_10115694 | Ga0070676_101156942 | 298 |
| 132 | 3300005328 | Ga0070676_10141338 | Ga0070676_101413381 | 298 |
| 133 | 3300005329 | Ga0070683_100000416 | Ga0070683_10000041619 | 298 |
| 134 | 3300005329 | Ga0070683_100000862 | Ga0070683_10000086218 | 298 |
| 135 | 3300005331 | Ga0070670_100064158 | Ga0070670_1000641584 | 298 |
| 136 | 3300005334 | Ga0068869_100027540 | Ga0068869_1000275404 | 298 |
| 137 | 3300005334 | Ga0068869_100061815 | Ga0068869_1000618152 | 298 |
| 138 | 3300005334 | Ga0068869_100072233 | Ga0068869_1000722332 | 298 |
| 139 | 3300005334 | Ga0068869_100310236 | Ga0068869_1003102362 | 298 |
| 140 | 3300005335 | Ga0070666_10008440 | Ga0070666_100084404 | 298 |
| 141 | 3300005335 | Ga0070666_10043338 | Ga0070666_100433383 | 298 |
| 142 | 3300005338 | Ga0068868_100027683 | Ga0068868_1000276833 | 298 |
| 143 | 3300005339 | Ga0070660_100001251 | Ga0070660_10000125111 | 298 |
| 144 | 3300005340 | Ga0070689_100046302 | Ga0070689_1000463023 | 298 |
| 145 | 3300005344 | Ga0070661_100001691 | Ga0070661_10000169116 | 298 |
| 146 | 3300005344 | Ga0070661_100041644 | Ga0070661_1000416442 | 298 |
| 147 | 3300005344 | Ga0070661_100049918 | Ga0070661_1000499183 | 298 |
| 148 | 3300005347 | Ga0070668_100046743 | Ga0070668_1000467433 | 298 |
| 149 | 3300005347 | Ga0070668_100143155 | Ga0070668_1001431552 | 298 |
| 150 | 3300005353 | Ga0070669_100040444 | Ga0070669_1000404442 | 298 |
| 151 | 3300005354 | Ga0070675_100027552 | Ga0070675_1000275522 | 298 |
| 152 | 3300005354 | Ga0070675_100298551 | Ga0070675_1002985512 | 298 |
| 153 | 3300005355 | Ga0070671_100197694 | Ga0070671_1001976942 | 298 |
| 154 | 3300005356 | Ga0070674_100003085 | Ga0070674_1000030852 | 298 |
| 155 | 3300005356 | Ga0070674_100157030 | Ga0070674_1001570302 | 298 |
| 156 | 3300005364 | Ga0070673_100018725 | Ga0070673_1000187255 | 298 |
| 157 | 3300005364 | Ga0070673_100197855 | Ga0070673_1001978551 | 298 |
| 158 | 3300005365 | Ga0070688_100227275 | Ga0070688_1002272752 | 298 |
| 159 | 3300005367 | Ga0070667_100553192 | Ga0070667_1005531921 | 298 |
| 160 | 3300005436 | Ga0070713_100059780 | Ga0070713_1000597803 | 298 |
| 161 | 3300005456 | Ga0070678_100008598 | Ga0070678_1000085985 | 298 |
| 162 | 3300005457 | Ga0070662_100205919 | Ga0070662_1002059191 | 298 |
| 163 | 3300005459 | Ga0068867_100120995 | Ga0068867_1001209952 | 298 |
| 164 | 3300005459 | Ga0068867_100137042 | Ga0068867_1001370422 | 298 |
| 165 | 3300005459 | Ga0068867_100211317 | Ga0068867_1002113171 | 298 |
| 166 | 3300005535 | Ga0070684_100010866 | Ga0070684_1000108668 | 298 |
| 167 | 3300005535 | Ga0070684_100060025 | Ga0070684_1000600254 | 298 |
| 168 | 3300005535 | Ga0070684_100132101 | Ga0070684_1001321012 | 298 |
| 169 | 3300005539 | Ga0068853_100005622 | Ga0068853_1000056227 | 298 |
| 170 | 3300005539 | Ga0068853_100079362 | Ga0068853_1000793623 | 298 |
| 171 | 3300005543 | Ga0070672_100018931 | Ga0070672_1000189316 | 298 |
| 172 | 3300005563 | Ga0068855_100000630 | Ga0068855_10000063031 | 298 |
| 173 | 3300005563 | Ga0068855_100227602 | Ga0068855_1002276022 | 298 |
| 174 | 3300005564 | Ga0070664_100009504 | Ga0070664_1000095047 | 298 |
| 175 | 3300005564 | Ga0070664_100024924 | Ga0070664_1000249245 | 298 |
| 176 | 3300005564 | Ga0070664_100263006 | Ga0070664_1002630061 | 298 |
| 177 | 3300005577 | Ga0068857_100029919 | Ga0068857_1000299195 | 298 |
| 178 | 3300005616 | Ga0068852_100096705 | Ga0068852_1000967051 | 298 |
| 179 | 3300005616 | Ga0068852_100124030 | Ga0068852_1001240302 | 298 |
| 180 | 3300005617 | Ga0068859_100020133 | Ga0068859_1000201335 | 298 |
| 181 | 3300005617 | Ga0068859_100041535 | Ga0068859_1000415355 | 298 |
| 182 | 3300005617 | Ga0068859_100057135 | Ga0068859_1000571354 | 298 |
| 183 | 3300005618 | Ga0068864_100012297 | Ga0068864_1000122976 | 298 |
| 184 | 3300005618 | Ga0068864_100044037 | Ga0068864_1000440372 | 298 |
| 185 | 3300005718 | Ga0068866_10010641 | Ga0068866_100106414 | 298 |
| 186 | 3300005719 | Ga0068861_100010694 | Ga0068861_1000106942 | 298 |
