F462915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 227 | 552 | 357 |
Family's Representative Sequence
| Representative Sequence | 3300049521|Ga0501298_011202|Ga0501298_011202_173_1195 |
| Length | 340 |
| Sequence | MDILQFMQLVYAGSDAERRKLRFMYSQSGIQQRYSVIGDYSKPVHDWKFYPQSENLEPFPSLEQRMTLFNKYAPQLSVDAIRDSLNSVHSHKEVTHLITVSCTGMSAPGLDLQVMELMDFGKNIFRTSVNFMGCYAALHALKLADAICKAEKGAQVVIVCTELCTLHFQREGTLDNITSSLLFGDGSAALLITGEDSDLPGLYIDGFYSEIIAKGKRDMAWELSSSGFLMTLSGYVPELIEEDFKAIVQRAIGSEQIEDISHWCMHPGGKRILEAVSKSTGIENEAFKHSYNVLQQYGNLSSASIVFVLKEVLQQKTAIPKLFGAAFGPGLTVETFTAHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 149 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 159 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 160 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 163 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 164 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 165 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 209 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 213 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 222 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 223 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 225 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 226 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.81 |
| Nodule | 0 |
| Rhizoplane | 1.27 |
| Rhizosphere | 93.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10000535 | 3300003320 | Bacteria | 24013 |
| 2 | rootH2_10259783 | 3300003320 | Bacteria | 1406 |
| 3 | rootL2_10221672 | 3300003322 | Unclassified | 3808 |
| 4 | rootH1_10116572 | 3300003323 | Bacteria | 3812 |
| 5 | rootH1_10121234 | 3300003323 | Bacteria | 1617 |
| 6 | rootH1_10199503 | 3300003323 | Bacteria | 2530 |
| 7 | Ga0070658_10001648 | 3300005327 | Bacteria | 18875 |
| 8 | Ga0070658_10048378 | 3300005327 | Bacteria | 3443 |
| 9 | Ga0070658_10081985 | 3300005327 | Bacteria | 2650 |
| 10 | Ga0070676_10004865 | 3300005328 | Bacteria | 7113 |
| 11 | Ga0070683_100025633 | 3300005329 | Bacteria | 5298 |
| 12 | Ga0070683_100033730 | 3300005329 | Bacteria | 4669 |
| 13 | Ga0070690_100047878 | 3300005330 | Bacteria | 2721 |
| 14 | Ga0070670_100053373 | 3300005331 | Unclassified | 3471 |
| 15 | Ga0070670_100103503 | 3300005331 | Unclassified | 2452 |
| 16 | Ga0070670_100120903 | 3300005331 | Bacteria | 2259 |
| 17 | Ga0070670_100200416 | 3300005331 | Bacteria | 1734 |
| 18 | Ga0070670_100236328 | 3300005331 | Unclassified | 1591 |
| 19 | Ga0068869_100048448 | 3300005334 | Bacteria | 3072 |
| 20 | Ga0068869_100063697 | 3300005334 | Bacteria | 2710 |
| 21 | Ga0068869_100108650 | 3300005334 | Unclassified | 2108 |
| 22 | Ga0068869_100294395 | 3300005334 | Bacteria | 1309 |
| 23 | Ga0070666_10000031 | 3300005335 | Bacteria | 132089 |
| 24 | Ga0070666_10000358 | 3300005335 | Bacteria | 28682 |
| 25 | Ga0070666_10048232 | 3300005335 | Unclassified | 2861 |
| 26 | Ga0070666_10053892 | 3300005335 | Bacteria | 2713 |
| 27 | Ga0070666_10118377 | 3300005335 | Unclassified | 1835 |
| 28 | Ga0070666_10121372 | 3300005335 | Bacteria | 1812 |
| 29 | Ga0068868_100000187 | 3300005338 | Bacteria | 41327 |
| 30 | Ga0068868_100000427 | 3300005338 | Bacteria | 28309 |
| 31 | Ga0068868_100003257 | 3300005338 | Bacteria | 11304 |
| 32 | Ga0068868_100023458 | 3300005338 | Unclassified | 4670 |
| 33 | Ga0068868_100128566 | 3300005338 | Bacteria | 2071 |
| 34 | Ga0070660_100020321 | 3300005339 | Bacteria | 4879 |
| 35 | Ga0070660_100078196 | 3300005339 | Bacteria | 2594 |
| 36 | Ga0070689_100044843 | 3300005340 | Bacteria | 3403 |
| 37 | Ga0070689_100098701 | 3300005340 | Bacteria | 2310 |
| 38 | Ga0070661_100019232 | 3300005344 | Bacteria | 4865 |
| 39 | Ga0070661_100108251 | 3300005344 | Bacteria | 2074 |
| 40 | Ga0070668_100003714 | 3300005347 | Bacteria | 11263 |