| 187 | 3300005719 | Ga0068861_100081735 | Ga0068861_1000817352 | 298 |
| 188 | 3300005841 | Ga0068863_100436971 | Ga0068863_1004369711 | 298 |
| 189 | 3300005841 | Ga0068863_100621024 | Ga0068863_1006210241 | 298 |
| 190 | 3300005843 | Ga0068860_100000046 | Ga0068860_100000046105 | 298 |
| 191 | 3300005843 | Ga0068860_100012479 | Ga0068860_1000124795 | 298 |
| 192 | 3300005843 | Ga0068860_100063896 | Ga0068860_1000638961 | 298 |
| 193 | 3300005844 | Ga0068862_100378411 | Ga0068862_1003784112 | 298 |
| 194 | 3300005844 | Ga0068862_100683976 | Ga0068862_1006839761 | 298 |
| 195 | 3300006237 | Ga0097621_100005734 | Ga0097621_1000057346 | 298 |
| 196 | 3300006237 | Ga0097621_100020920 | Ga0097621_1000209203 | 298 |
| 197 | 3300006237 | Ga0097621_100120499 | Ga0097621_1001204992 | 298 |
| 198 | 3300006358 | Ga0068871_100001400 | Ga0068871_1000014004 | 298 |
| 199 | 3300006881 | Ga0068865_100115537 | Ga0068865_1001155372 | 298 |
| 200 | 3300006881 | Ga0068865_100210844 | Ga0068865_1002108442 | 298 |
| 201 | 3300006914 | Ga0075436_100191241 | Ga0075436_1001912412 | 298 |
| 202 | 3300006931 | Ga0097620_100020133 | Ga0097620_1000201333 | 298 |
| 203 | 3300006931 | Ga0097620_100041533 | Ga0097620_1000415335 | 298 |
| 204 | 3300006931 | Ga0097620_100057136 | Ga0097620_1000571364 | 298 |
| 205 | 3300009094 | Ga0111539_10027898 | Ga0111539_100278988 | 298 |
| 206 | 3300009176 | Ga0105242_10035863 | Ga0105242_100358632 | 298 |
| 207 | 3300009176 | Ga0105242_10081723 | Ga0105242_100817233 | 298 |
| 208 | 3300009176 | Ga0105242_10167480 | Ga0105242_101674802 | 298 |
| 209 | 3300009177 | Ga0105248_10434615 | Ga0105248_104346152 | 298 |
| 210 | 3300009553 | Ga0105249_10000336 | Ga0105249_1000033635 | 298 |
| 211 | 3300009553 | Ga0105249_10062091 | Ga0105249_100620914 | 298 |
| 212 | 3300009553 | Ga0105249_10077375 | Ga0105249_100773754 | 298 |
| 213 | 3300010375 | Ga0105239_10728352 | Ga0105239_107283522 | 298 |
| 214 | 3300011119 | Ga0105246_10046348 | Ga0105246_100463482 | 298 |
| 215 | 3300011119 | Ga0105246_10096961 | Ga0105246_100969612 | 298 |
| 216 | 3300013100 | Ga0157373_10411245 | Ga0157373_104112451 | 298 |
| 217 | 3300013296 | Ga0157374_10031789 | Ga0157374_100317892 | 298 |
| 218 | 3300013296 | Ga0157374_10261725 | Ga0157374_102617252 | 298 |
| 219 | 3300013297 | Ga0157378_10033991 | Ga0157378_100339912 | 298 |
| 220 | 3300013297 | Ga0157378_10041279 | Ga0157378_100412791 | 298 |
| 221 | 3300013306 | Ga0163162_10540856 | Ga0163162_105408562 | 298 |
| 222 | 3300014325 | Ga0163163_10338101 | Ga0163163_103381012 | 298 |
| 223 | 3300014326 | Ga0157380_10194326 | Ga0157380_101943262 | 298 |
| 224 | 3300014745 | Ga0157377_10010450 | Ga0157377_100104502 | 298 |
| 225 | 3300014968 | Ga0157379_10030191 | Ga0157379_100301912 | 298 |
| 226 | 3300014968 | Ga0157379_10220949 | Ga0157379_102209491 | 298 |
| 227 | 3300014968 | Ga0157379_10279260 | Ga0157379_102792602 | 298 |
| 228 | 3300017792 | Ga0163161_10028064 | Ga0163161_100280643 | 298 |
| 229 | 3300025315 | Ga0207697_10072834 | Ga0207697_100728341 | 298 |
| 230 | 3300025901 | Ga0207688_10010428 | Ga0207688_100104282 | 298 |
| 231 | 3300025901 | Ga0207688_10010984 | Ga0207688_100109842 | 298 |
| 232 | 3300025903 | Ga0207680_10090125 | Ga0207680_100901251 | 298 |
| 233 | 3300025903 | Ga0207680_10127486 | Ga0207680_101274862 | 298 |
| 234 | 3300025903 | Ga0207680_10258231 | Ga0207680_102582311 | 298 |
| 235 | 3300025907 | Ga0207645_10000354 | Ga0207645_1000035434 | 298 |
| 236 | 3300025907 | Ga0207645_10007158 | Ga0207645_100071585 | 298 |
| 237 | 3300025907 | Ga0207645_10160915 | Ga0207645_101609152 | 298 |
| 238 | 3300025907 | Ga0207645_10212118 | Ga0207645_102121181 | 298 |
| 239 | 3300025908 | Ga0207643_10003608 | Ga0207643_100036082 | 298 |
| 240 | 3300025911 | Ga0207654_10240283 | Ga0207654_102402831 | 298 |
| 241 | 3300025913 | Ga0207695_10000110 | Ga0207695_10000110178 | 298 |
| 242 | 3300025919 | Ga0207657_10022885 | Ga0207657_100228854 | 298 |
| 243 | 3300025920 | Ga0207649_10024736 | Ga0207649_100247365 | 298 |
| 244 | 3300025920 | Ga0207649_10130932 | Ga0207649_101309322 | 298 |
| 245 | 3300025923 | Ga0207681_10174592 | Ga0207681_101745923 | 298 |
| 246 | 3300025923 | Ga0207681_10382595 | Ga0207681_103825951 | 298 |
| 247 | 3300025926 | Ga0207659_10263654 | Ga0207659_102636542 | 298 |
| 248 | 3300025931 | Ga0207644_10111448 | Ga0207644_101114482 | 298 |
| 249 | 3300025931 | Ga0207644_10129579 | Ga0207644_101295792 | 298 |
| 250 | 3300025933 | Ga0207706_10306261 | Ga0207706_103062611 | 298 |
| 251 | 3300025934 | Ga0207686_10278279 | Ga0207686_102782792 | 298 |
| 252 | 3300025936 | Ga0207670_10040599 | Ga0207670_100405992 | 298 |
| 253 | 3300025937 | Ga0207669_10188217 | Ga0207669_101882171 | 298 |
| 254 | 3300025940 | Ga0207691_10008243 | Ga0207691_100082436 | 298 |
| 255 | 3300025940 | Ga0207691_10063145 | Ga0207691_100631452 | 298 |
| 256 | 3300025942 | Ga0207689_10003402 | Ga0207689_100034024 | 298 |
| 257 | 3300025942 | Ga0207689_10010556 | Ga0207689_100105568 | 298 |
| 258 | 3300025942 | Ga0207689_10028309 | Ga0207689_100283092 | 298 |
| 259 | 3300025942 | Ga0207689_10039159 | Ga0207689_100391593 | 298 |
| 260 | 3300025944 | Ga0207661_10000927 | Ga0207661_1000092717 | 298 |
| 261 | 3300025944 | Ga0207661_10017050 | Ga0207661_100170506 | 298 |
| 262 | 3300025945 | Ga0207679_10012298 | Ga0207679_100122982 | 298 |
| 263 | 3300025945 | Ga0207679_10174640 | Ga0207679_101746402 | 298 |
| 264 | 3300025945 | Ga0207679_10355117 | Ga0207679_103551172 | 298 |
| 265 | 3300025949 | Ga0207667_10000700 | Ga0207667_100007004 | 298 |
| 266 | 3300025960 | Ga0207651_10029346 | Ga0207651_100293462 | 298 |
| 267 | 3300025961 | Ga0207712_10011962 | Ga0207712_100119625 | 298 |
| 268 | 3300025961 | Ga0207712_10031978 | Ga0207712_100319785 | 298 |
| 269 | 3300025961 | Ga0207712_10128949 | Ga0207712_101289492 | 298 |
| 270 | 3300025972 | Ga0207668_10206746 | Ga0207668_102067462 | 298 |
| 271 | 3300025972 | Ga0207668_10493100 | Ga0207668_104931001 | 298 |
| 272 | 3300025986 | Ga0207658_10072894 | Ga0207658_100728943 | 298 |
| 273 | 3300025986 | Ga0207658_10112399 | Ga0207658_101123992 | 298 |
| 274 | 3300025986 | Ga0207658_10243111 | Ga0207658_102431112 | 298 |
| 275 | 3300026023 | Ga0207677_10165535 | Ga0207677_101655352 | 298 |
| 276 | 3300026035 | Ga0207703_10342658 | Ga0207703_103426582 | 298 |
| 277 | 3300026041 | Ga0207639_10010461 | Ga0207639_100104612 | 298 |
| 278 | 3300026041 | Ga0207639_10159449 | Ga0207639_101594492 | 298 |
| 279 | 3300026088 | Ga0207641_10282834 | Ga0207641_102828342 | 298 |
| 280 | 3300026089 | Ga0207648_10000404 | Ga0207648_1000040439 | 298 |
| 281 | 3300026089 | Ga0207648_10006809 | Ga0207648_1000680910 | 298 |
| 282 | 3300026095 | Ga0207676_10203869 | Ga0207676_102038692 | 298 |
| 283 | 3300026116 | Ga0207674_10002719 | Ga0207674_1000271920 | 298 |
| 284 | 3300026116 | Ga0207674_10396486 | Ga0207674_103964862 | 298 |
| 285 | 3300026118 | Ga0207675_100136473 | Ga0207675_1001364733 | 298 |
| 286 | 3300026118 | Ga0207675_100637145 | Ga0207675_1006371451 | 298 |
| 287 | 3300026121 | Ga0207683_10021738 | Ga0207683_100217383 | 298 |
| 288 | 3300026142 | Ga0207698_10031580 | Ga0207698_100315805 | 298 |
| 289 | 3300027907 | Ga0207428_10374460 | Ga0207428_103744601 | 298 |
| 290 | 3300028379 | Ga0268266_10115106 | Ga0268266_101151062 | 298 |
| 291 | 3300028380 | Ga0268265_10073544 | Ga0268265_100735442 | 298 |
| 292 | 3300028381 | Ga0268264_10000041 | Ga0268264_10000041222 | 298 |
| 293 | 3300031852 | Ga0307410_10079004 | Ga0307410_100790042 | 298 |
| 294 | 3300044658 | Ga0466972_0028475 | Ga0466972_0028475_66_962 | 298 |
| 295 | 3300044719 | Ga0466971_0083026 | Ga0466971_0083026_94_990 | 298 |
| 296 | 3300044842 | Ga0466957_0012368 | Ga0466957_0012368_324_1220 | 298 |
| 297 | 3300046471 | Ga0495650_0033545 | Ga0495650_0033545_1087_1998 | 298 |
| 298 | 3300046616 | Ga0495668_0001941 | Ga0495668_0001941_11498_12397 | 298 |
| 299 | 3300048913 | Ga0496110_0039739 | Ga0496110_0039739_2659_3582 | 298 |