| 41 | Ga0070668_100180515 | 3300005347 | Bacteria | 1724 |
| 42 | Ga0070669_100086199 | 3300005353 | Bacteria | 2346 |
| 43 | Ga0070675_100007290 | 3300005354 | Bacteria | 8533 |
| 44 | Ga0070675_100064519 | 3300005354 | Bacteria | 3028 |
| 45 | Ga0070675_100167321 | 3300005354 | Bacteria | 1894 |
| 46 | Ga0070675_100188121 | 3300005354 | Bacteria | 1788 |
| 47 | Ga0070671_100004244 | 3300005355 | Bacteria | 11343 |
| 48 | Ga0070671_100125386 | 3300005355 | Bacteria | 2162 |
| 49 | Ga0070674_100062207 | 3300005356 | Bacteria | 2608 |
| 50 | Ga0070674_100158238 | 3300005356 | Bacteria | 1716 |
| 51 | Ga0070673_100000124 | 3300005364 | Bacteria | 35840 |
| 52 | Ga0070673_100022372 | 3300005364 | Unclassified | 4600 |
| 53 | Ga0070688_100069983 | 3300005365 | Bacteria | 2242 |
| 54 | Ga0070688_100092656 | 3300005365 | Bacteria | 1977 |
| 55 | Ga0070667_100000980 | 3300005367 | Bacteria | 26248 |
| 56 | Ga0070667_100007822 | 3300005367 | Bacteria | 8866 |
| 57 | Ga0070667_100011432 | 3300005367 | Bacteria | 7340 |
| 58 | Ga0070667_100014894 | 3300005367 | Bacteria | 6425 |
| 59 | Ga0070667_100053693 | 3300005367 | Unclassified | 3401 |
| 60 | Ga0070678_100010622 | 3300005456 | Bacteria | 5636 |
| 61 | Ga0070678_100057194 | 3300005456 | Bacteria | 2856 |
| 62 | Ga0070678_100075904 | 3300005456 | Bacteria | 2530 |
| 63 | Ga0070662_100009734 | 3300005457 | Bacteria | 6292 |
| 64 | Ga0070662_100010835 | 3300005457 | Bacteria | 6003 |
| 65 | Ga0070662_100011948 | 3300005457 | Bacteria | 5742 |
| 66 | Ga0070662_100013483 | 3300005457 | Bacteria | 5438 |
| 67 | Ga0070681_10035209 | 3300005458 | Bacteria | 5029 |
| 68 | Ga0068867_100002368 | 3300005459 | Bacteria | 13255 |
| 69 | Ga0068867_100066748 | 3300005459 | Unclassified | 2680 |
| 70 | Ga0068867_100172446 | 3300005459 | Bacteria | 1714 |
| 71 | Ga0068867_100276970 | 3300005459 | Bacteria | 1374 |
| 72 | Ga0070698_100055718 | 3300005471 | Bacteria | 4007 |
| 73 | Ga0070679_100136389 | 3300005530 | Bacteria | 2435 |
| 74 | Ga0070684_100157993 | 3300005535 | Bacteria | 2056 |
| 75 | Ga0068853_100002569 | 3300005539 | Bacteria | 13648 |
| 76 | Ga0068853_100128415 | 3300005539 | Unclassified | 2267 |
| 77 | Ga0068853_100179198 | 3300005539 | Bacteria | 1921 |
| 78 | Ga0070672_100000105 | 3300005543 | Bacteria | 41868 |
| 79 | Ga0070686_100001965 | 3300005544 | Bacteria | 11413 |
| 80 | Ga0070686_100036727 | 3300005544 | Bacteria | 3036 |
| 81 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 82 | Ga0070665_100000635 | 3300005548 | Bacteria | 47836 |
| 83 | Ga0070665_100076193 | 3300005548 | Unclassified | 3361 |
| 84 | Ga0070665_100130947 | 3300005548 | Bacteria | 2511 |
| 85 | Ga0068855_100003306 | 3300005563 | Bacteria | 19732 |
| 86 | Ga0068855_100005625 | 3300005563 | Bacteria | 15291 |
| 87 | Ga0068855_100019495 | 3300005563 | Bacteria | 8151 |
| 88 | Ga0068855_100063337 | 3300005563 | Bacteria | 4315 |
| 89 | Ga0068855_100097871 | 3300005563 | Unclassified | 3380 |
| 90 | Ga0068855_100224203 | 3300005563 | Bacteria | 2107 |
| 91 | Ga0070664_100001670 | 3300005564 | Bacteria | 17755 |
| 92 | Ga0068857_100000287 | 3300005577 | Bacteria | 34776 |
| 93 | Ga0068857_100007841 | 3300005577 | Bacteria | 9207 |
| 94 | Ga0068854_100026109 | 3300005578 | Bacteria | 4012 |
| 95 | Ga0068854_100147904 | 3300005578 | Unclassified | 1809 |
| 96 | Ga0068854_100231846 | 3300005578 | Unclassified | 1466 |
| 97 | Ga0068854_100282405 | 3300005578 | Bacteria | 1337 |
| 98 | Ga0068856_100020480 | 3300005614 | Bacteria | 6424 |
| 99 | Ga0068856_100044643 | 3300005614 | Bacteria | 4363 |
| 100 | Ga0068856_100075596 | 3300005614 | Bacteria | 3336 |
| 101 | Ga0068856_100126812 | 3300005614 | Bacteria | 2556 |
| 102 | Ga0068856_100339680 | 3300005614 | Bacteria | 1520 |
| 103 | Ga0068852_100000848 | 3300005616 | Bacteria | 20294 |