| 300 | 3300048913 | Ga0496110_0514358 | Ga0496110_0514358_138_1055 | 298 |
| 301 | 3300049568 | Ga0501031_0003126 | Ga0501031_0003126_47_943 | 298 |
| 302 | 3300049572 | Ga0501036_0018517 | Ga0501036_0018517_4850_5746 | 298 |
| 303 | 3300049574 | Ga0501038_0006153 | Ga0501038_0006153_6140_7114 | 298 |
| 304 | 3300049588 | Ga0501072_0154018 | Ga0501072_0154018_869_1765 | 298 |
| 305 | 3300049589 | Ga0501073_0351667 | Ga0501073_0351667_81_977 | 298 |
| 306 | 3300049656 | Ga0501209_051941 | Ga0501209_051941_23_919 | 298 |
| 307 | 3300049823 | Ga0501044_0008339 | Ga0501044_0008339_8991_9965 | 298 |
| 308 | 3300053727 | Ga0500611_000028 | Ga0500611_000028_24661_25557 | 298 |
| 309 | 3300002459 | JGI24751J29686_10003924 | JGI24751J29686_100039242 | 299 |
| 310 | 3300003323 | rootH1_10005105 | rootH1_1000510517 | 299 |
| 311 | 3300003323 | rootH1_10188737 | rootH1_101887372 | 299 |
| 312 | 3300005327 | Ga0070658_10122562 | Ga0070658_101225622 | 299 |
| 313 | 3300005331 | Ga0070670_100077525 | Ga0070670_1000775252 | 299 |
| 314 | 3300005331 | Ga0070670_100096076 | Ga0070670_1000960762 | 299 |
| 315 | 3300005333 | Ga0070677_10014063 | Ga0070677_100140631 | 299 |
| 316 | 3300005334 | Ga0068869_100027065 | Ga0068869_1000270652 | 299 |
| 317 | 3300005336 | Ga0070680_100015814 | Ga0070680_1000158144 | 299 |
| 318 | 3300005336 | Ga0070680_100053596 | Ga0070680_1000535962 | 299 |
| 319 | 3300005337 | Ga0070682_100036556 | Ga0070682_1000365561 | 299 |
| 320 | 3300005338 | Ga0068868_100001540 | Ga0068868_1000015407 | 299 |
| 321 | 3300005339 | Ga0070660_100027666 | Ga0070660_1000276662 | 299 |
| 322 | 3300005339 | Ga0070660_100097607 | Ga0070660_1000976071 | 299 |
| 323 | 3300005343 | Ga0070687_100168432 | Ga0070687_1001684321 | 299 |
| 324 | 3300005354 | Ga0070675_100229375 | Ga0070675_1002293752 | 299 |
| 325 | 3300005355 | Ga0070671_100041177 | Ga0070671_1000411772 | 299 |
| 326 | 3300005355 | Ga0070671_100159034 | Ga0070671_1001590341 | 299 |
| 327 | 3300005366 | Ga0070659_100025801 | Ga0070659_1000258012 | 299 |
| 328 | 3300005366 | Ga0070659_100210510 | Ga0070659_1002105102 | 299 |
| 329 | 3300005367 | Ga0070667_100026896 | Ga0070667_1000268963 | 299 |
| 330 | 3300005441 | Ga0070700_100062674 | Ga0070700_1000626743 | 299 |
| 331 | 3300005455 | Ga0070663_100133295 | Ga0070663_1001332952 | 299 |
| 332 | 3300005458 | Ga0070681_10293747 | Ga0070681_102937472 | 299 |
| 333 | 3300005530 | Ga0070679_100003166 | Ga0070679_1000031665 | 299 |
| 334 | 3300005530 | Ga0070679_100008640 | Ga0070679_10000864010 | 299 |
| 335 | 3300005530 | Ga0070679_100233318 | Ga0070679_1002333182 | 299 |
| 336 | 3300005530 | Ga0070679_100321481 | Ga0070679_1003214812 | 299 |
| 337 | 3300005539 | Ga0068853_100001585 | Ga0068853_1000015852 | 299 |
| 338 | 3300005539 | Ga0068853_100031135 | Ga0068853_1000311354 | 299 |
| 339 | 3300005539 | Ga0068853_100209830 | Ga0068853_1002098301 | 299 |
| 340 | 3300005543 | Ga0070672_100102005 | Ga0070672_1001020052 | 299 |
| 341 | 3300005543 | Ga0070672_100269417 | Ga0070672_1002694172 | 299 |
| 342 | 3300005548 | Ga0070665_100229958 | Ga0070665_1002299582 | 299 |
| 343 | 3300005563 | Ga0068855_100008628 | Ga0068855_1000086282 | 299 |
| 344 | 3300005563 | Ga0068855_100024867 | Ga0068855_1000248677 | 299 |
| 345 | 3300005563 | Ga0068855_100038643 | Ga0068855_1000386432 | 299 |
| 346 | 3300005563 | Ga0068855_100114206 | Ga0068855_1001142062 | 299 |
| 347 | 3300005563 | Ga0068855_100748844 | Ga0068855_1007488441 | 299 |
| 348 | 3300005577 | Ga0068857_100052605 | Ga0068857_1000526053 | 299 |
| 349 | 3300005577 | Ga0068857_100266087 | Ga0068857_1002660872 | 299 |
| 350 | 3300005578 | Ga0068854_100032094 | Ga0068854_1000320944 | 299 |
| 351 | 3300005614 | Ga0068856_100027858 | Ga0068856_1000278584 | 299 |
| 352 | 3300005614 | Ga0068856_100094037 | Ga0068856_1000940373 | 299 |
| 353 | 3300005614 | Ga0068856_100351643 | Ga0068856_1003516431 | 299 |
| 354 | 3300005616 | Ga0068852_100004122 | Ga0068852_1000041229 | 299 |
| 355 | 3300005616 | Ga0068852_100164427 | Ga0068852_1001644272 | 299 |