| 104 | Ga0068852_100005012 | 3300005616 | Bacteria | 9417 |
| 105 | Ga0068852_100008024 | 3300005616 | Bacteria | 7745 |
| 106 | Ga0068859_100000045 | 3300005617 | Bacteria | 143607 |
| 107 | Ga0068859_100017677 | 3300005617 | Bacteria | 7169 |
| 108 | Ga0068859_100026115 | 3300005617 | Bacteria | 5858 |
| 109 | Ga0068859_100072364 | 3300005617 | Bacteria | 3484 |
| 110 | Ga0068859_100455501 | 3300005617 | Bacteria | 1375 |
| 111 | Ga0068864_100001254 | 3300005618 | Bacteria | 21079 |
| 112 | Ga0068864_100001485 | 3300005618 | Bacteria | 19316 |
| 113 | Ga0068864_100124691 | 3300005618 | Bacteria | 2307 |
| 114 | Ga0068864_100152802 | 3300005618 | Bacteria | 2092 |
| 115 | Ga0068864_100284515 | 3300005618 | Bacteria | 1544 |
| 116 | Ga0068866_10082359 | 3300005718 | Bacteria | 1731 |
| 117 | Ga0068866_10089437 | 3300005718 | Unclassified | 1673 |
| 118 | Ga0068861_100007098 | 3300005719 | Bacteria | 7665 |
| 119 | Ga0068861_100235088 | 3300005719 | Bacteria | 1556 |
| 120 | Ga0068851_10008746 | 3300005834 | Bacteria | 4691 |
| 121 | Ga0068851_10104766 | 3300005834 | Bacteria | 1504 |
| 122 | Ga0068863_100002352 | 3300005841 | Bacteria | 18798 |
| 123 | Ga0068863_100066420 | 3300005841 | Unclassified | 3411 |
| 124 | Ga0068863_100106235 | 3300005841 | Bacteria | 2671 |
| 125 | Ga0068858_100003543 | 3300005842 | Bacteria | 15456 |
| 126 | Ga0068858_100010584 | 3300005842 | Bacteria | 8734 |
| 127 | Ga0068858_100211529 | 3300005842 | Bacteria | 1835 |
| 128 | Ga0068858_100257317 | 3300005842 | Bacteria | 1659 |
| 129 | Ga0068860_100000040 | 3300005843 | Bacteria | 231652 |
| 130 | Ga0068860_100001418 | 3300005843 | Bacteria | 25953 |
| 131 | Ga0068860_100003309 | 3300005843 | Bacteria | 16586 |
| 132 | Ga0068860_100008301 | 3300005843 | Bacteria | 10335 |
| 133 | Ga0068860_100015775 | 3300005843 | Bacteria | 7376 |
| 134 | Ga0068860_100018642 | 3300005843 | Bacteria | 6750 |
| 135 | Ga0068860_100019177 | 3300005843 | Bacteria | 6639 |
| 136 | Ga0068860_100039499 | 3300005843 | Unclassified | 4514 |
| 137 | Ga0068860_100076409 | 3300005843 | Unclassified | 3185 |
| 138 | Ga0068862_100052368 | 3300005844 | Bacteria | 3492 |
| 139 | Ga0068862_100092530 | 3300005844 | Bacteria | 2636 |
| 140 | Ga0097621_100000499 | 3300006237 | Bacteria | 27492 |
| 141 | Ga0097621_100011606 | 3300006237 | Bacteria | 6494 |
| 142 | Ga0097621_100014541 | 3300006237 | Bacteria | 5894 |
| 143 | Ga0097621_100034375 | 3300006237 | Bacteria | 4044 |
| 144 | Ga0097621_100035931 | 3300006237 | Unclassified | 3960 |
| 145 | Ga0097621_100134194 | 3300006237 | Bacteria | 2110 |
| 146 | Ga0068871_100002567 | 3300006358 | Bacteria | 12404 |
| 147 | Ga0068871_100008100 | 3300006358 | Bacteria | 7544 |
| 148 | Ga0068871_100010053 | 3300006358 | Bacteria | 6880 |
| 149 | Ga0068871_100052861 | 3300006358 | Bacteria | 3291 |
| 150 | Ga0068871_100074980 | 3300006358 | Bacteria | 2792 |
| 151 | Ga0068871_100124752 | 3300006358 | Bacteria | 2178 |
| 152 | Ga0068871_100242605 | 3300006358 | Bacteria | 1567 |
| 153 | Ga0068871_100242870 | 3300006358 | Unclassified | 1566 |
| 154 | Ga0075434_100009056 | 3300006871 | Bacteria | 9272 |
| 155 | Ga0068865_100001094 | 3300006881 | Bacteria | 15637 |
| 156 | Ga0068865_100006917 | 3300006881 | Bacteria | 6954 |
| 157 | Ga0068865_100016931 | 3300006881 | Bacteria | 4677 |
| 158 | Ga0068865_100058475 | 3300006881 | Bacteria | 2693 |
| 159 | Ga0097620_100000045 | 3300006931 | Bacteria | 143607 |
| 160 | Ga0097620_100017677 | 3300006931 | Bacteria | 7169 |
| 161 | Ga0097620_100026115 | 3300006931 | Bacteria | 5858 |
| 162 | Ga0097620_100072356 | 3300006931 | Bacteria | 3484 |
| 163 | Ga0097620_100455542 | 3300006931 | Bacteria | 1375 |
| 164 | Ga0105240_10000472 | 3300009093 | Bacteria | 74359 |
| 165 | Ga0105240_10019870 | 3300009093 | Bacteria | 8972 |
| 166 | Ga0105240_10022478 | 3300009093 | Bacteria | 8358 |