| 356 | 3300005616 | Ga0068852_100358872 | Ga0068852_1003588722 | 299 |
| 357 | 3300005617 | Ga0068859_100280449 | Ga0068859_1002804492 | 299 |
| 358 | 3300005617 | Ga0068859_100854078 | Ga0068859_1008540781 | 299 |
| 359 | 3300005618 | Ga0068864_100071732 | Ga0068864_1000717323 | 299 |
| 360 | 3300005618 | Ga0068864_100307092 | Ga0068864_1003070921 | 299 |
| 361 | 3300005841 | Ga0068863_100002125 | Ga0068863_10000212518 | 299 |
| 362 | 3300005843 | Ga0068860_100007815 | Ga0068860_1000078155 | 299 |
| 363 | 3300005843 | Ga0068860_100020187 | Ga0068860_1000201875 | 299 |
| 364 | 3300005844 | Ga0068862_100008092 | Ga0068862_1000080929 | 299 |
| 365 | 3300006195 | Ga0075366_10044041 | Ga0075366_100440412 | 299 |
| 366 | 3300006195 | Ga0075366_10044467 | Ga0075366_100444672 | 299 |
| 367 | 3300006195 | Ga0075366_10044732 | Ga0075366_100447322 | 299 |
| 368 | 3300006358 | Ga0068871_100132921 | Ga0068871_1001329213 | 299 |
| 369 | 3300006847 | Ga0075431_100089555 | Ga0075431_1000895552 | 299 |
| 370 | 3300006931 | Ga0097620_100280441 | Ga0097620_1002804412 | 299 |
| 371 | 3300006931 | Ga0097620_100854109 | Ga0097620_1008541091 | 299 |
| 372 | 3300009093 | Ga0105240_10002716 | Ga0105240_100027164 | 299 |
| 373 | 3300009093 | Ga0105240_10002823 | Ga0105240_1000282325 | 299 |
| 374 | 3300009093 | Ga0105240_10112572 | Ga0105240_101125723 | 299 |
| 375 | 3300009093 | Ga0105240_10293984 | Ga0105240_102939842 | 299 |
| 376 | 3300009093 | Ga0105240_10327078 | Ga0105240_103270782 | 299 |
| 377 | 3300009093 | Ga0105240_10601691 | Ga0105240_106016911 | 299 |
| 378 | 3300009101 | Ga0105247_10229417 | Ga0105247_102294171 | 299 |
| 379 | 3300009147 | Ga0114129_10022075 | Ga0114129_100220758 | 299 |
| 380 | 3300009174 | Ga0105241_10137005 | Ga0105241_101370052 | 299 |
| 381 | 3300009545 | Ga0105237_10020194 | Ga0105237_100201943 | 299 |
| 382 | 3300009545 | Ga0105237_10435858 | Ga0105237_104358581 | 299 |
| 383 | 3300009551 | Ga0105238_10136112 | Ga0105238_101361123 | 299 |
| 384 | 3300009553 | Ga0105249_10002924 | Ga0105249_1000292412 | 299 |
| 385 | 3300010375 | Ga0105239_10008174 | Ga0105239_100081742 | 299 |
| 386 | 3300010375 | Ga0105239_10035221 | Ga0105239_100352212 | 299 |
| 387 | 3300010375 | Ga0105239_10203614 | Ga0105239_102036143 | 299 |
| 388 | 3300011119 | Ga0105246_10241185 | Ga0105246_102411852 | 299 |
| 389 | 3300013100 | Ga0157373_10001885 | Ga0157373_1000188511 | 299 |
| 390 | 3300013100 | Ga0157373_10022711 | Ga0157373_100227115 | 299 |
| 391 | 3300013102 | Ga0157371_10001002 | Ga0157371_1000100231 | 299 |
| 392 | 3300013102 | Ga0157371_10002977 | Ga0157371_1000297712 | 299 |
| 393 | 3300013102 | Ga0157371_10004296 | Ga0157371_100042964 | 299 |
| 394 | 3300013102 | Ga0157371_10006866 | Ga0157371_100068667 | 299 |
| 395 | 3300013102 | Ga0157371_10006988 | Ga0157371_100069888 | 299 |
| 396 | 3300013102 | Ga0157371_10014226 | Ga0157371_100142262 | 299 |
| 397 | 3300013102 | Ga0157371_10014774 | Ga0157371_100147745 | 299 |
| 398 | 3300013102 | Ga0157371_10029414 | Ga0157371_100294142 | 299 |
| 399 | 3300013102 | Ga0157371_10047724 | Ga0157371_100477242 | 299 |
| 400 | 3300013102 | Ga0157371_10197804 | Ga0157371_101978042 | 299 |
| 401 | 3300013104 | Ga0157370_10004047 | Ga0157370_100040476 | 299 |
| 402 | 3300013104 | Ga0157370_10054899 | Ga0157370_100548992 | 299 |
| 403 | 3300013104 | Ga0157370_10231376 | Ga0157370_102313762 | 299 |
| 404 | 3300013105 | Ga0157369_10018160 | Ga0157369_100181602 | 299 |
| 405 | 3300013105 | Ga0157369_10080099 | Ga0157369_100800991 | 299 |
| 406 | 3300013296 | Ga0157374_10040796 | Ga0157374_100407962 | 299 |
| 407 | 3300013296 | Ga0157374_10390963 | Ga0157374_103909631 | 299 |
| 408 | 3300013297 | Ga0157378_10002969 | Ga0157378_1000296913 | 299 |
| 409 | 3300013297 | Ga0157378_10293679 | Ga0157378_102936791 | 299 |
| 410 | 3300013306 | Ga0163162_10353766 | Ga0163162_103537662 | 299 |
| 411 | 3300013307 | Ga0157372_10054066 | Ga0157372_100540666 | 299 |
| 412 | 3300013307 | Ga0157372_10080094 | Ga0157372_100800942 | 299 |