| 167 | Ga0105240_10033401 | 3300009093 | Bacteria | 6647 |
| 168 | Ga0105240_10034849 | 3300009093 | Bacteria | 6489 |
| 169 | Ga0105240_10097824 | 3300009093 | Unclassified | 3575 |
| 170 | Ga0105240_10246023 | 3300009093 | Bacteria | 2071 |
| 171 | Ga0111539_10073279 | 3300009094 | Bacteria | 4038 |
| 172 | Ga0105245_10069796 | 3300009098 | Bacteria | 3187 |
| 173 | Ga0105245_10169907 | 3300009098 | Bacteria | 2076 |
| 174 | Ga0105247_10003520 | 3300009101 | Bacteria | 10181 |
| 175 | Ga0105247_10033980 | 3300009101 | Bacteria | 3105 |
| 176 | Ga0105247_10094027 | 3300009101 | Bacteria | 1906 |
| 177 | Ga0114129_10082403 | 3300009147 | Bacteria | 4470 |
| 178 | Ga0105243_10315371 | 3300009148 | Bacteria | 1423 |
| 179 | Ga0105241_10001733 | 3300009174 | Bacteria | 16555 |
| 180 | Ga0105241_10006485 | 3300009174 | Bacteria | 8628 |
| 181 | Ga0105241_10006681 | 3300009174 | Bacteria | 8489 |
| 182 | Ga0105241_10337605 | 3300009174 | Bacteria | 1304 |
| 183 | Ga0105242_10010544 | 3300009176 | Bacteria | 7096 |
| 184 | Ga0105242_10020808 | 3300009176 | Bacteria | 5146 |
| 185 | Ga0105242_10023228 | 3300009176 | Bacteria | 4888 |
| 186 | Ga0105242_10042593 | 3300009176 | Bacteria | 3667 |
| 187 | Ga0105242_10072142 | 3300009176 | Unclassified | 2867 |
| 188 | Ga0105248_10022859 | 3300009177 | Bacteria | 6942 |
| 189 | Ga0105248_10038321 | 3300009177 | Bacteria | 5364 |
| 190 | Ga0105237_10001767 | 3300009545 | Bacteria | 27942 |
| 191 | Ga0105237_10022501 | 3300009545 | Bacteria | 6466 |
| 192 | Ga0105237_10030614 | 3300009545 | Bacteria | 5465 |
| 193 | Ga0105237_10054400 | 3300009545 | Bacteria | 4010 |
| 194 | Ga0105237_10060266 | 3300009545 | Unclassified | 3797 |
| 195 | Ga0105237_10329180 | 3300009545 | Bacteria | 1532 |
| 196 | Ga0105238_10002017 | 3300009551 | Bacteria | 20488 |
| 197 | Ga0105238_10142233 | 3300009551 | Bacteria | 2375 |
| 198 | Ga0105249_10011083 | 3300009553 | Bacteria | 7922 |
| 199 | Ga0105249_10011427 | 3300009553 | Bacteria | 7799 |
| 200 | Ga0105249_10028339 | 3300009553 | Bacteria | 5055 |
| 201 | Ga0105249_10028806 | 3300009553 | Bacteria | 5013 |
| 202 | Ga0105249_10231433 | 3300009553 | Bacteria | 1823 |
| 203 | Ga0105249_10421385 | 3300009553 | Bacteria | 1369 |
| 204 | Ga0105239_10000155 | 3300010375 | Bacteria | 98415 |
| 205 | Ga0105239_10001180 | 3300010375 | Bacteria | 35825 |
| 206 | Ga0105239_10003358 | 3300010375 | Bacteria | 19664 |
| 207 | Ga0105239_10031409 | 3300010375 | Bacteria | 5841 |
| 208 | Ga0105239_10094105 | 3300010375 | Bacteria | 3309 |
| 209 | Ga0105239_10240194 | 3300010375 | Bacteria | 2033 |
| 210 | Ga0157373_10009844 | 3300013100 | Bacteria | 7047 |
| 211 | Ga0157371_10000284 | 3300013102 | Bacteria | 68549 |
| 212 | Ga0157371_10000725 | 3300013102 | Bacteria | 38633 |
| 213 | Ga0157371_10009503 | 3300013102 | Bacteria | 7649 |
| 214 | Ga0157371_10075116 | 3300013102 | Bacteria | 2393 |
| 215 | Ga0157371_10148051 | 3300013102 | Bacteria | 1674 |
| 216 | Ga0157370_10002079 | 3300013104 | Bacteria | 24513 |
| 217 | Ga0157370_10009358 | 3300013104 | Bacteria | 10483 |
| 218 | Ga0157370_10021147 | 3300013104 | Bacteria | 6488 |
| 219 | Ga0157370_10184844 | 3300013104 | Unclassified | 1935 |
| 220 | Ga0157369_10073809 | 3300013105 | Bacteria | 3659 |
| 221 | Ga0157369_10341159 | 3300013105 | Bacteria | 1556 |
| 222 | Ga0157369_10351240 | 3300013105 | Bacteria | 1531 |
| 223 | Ga0157369_10569704 | 3300013105 | Bacteria | 1170 |
| 224 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 225 | Ga0157374_10000260 | 3300013296 | Bacteria | 48732 |
| 226 | Ga0157374_10002980 | 3300013296 | Bacteria | 14179 |
| 227 | Ga0157374_10027083 | 3300013296 | Bacteria | 5166 |
| 228 | Ga0157374_10073925 | 3300013296 | Unclassified | 3217 |
| 229 | Ga0157374_10079023 | 3300013296 | Bacteria | 3116 |
| 230 | Ga0157374_10160909 | 3300013296 | Bacteria | 2187 |
| 231 | Ga0157374_10205062 | 3300013296 | Bacteria | 1932 |
| 232 | Ga0157378_10003039 | 3300013297 | Bacteria | 14913 |
| 233 | Ga0157378_10012828 | 3300013297 | Bacteria | 7335 |
| 234 | Ga0157378_10013251 | 3300013297 | Bacteria | 7209 |
| 235 | Ga0157378_10071685 | 3300013297 | Bacteria | 3112 |
| 236 | Ga0157378_10079114 | 3300013297 | Bacteria | 2968 |
| 237 | Ga0157378_10172195 | 3300013297 | Bacteria | 2031 |
| 238 | Ga0157378_10329934 | 3300013297 | Unclassified | 1485 |
| 239 | Ga0157378_10358304 | 3300013297 | Bacteria | 1427 |
| 240 | Ga0157378_10371125 | 3300013297 | Bacteria | 1403 |
| 241 | Ga0163162_10000312 | 3300013306 | Bacteria | 45022 |
| 242 | Ga0163162_10001336 | 3300013306 | Bacteria | 23007 |
| 243 | Ga0163162_10001523 | 3300013306 | Bacteria | 21599 |
| 244 | Ga0163162_10002647 | 3300013306 | Bacteria | 16974 |
| 245 | Ga0163162_10004060 | 3300013306 | Bacteria | 14047 |
| 246 | Ga0163162_10004258 | 3300013306 | Bacteria | 13763 |
| 247 | Ga0163162_10007829 | 3300013306 | Bacteria | 10415 |
| 248 | Ga0163162_10022439 | 3300013306 | Bacteria | 6218 |
| 249 | Ga0163162_10055604 | 3300013306 | Bacteria | 3985 |
| 250 | Ga0163162_10074114 | 3300013306 | Bacteria | 3462 |
| 251 | Ga0163162_10074490 | 3300013306 | Bacteria | 3454 |
| 252 | Ga0163162_10229514 | 3300013306 | Bacteria | 1986 |
| 253 | Ga0157372_10000741 | 3300013307 | Bacteria | 35589 |
| 254 | Ga0157372_10018758 | 3300013307 | Bacteria | 7443 |
| 255 | Ga0157372_10078712 | 3300013307 | Bacteria | 3726 |
| 256 | Ga0157372_10092124 | 3300013307 | Bacteria | 3447 |
| 257 | Ga0157372_10114317 | 3300013307 | Bacteria | 3094 |
| 258 | Ga0157372_10240973 | 3300013307 | Bacteria | 2099 |
| 259 | Ga0157372_10487144 | 3300013307 | Unclassified | 1438 |
| 260 | Ga0157375_10000686 | 3300013308 | Bacteria | 29989 |
| 261 | Ga0157375_10002871 | 3300013308 | Bacteria | 14932 |
| 262 | Ga0157375_10010009 | 3300013308 | Bacteria | 8337 |
| 263 | Ga0157375_10082885 | 3300013308 | Bacteria | 3250 |
| 264 | Ga0157375_10115825 | 3300013308 | Bacteria | 2783 |
| 265 | Ga0157375_10136431 | 3300013308 | Bacteria | 2577 |
| 266 | Ga0157375_10149918 | 3300013308 | Unclassified | 2467 |
| 267 | Ga0157375_10233750 | 3300013308 | Unclassified | 1997 |
| 268 | Ga0157375_10509143 | 3300013308 | Bacteria | 1368 |
| 269 | Ga0163163_10000279 | 3300014325 | Bacteria | 50882 |
| 270 | Ga0163163_10000346 | 3300014325 | Bacteria | 44619 |
| 271 | Ga0163163_10012583 | 3300014325 | Bacteria | 7718 |
| 272 | Ga0163163_10016396 | 3300014325 | Bacteria | 6884 |
| 273 | Ga0163163_10135642 | 3300014325 | Bacteria | 2502 |
| 274 | Ga0163163_10238436 | 3300014325 | Bacteria | 1868 |
| 275 | Ga0157380_10077609 | 3300014326 | Bacteria | 2707 |
| 276 | Ga0157380_10178655 | 3300014326 | Bacteria | 1863 |
| 277 | Ga0157377_10008716 | 3300014745 | Bacteria | 4957 |
| 278 | Ga0157377_10017063 | 3300014745 | Unclassified | 3750 |
| 279 | Ga0157379_10000242 | 3300014968 | Bacteria | 42795 |
| 280 | Ga0157379_10011127 | 3300014968 | Bacteria | 7844 |
| 281 | Ga0157379_10032372 | 3300014968 | Bacteria | 4662 |
| 282 | Ga0157379_10052461 | 3300014968 | Bacteria | 3643 |
| 283 | Ga0157379_10476069 | 3300014968 | Unclassified | 1155 |
| 284 | Ga0157376_10001139 | 3300014969 | Bacteria | 17447 |
| 285 | Ga0157376_10002821 | 3300014969 | Bacteria | 11880 |
| 286 | Ga0157376_10003968 | 3300014969 | Bacteria | 10230 |
| 287 | Ga0157376_10007029 | 3300014969 | Bacteria | 7989 |
| 288 | Ga0163161_10005088 | 3300017792 | Bacteria | 9153 |
| 289 | Ga0163161_10006224 | 3300017792 | Bacteria | 8270 |
| 290 | Ga0206352_10293594 | 3300020078 | Bacteria | 1379 |
| 291 | Ga0207697_10009658 | 3300025315 | Unclassified | 4156 |
| 292 | Ga0207656_10016708 | 3300025321 | Unclassified | 2861 |