| 413 | 3300013307 | Ga0157372_10227461 | Ga0157372_102274611 | 299 |
| 414 | 3300013307 | Ga0157372_10307524 | Ga0157372_103075242 | 299 |
| 415 | 3300013307 | Ga0157372_10778967 | Ga0157372_107789671 | 299 |
| 416 | 3300013308 | Ga0157375_10399131 | Ga0157375_103991312 | 299 |
| 417 | 3300014325 | Ga0163163_10035920 | Ga0163163_100359202 | 299 |
| 418 | 3300014325 | Ga0163163_10112099 | Ga0163163_101120993 | 299 |
| 419 | 3300014326 | Ga0157380_10107218 | Ga0157380_101072182 | 299 |
| 420 | 3300014968 | Ga0157379_10188186 | Ga0157379_101881862 | 299 |
| 421 | 3300015261 | Ga0182006_1005135 | Ga0182006_10051354 | 299 |
| 422 | 3300017792 | Ga0163161_10203979 | Ga0163161_102039792 | 299 |
| 423 | 3300025246 | Ga0209646_1001411 | Ga0209646_10014116 | 299 |
| 424 | 3300025904 | Ga0207647_10022060 | Ga0207647_100220604 | 299 |
| 425 | 3300025904 | Ga0207647_10041934 | Ga0207647_100419342 | 299 |
| 426 | 3300025909 | Ga0207705_10002745 | Ga0207705_100027454 | 299 |
| 427 | 3300025912 | Ga0207707_10251310 | Ga0207707_102513102 | 299 |
| 428 | 3300025913 | Ga0207695_10000023 | Ga0207695_1000002334 | 299 |
| 429 | 3300025913 | Ga0207695_10000229 | Ga0207695_10000229107 | 299 |
| 430 | 3300025913 | Ga0207695_10016531 | Ga0207695_100165317 | 299 |
| 431 | 3300025913 | Ga0207695_10267368 | Ga0207695_102673682 | 299 |
| 432 | 3300025914 | Ga0207671_10406374 | Ga0207671_104063741 | 299 |
| 433 | 3300025917 | Ga0207660_10006958 | Ga0207660_100069584 | 299 |
| 434 | 3300025917 | Ga0207660_10036076 | Ga0207660_100360764 | 299 |
| 435 | 3300025919 | Ga0207657_10032463 | Ga0207657_100324633 | 299 |
| 436 | 3300025919 | Ga0207657_10042465 | Ga0207657_100424653 | 299 |
| 437 | 3300025919 | Ga0207657_10092792 | Ga0207657_100927921 | 299 |
| 438 | 3300025919 | Ga0207657_10343784 | Ga0207657_103437841 | 299 |
| 439 | 3300025921 | Ga0207652_10000181 | Ga0207652_1000018160 | 299 |
| 440 | 3300025921 | Ga0207652_10004884 | Ga0207652_100048849 | 299 |
| 441 | 3300025921 | Ga0207652_10009180 | Ga0207652_100091806 | 299 |
| 442 | 3300025925 | Ga0207650_10003002 | Ga0207650_100030028 | 299 |
| 443 | 3300025925 | Ga0207650_10196085 | Ga0207650_101960852 | 299 |
| 444 | 3300025929 | Ga0207664_10201931 | Ga0207664_102019312 | 299 |
| 445 | 3300025931 | Ga0207644_10021217 | Ga0207644_100212172 | 299 |
| 446 | 3300025932 | Ga0207690_10255171 | Ga0207690_102551711 | 299 |
| 447 | 3300025933 | Ga0207706_10386944 | Ga0207706_103869441 | 299 |
| 448 | 3300025940 | Ga0207691_10003925 | Ga0207691_1000392510 | 299 |
| 449 | 3300025940 | Ga0207691_10037067 | Ga0207691_100370672 | 299 |
| 450 | 3300025940 | Ga0207691_10089598 | Ga0207691_100895983 | 299 |
| 451 | 3300025949 | Ga0207667_10002784 | Ga0207667_1000278411 | 299 |
| 452 | 3300025949 | Ga0207667_10021765 | Ga0207667_100217656 | 299 |
| 453 | 3300025949 | Ga0207667_10024649 | Ga0207667_100246496 | 299 |
| 454 | 3300025960 | Ga0207651_10383278 | Ga0207651_103832782 | 299 |
| 455 | 3300025961 | Ga0207712_10030807 | Ga0207712_100308075 | 299 |
| 456 | 3300025981 | Ga0207640_10093442 | Ga0207640_100934422 | 299 |
| 457 | 3300025981 | Ga0207640_10350103 | Ga0207640_103501032 | 299 |
| 458 | 3300025981 | Ga0207640_10503965 | Ga0207640_105039651 | 299 |
| 459 | 3300025986 | Ga0207658_10267122 | Ga0207658_102671222 | 299 |
| 460 | 3300026023 | Ga0207677_10010001 | Ga0207677_100100011 | 299 |
| 461 | 3300026035 | Ga0207703_10404726 | Ga0207703_104047261 | 299 |
| 462 | 3300026041 | Ga0207639_10043200 | Ga0207639_100432002 | 299 |
| 463 | 3300026075 | Ga0207708_10115057 | Ga0207708_101150572 | 299 |
| 464 | 3300026078 | Ga0207702_10078915 | Ga0207702_100789153 | 299 |
| 465 | 3300026078 | Ga0207702_10111484 | Ga0207702_101114842 | 299 |
| 466 | 3300026078 | Ga0207702_10567416 | Ga0207702_105674161 | 299 |
| 467 | 3300026088 | Ga0207641_10160035 | Ga0207641_101600352 | 299 |
| 468 | 3300026095 | Ga0207676_10022185 | Ga0207676_100221852 | 299 |
| 469 | 3300026116 | Ga0207674_10048243 | Ga0207674_100482434 | 299 |
| 470 | 3300026116 | Ga0207674_10055019 | Ga0207674_100550192 | 299 |
| 471 | 3300026142 | Ga0207698_10332943 | Ga0207698_103329431 | 299 |
| 472 | 3300028379 | Ga0268266_10220049 | Ga0268266_102200492 | 299 |
| 473 | 3300028381 | Ga0268264_10003143 | Ga0268264_1000314310 | 299 |
| 474 | 3300028381 | Ga0268264_10010550 | Ga0268264_100105505 | 299 |
| 475 | 3300028381 | Ga0268264_10018981 | Ga0268264_100189812 | 299 |
| 476 | 3300028794 | Ga0307515_10000039 | Ga0307515_10000039159 | 299 |
| 477 | 3300031251 | Ga0265327_10085600 | Ga0265327_100856002 | 299 |
| 478 | 3300031456 | Ga0307513_10033861 | Ga0307513_100338611 | 299 |
| 479 | 3300031456 | Ga0307513_10035308 | Ga0307513_100353084 | 299 |
| 480 | 3300031456 | Ga0307513_10280517 | Ga0307513_102805171 | 299 |
| 481 | 3300031507 | Ga0307509_10116319 | Ga0307509_101163192 | 299 |
| 482 | 3300031903 | Ga0307407_10114337 | Ga0307407_101143372 | 299 |
| 483 | 3300033180 | Ga0307510_10000805 | Ga0307510_1000080510 | 299 |
| 484 | 3300037312 | Ga0395899_0023691 | Ga0395899_0023691_2599_3516 | 299 |
| 485 | 3300037312 | Ga0395899_0033036 | Ga0395899_0033036_832_1740 | 299 |
| 486 | 3300037312 | Ga0395899_0059292 | Ga0395899_0059292_647_1555 | 299 |
| 487 | 3300037418 | Ga0395900_0007567 | Ga0395900_0007567_3229_4146 | 299 |
| 488 | 3300037418 | Ga0395900_0017877 | Ga0395900_0017877_4454_5371 | 299 |
| 489 | 3300037418 | Ga0395900_0040292 | Ga0395900_0040292_2209_3117 | 299 |
| 490 | 3300037418 | Ga0395900_0082623 | Ga0395900_0082623_2031_2948 | 299 |
| 491 | 3300037418 | Ga0395900_0268260 | Ga0395900_0268260_355_1272 | 299 |
| 492 | 3300037466 | Ga0395898_0001381 | Ga0395898_0001381_4895_5812 | 299 |
| 493 | 3300037466 | Ga0395898_0003360 | Ga0395898_0003360_14567_15475 | 299 |
| 494 | 3300037466 | Ga0395898_0042155 | Ga0395898_0042155_2653_3570 | 299 |
| 495 | 3300037466 | Ga0395898_0154572 | Ga0395898_0154572_298_1206 | 299 |
| 496 | 3300037471 | Ga0395905_0103398 | Ga0395905_0103398_389_1297 | 299 |
| 497 | 3300038443 | Ga0395901_0012942 | Ga0395901_0012942_6442_7359 | 299 |
| 498 | 3300038443 | Ga0395901_0041303 | Ga0395901_0041303_1130_2038 | 299 |
| 499 | 3300041404 | Ga0439436_0009107 | Ga0439436_0009107_193_1092 | 299 |
| 500 | 3300041406 | Ga0439439_0013442 | Ga0439439_0013442_662_1561 | 299 |
| 501 | 3300041456 | Ga0451795_0953208 | Ga0451795_0953208_619_1518 | 299 |
| 502 | 3300041512 | Ga0451853_2186550 | Ga0451853_2186550_35_934 | 299 |
| 503 | 3300042014 | Ga0439457_000707 | Ga0439457_000707_2679_3578 | 299 |
| 504 | 3300042876 | Ga0451577_0311814 | Ga0451577_0311814_348_1247 | 299 |
| 505 | 3300044656 | Ga0466969_0000182 | Ga0466969_0000182_30607_31506 | 299 |
| 506 | 3300044658 | Ga0466972_0003013 | Ga0466972_0003013_7003_7908 | 299 |
| 507 | 3300044658 | Ga0466972_0020761 | Ga0466972_0020761_2333_3238 | 299 |
| 508 | 3300044683 | Ga0466965_0176656 | Ga0466965_0176656_91_990 | 299 |
| 509 | 3300044684 | Ga0466966_0002356 | Ga0466966_0002356_10793_11692 | 299 |
| 510 | 3300044712 | Ga0453684_0190650 | Ga0453684_0190650_745_1656 | 299 |
| 511 | 3300044735 | Ga0466968_0021860 | Ga0466968_0021860_28_930 | 299 |
| 512 | 3300044735 | Ga0466968_0159273 | Ga0466968_0159273_63_962 | 299 |
| 513 | 3300044842 | Ga0466957_0033803 | Ga0466957_0033803_2029_2934 | 299 |
| 514 | 3300045049 | Ga0466959_0000056 | Ga0466959_0000056_32363_33262 | 299 |
| 515 | 3300046519 | Ga0495632_0074992 | Ga0495632_0074992_551_1450 | 299 |
| 516 | 3300046616 | Ga0495668_0076915 | Ga0495668_0076915_327_1226 | 299 |
| 517 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_481447_482346 | 299 |
| 518 | 3300049570 | Ga0501033_0209318 | Ga0501033_0209318_59_958 | 299 |
| 519 | 3300049571 | Ga0501034_0168910 | Ga0501034_0168910_471_1370 | 299 |
| 520 | 3300049573 | Ga0501037_0187002 | Ga0501037_0187002_309_1208 | 299 |
| 521 | 3300049579 | Ga0501043_0238588 | Ga0501043_0238588_88_987 | 299 |
| 522 | 3300049581 | Ga0501047_0056300 | Ga0501047_0056300_152_1051 | 299 |
| 523 | 3300049582 | Ga0501048_0151809 | Ga0501048_0151809_35_934 | 299 |