| 293 | Ga0207656_10023113 | 3300025321 | Bacteria | 2500 |
| 294 | Ga0207682_10028902 | 3300025893 | Unclassified | 2215 |
| 295 | Ga0207642_10075620 | 3300025899 | Bacteria | 1618 |
| 296 | Ga0207710_10002713 | 3300025900 | Bacteria | 8106 |
| 297 | Ga0207688_10030435 | 3300025901 | Unclassified | 2976 |
| 298 | Ga0207680_10000141 | 3300025903 | Bacteria | 34433 |
| 299 | Ga0207680_10003927 | 3300025903 | Bacteria | 7016 |
| 300 | Ga0207680_10101793 | 3300025903 | Unclassified | 1847 |
| 301 | Ga0207647_10002819 | 3300025904 | Bacteria | 13115 |
| 302 | Ga0207647_10027231 | 3300025904 | Bacteria | 3729 |
| 303 | Ga0207645_10001794 | 3300025907 | Bacteria | 17325 |
| 304 | Ga0207645_10019981 | 3300025907 | Unclassified | 4384 |
| 305 | Ga0207645_10138505 | 3300025907 | Bacteria | 1585 |
| 306 | Ga0207645_10195010 | 3300025907 | Bacteria | 1332 |
| 307 | Ga0207705_10007257 | 3300025909 | Bacteria | 8155 |
| 308 | Ga0207705_10012513 | 3300025909 | Bacteria | 6127 |
| 309 | Ga0207705_10017600 | 3300025909 | Bacteria | 5114 |
| 310 | Ga0207705_10032755 | 3300025909 | Bacteria | 3714 |
| 311 | Ga0207705_10043803 | 3300025909 | Bacteria | 3215 |
| 312 | Ga0207654_10003695 | 3300025911 | Bacteria | 7718 |
| 313 | Ga0207654_10029613 | 3300025911 | Unclassified | 3000 |
| 314 | Ga0207707_10270127 | 3300025912 | Unclassified | 1474 |
| 315 | Ga0207695_10000282 | 3300025913 | Bacteria | 126242 |
| 316 | Ga0207695_10001688 | 3300025913 | Bacteria | 35472 |
| 317 | Ga0207695_10004070 | 3300025913 | Bacteria | 20110 |
| 318 | Ga0207695_10028517 | 3300025913 | Bacteria | 6188 |
| 319 | Ga0207695_10059033 | 3300025913 | Bacteria | 3980 |
| 320 | Ga0207695_10064026 | 3300025913 | Unclassified | 3788 |
| 321 | Ga0207671_10011688 | 3300025914 | Bacteria | 7117 |
| 322 | Ga0207671_10011870 | 3300025914 | Bacteria | 7049 |
| 323 | Ga0207671_10019242 | 3300025914 | Bacteria | 5224 |
| 324 | Ga0207671_10072568 | 3300025914 | Unclassified | 2569 |
| 325 | Ga0207671_10160588 | 3300025914 | Unclassified | 1740 |
| 326 | Ga0207662_10021541 | 3300025918 | Bacteria | 3686 |
| 327 | Ga0207657_10023896 | 3300025919 | Bacteria | 5676 |
| 328 | Ga0207649_10007908 | 3300025920 | Bacteria | 5787 |
| 329 | Ga0207652_10000045 | 3300025921 | Bacteria | 125343 |
| 330 | Ga0207652_10025521 | 3300025921 | Bacteria | 4915 |
| 331 | Ga0207681_10011577 | 3300025923 | Bacteria | 5419 |
| 332 | Ga0207681_10017517 | 3300025923 | Unclassified | 4499 |
| 333 | Ga0207694_10033341 | 3300025924 | Bacteria | 3945 |
| 334 | Ga0207694_10057411 | 3300025924 | Unclassified | 3026 |
| 335 | Ga0207650_10002954 | 3300025925 | Bacteria | 11729 |
| 336 | Ga0207650_10015410 | 3300025925 | Bacteria | 5323 |
| 337 | Ga0207650_10102229 | 3300025925 | Bacteria | 2208 |
| 338 | Ga0207687_10116816 | 3300025927 | Bacteria | 1989 |
| 339 | Ga0207644_10036096 | 3300025931 | Unclassified | 3468 |
| 340 | Ga0207644_10128751 | 3300025931 | Bacteria | 1935 |
| 341 | Ga0207690_10011163 | 3300025932 | Bacteria | 5361 |
| 342 | Ga0207690_10255535 | 3300025932 | Bacteria | 1355 |
| 343 | Ga0207706_10003994 | 3300025933 | Bacteria | 13976 |
| 344 | Ga0207706_10022319 | 3300025933 | Bacteria | 5679 |
| 345 | Ga0207706_10059068 | 3300025933 | Bacteria | 3378 |
| 346 | Ga0207686_10165759 | 3300025934 | Unclassified | 1553 |
| 347 | Ga0207686_10202293 | 3300025934 | Bacteria | 1423 |
| 348 | Ga0207709_10146863 | 3300025935 | Unclassified | 1628 |
| 349 | Ga0207670_10006784 | 3300025936 | Bacteria | 6368 |
| 350 | Ga0207670_10070587 | 3300025936 | Bacteria | 2413 |
| 351 | Ga0207669_10102711 | 3300025937 | Bacteria | 1894 |
| 352 | Ga0207669_10110333 | 3300025937 | Bacteria | 1842 |
| 353 | Ga0207704_10009869 | 3300025938 | Bacteria | 4628 |
| 354 | Ga0207704_10201391 | 3300025938 | Bacteria | 1457 |
| 355 | Ga0207691_10000012 | 3300025940 | Bacteria | 147942 |
| 356 | Ga0207691_10004759 | 3300025940 | Bacteria | 13125 |
| 357 | Ga0207691_10176593 | 3300025940 | Bacteria | 1868 |
| 358 | Ga0207689_10008936 | 3300025942 | Bacteria | 8687 |
| 359 | Ga0207689_10009466 | 3300025942 | Bacteria | 8410 |
| 360 | Ga0207689_10017516 | 3300025942 | Bacteria | 6060 |
| 361 | Ga0207689_10018137 | 3300025942 | Bacteria | 5944 |
| 362 | Ga0207689_10030002 | 3300025942 | Bacteria | 4534 |
| 363 | Ga0207689_10041033 | 3300025942 | Unclassified | 3829 |
| 364 | Ga0207689_10301278 | 3300025942 | Bacteria | 1329 |
| 365 | Ga0207661_10004722 | 3300025944 | Bacteria | 9540 |
| 366 | Ga0207679_10017260 | 3300025945 | Unclassified | 4811 |
| 367 | Ga0207679_10169190 | 3300025945 | Bacteria | 1797 |
| 368 | Ga0207679_10233787 | 3300025945 | Bacteria | 1554 |
| 369 | Ga0207667_10000643 | 3300025949 | Bacteria | 45271 |
| 370 | Ga0207667_10012455 | 3300025949 | Bacteria | 9797 |
| 371 | Ga0207667_10026076 | 3300025949 | Bacteria | 6391 |
| 372 | Ga0207667_10034450 | 3300025949 | Bacteria | 5437 |
| 373 | Ga0207667_10045123 | 3300025949 | Bacteria | 4669 |
| 374 | Ga0207667_10132420 | 3300025949 | Bacteria | 2568 |
| 375 | Ga0207651_10000216 | 3300025960 | Bacteria | 24808 |
| 376 | Ga0207651_10064393 | 3300025960 | Bacteria | 2566 |
| 377 | Ga0207651_10108714 | 3300025960 | Bacteria | 2076 |
| 378 | Ga0207651_10159616 | 3300025960 | Unclassified | 1766 |
| 379 | Ga0207712_10010440 | 3300025961 | Bacteria | 5896 |
| 380 | Ga0207712_10022982 | 3300025961 | Bacteria | 4111 |
| 381 | Ga0207712_10027659 | 3300025961 | Bacteria | 3788 |
| 382 | Ga0207712_10076659 | 3300025961 | Bacteria | 2421 |
| 383 | Ga0207668_10001361 | 3300025972 | Bacteria | 14445 |
| 384 | Ga0207640_10014955 | 3300025981 | Bacteria | 4480 |
| 385 | Ga0207640_10178269 | 3300025981 | Unclassified | 1591 |
| 386 | Ga0207658_10000374 | 3300025986 | Bacteria | 43784 |
| 387 | Ga0207658_10008025 | 3300025986 | Bacteria | 7193 |
| 388 | Ga0207658_10033838 | 3300025986 | Unclassified | 3648 |
| 389 | Ga0207658_10057016 | 3300025986 | Bacteria | 2901 |
| 390 | Ga0207658_10058596 | 3300025986 | Bacteria | 2867 |
| 391 | Ga0207658_10108421 | 3300025986 | Bacteria | 2190 |
| 392 | Ga0207677_10000984 | 3300026023 | Bacteria | 15691 |
| 393 | Ga0207677_10006012 | 3300026023 | Bacteria | 6614 |
| 394 | Ga0207677_10018387 | 3300026023 | Unclassified | 4193 |
| 395 | Ga0207703_10019138 | 3300026035 | Bacteria | 5348 |
| 396 | Ga0207703_10035352 | 3300026035 | Bacteria | 3970 |
| 397 | Ga0207703_10185998 | 3300026035 | Bacteria | 1836 |
| 398 | Ga0207639_10002390 | 3300026041 | Bacteria | 12590 |
| 399 | Ga0207639_10032242 | 3300026041 | Unclassified | 3856 |
| 400 | Ga0207678_10013503 | 3300026067 | Bacteria | 7170 |
| 401 | Ga0207678_10031808 | 3300026067 | Unclassified | 4601 |
| 402 | Ga0207702_10025199 | 3300026078 | Bacteria | 4936 |
| 403 | Ga0207702_10026475 | 3300026078 | Bacteria | 4814 |
| 404 | Ga0207641_10000133 | 3300026088 | Bacteria | 109199 |
| 405 | Ga0207648_10010253 | 3300026089 | Bacteria | 8899 |
| 406 | Ga0207648_10027821 | 3300026089 | Bacteria | 5016 |
| 407 | Ga0207648_10056263 | 3300026089 | Bacteria | 3433 |
| 408 | Ga0207648_10067242 | 3300026089 | Bacteria | 3125 |
| 409 | Ga0207648_10083158 | 3300026089 | Bacteria | 2792 |
| 410 | Ga0207648_10164609 | 3300026089 | Bacteria | 1959 |
| 411 | Ga0207676_10000697 | 3300026095 | Bacteria | 26479 |
| 412 | Ga0207676_10005018 | 3300026095 | Bacteria | 9372 |
| 413 | Ga0207674_10001630 | 3300026116 | Bacteria | 28871 |
| 414 | Ga0207674_10014867 | 3300026116 | Bacteria | 8583 |
| 415 | Ga0207675_100005430 | 3300026118 | Bacteria | 12213 |
| 416 | Ga0207675_100034881 | 3300026118 | Bacteria | 4691 |
| 417 | Ga0207675_100095057 | 3300026118 | Bacteria | 2803 |
| 418 | Ga0207683_10002013 | 3300026121 | Bacteria | 17984 |
| 419 | Ga0207683_10025467 | 3300026121 | Bacteria | 5105 |
| 420 | Ga0207683_10025629 | 3300026121 | Bacteria | 5088 |
| 421 | Ga0207683_10107571 | 3300026121 | Bacteria | 2495 |
| 422 | Ga0207698_10003512 | 3300026142 | Bacteria | 9452 |
| 423 | Ga0207698_10009340 | 3300026142 | Bacteria | 6249 |
| 424 | Ga0207698_10014863 | 3300026142 | Bacteria | 5190 |
| 425 | Ga0207698_10032463 | 3300026142 | Bacteria | 3782 |
| 426 | Ga0207698_10034087 | 3300026142 | Bacteria | 3707 |
| 427 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 428 | Ga0268266_10005379 | 3300028379 | Bacteria | 11960 |
| 429 | Ga0268266_10035267 | 3300028379 | Unclassified | 4255 |
| 430 | Ga0268266_10332080 | 3300028379 | Bacteria | 1425 |
| 431 | Ga0268265_10009351 | 3300028380 | Bacteria | 6624 |
| 432 | Ga0268265_10316991 | 3300028380 | Bacteria | 1410 |
| 433 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 434 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 435 | Ga0268264_10000054 | 3300028381 | Bacteria | 317048 |
| 436 | Ga0268264_10003975 | 3300028381 | Bacteria | 12651 |
| 437 | Ga0268264_10008390 | 3300028381 | Bacteria | 8589 |
| 438 | Ga0268264_10008474 | 3300028381 | Bacteria | 8550 |
| 439 | Ga0268264_10008570 | 3300028381 | Bacteria | 8500 |
| 440 | Ga0268264_10008865 | 3300028381 | Bacteria | 8337 |
| 441 | Ga0268264_10011860 | 3300028381 | Bacteria | 7180 |
| 442 | Ga0268264_10046760 | 3300028381 | Unclassified | 3595 |
| 443 | Ga0307515_10000024 | 3300028794 | Bacteria | 393119 |
| 444 | Ga0307511_10000228 | 3300030521 | Bacteria | 57237 |
| 445 | Ga0307513_10168728 | 3300031456 | Unclassified | 2069 |
| 446 | Ga0307513_10202106 | 3300031456 | Bacteria | 1827 |
| 447 | Ga0307509_10015498 | 3300031507 | Bacteria | 8889 |
| 448 | Ga0307509_10171864 | 3300031507 | Bacteria | 2045 |
| 449 | Ga0307509_10255934 | 3300031507 | Bacteria | 1530 |
| 450 | Ga0307508_10001024 | 3300031616 | Bacteria | 32462 |
| 451 | Ga0307508_10218480 | 3300031616 | Bacteria | 1506 |
| 452 | Ga0307516_10033259 | 3300031730 | Bacteria | 5188 |
| 453 | Ga0307405_10005405 | 3300031731 | Bacteria | 6160 |
| 454 | Ga0307413_10008468 | 3300031824 | Bacteria | 4858 |
| 455 | Ga0307411_10061340 | 3300032005 | Bacteria | 2503 |
| 456 | Ga0307510_10017333 | 3300033180 | Bacteria | 8497 |
| 457 | Ga0373943_0085951 | 3300035170 | Bacteria | 1621 |
| 458 | Ga0373955_0056898 | 3300035172 | Unclassified | 2147 |
| 459 | Ga0373937_0006671 | 3300036401 | Bacteria | 9965 |
| 460 | Ga0373937_0339533 | 3300036401 | Unclassified | 1422 |
| 461 | Ga0395899_0007489 | 3300037312 | Bacteria | 8432 |
| 462 | Ga0395899_0061852 | 3300037312 | Bacteria | 2757 |
| 463 | Ga0395899_0063013 | 3300037312 | Bacteria | 2729 |
| 464 | Ga0395900_0004195 | 3300037418 | Bacteria | 15298 |
| 465 | Ga0395900_0008499 | 3300037418 | Bacteria | 10554 |
| 466 | Ga0395898_0003718 | 3300037466 | Bacteria | 16922 |
| 467 | Ga0395898_0013466 | 3300037466 | Bacteria | 8421 |
| 468 | Ga0395898_0081915 | 3300037466 | Bacteria | 3111 |
| 469 | Ga0395905_0289476 | 3300037471 | Bacteria | 1525 |
| 470 | Ga0395901_0005062 | 3300038443 | Bacteria | 13315 |
| 471 | Ga0395901_0028050 | 3300038443 | Bacteria | 5790 |
| 472 | Ga0395901_0090262 | 3300038443 | Bacteria | 3207 |
| 473 | Ga0451798_0707333 | 3300041458 | Bacteria | 1309 |
| 474 | Ga0451839_0329258 | 3300041496 | Bacteria | 1383 |
| 475 | Ga0451841_0745731 | 3300041498 | Bacteria | 1596 |
| 476 | Ga0439433_0015436 | 3300041999 | Bacteria | 1686 |
| 477 | Ga0439449_0015494 | 3300042007 | Bacteria | 2865 |
| 478 | Ga0439457_000930 | 3300042014 | Bacteria | 8796 |
| 479 | Ga0439462_0006134 | 3300042015 | Bacteria | 2979 |
| 480 | Ga0466969_0000004 | 3300044656 | Bacteria | 168068 |
| 481 | Ga0466969_0153723 | 3300044656 | Bacteria | 1059 |
| 482 | Ga0466972