| 524 | 3300049586 | Ga0501070_0033866 | Ga0501070_0033866_346_1245 | 299 |
| 525 | 3300049705 | Ga0501225_0004929 | Ga0501225_0004929_964_1863 | 299 |
| 526 | 3300049822 | Ga0501035_0028141 | Ga0501035_0028141_122_1021 | 299 |
| 527 | 3300049823 | Ga0501044_0037968 | Ga0501044_0037968_2237_3136 | 299 |
| 528 | 3300049823 | Ga0501044_0063747 | Ga0501044_0063747_1657_2556 | 299 |
| 529 | 3300049823 | Ga0501044_0264558 | Ga0501044_0264558_470_1369 | 299 |
| 530 | 3300050493 | nmdc:mga0k408_4024_c1 | nmdc:mga0k408_4024_c1_6036_6935 | 299 |
| 531 | 3300050493 | nmdc:mga0k408_73834_c1 | nmdc:mga0k408_73834_c1_235_1134 | 299 |
| 532 | 3300050507 | nmdc:mga05p37_16027_c1 | nmdc:mga05p37_16027_c1_5566_6465 | 299 |
| 533 | 3300053086 | Ga0500578_0000150 | Ga0500578_0000150_70583_71488 | 299 |
| 534 | 3300053086 | Ga0500578_0184274 | Ga0500578_0184274_53_958 | 299 |
| 535 | 3300053092 | Ga0500583_0009104 | Ga0500583_0009104_2638_3537 | 299 |
| 536 | 3300053098 | Ga0500650_0099596 | Ga0500650_0099596_301_1200 | 299 |
| 537 | 3300053142 | Ga0500577_0089424 | Ga0500577_0089424_291_1190 | 299 |
| 538 | 3300053146 | Ga0500588_0025343 | Ga0500588_0025343_714_1613 | 299 |
| 539 | 3300053147 | Ga0500589_040460 | Ga0500589_040460_1082_1981 | 299 |
| 540 | 3300053727 | Ga0500611_016148 | Ga0500611_016148_161_1060 | 299 |
| 541 | 3300001979 | JGI24740J21852_10000984 | JGI24740J21852_100009842 | 300 |
| 542 | 3300001989 | JGI24739J22299_10007020 | JGI24739J22299_100070202 | 300 |
| 543 | 3300001989 | JGI24739J22299_10018624 | JGI24739J22299_100186242 | 300 |
| 544 | 3300003316 | rootH1_10098359 | rootH1_100983591 | 300 |
| 545 | 3300003322 | rootL2_10058361 | rootL2_100583613 | 300 |
| 546 | 3300003322 | rootL2_10058370 | rootL2_100583704 | 300 |
| 547 | 3300005290 | Ga0065712_10079131 | Ga0065712_100791312 | 300 |
| 548 | 3300005339 | Ga0070660_100176151 | Ga0070660_1001761511 | 300 |
| 549 | 3300005366 | Ga0070659_100030941 | Ga0070659_1000309412 | 300 |
| 550 | 3300013105 | Ga0157369_10214197 | Ga0157369_102141972 | 300 |
| 551 | 3300025904 | Ga0207647_10006531 | Ga0207647_100065318 | 300 |
| 552 | 3300025932 | Ga0207690_10071566 | Ga0207690_100715662 | 300 |
| 553 | 3300041406 | Ga0439439_0026591 | Ga0439439_0026591_325_1227 | 300 |
| 554 | 3300049653 | Ga0501206_003258 | Ga0501206_003258_957_1865 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pnn-assembly1.cif.gz_A | the crystal structure of a glycosyltransferase from porphyromonas gingivalis w83 | 0.9484 | 1 | 298 |
| 3pnn-assembly1.cif.gz_A | the crystal structure of a glycosyltransferase from porphyromonas gingivalis w83 | 0.9392 | 1 | 298 |
| 5z0a-assembly1.cif.gz_E-2 | st0452(y97n)-glcnac binding form | 0.8263 | 4 | 284 |
| 6t37-assembly2.cif.gz_C-3 | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.7947 | 2 | 293 |
| 6tqg-assembly1.cif.gz_D | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.7862 | 4 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pnnA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9463 | 1 | 298 | 3.90.550.10 |
| 3pnnA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9401 | 1 | 298 | 3.90.550.10 |
| 5z0aE01 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7984 | 4 | 272 | 3.90.550.10 |
| 4jd0A00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7969 | 2 | 289 | 3.90.550.10 |
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.796 | 1 | 292 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V5PCX8-F1-model_v4 | Nucleotidyltransferase | 0.9832 | 1 | 300 |
|
| AF-A0A2T5C410-F1-model_v4 | Nucleotidyltransferase-like protein | 0.9831 | 1 | 299 |
GO:0009058
GO:0016779 |
| AF-A0A6C0GHB8-F1-model_v4 | Nucleotidyltransferase | 0.9829 | 1 | 300 |
GO:0009058
GO:0016740 |
| AF-A0A7X7Y0R1-F1-model_v4 | Nucleotidyltransferase | 0.9801 | 1 | 300 |
GO:0009058
GO:0016779 |
| AF-A0A2T5C410-F1-model_v4 | Nucleotidyltransferase-like protein | 0.9799 | 1 | 299 |
GO:0009058
GO:0016779 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar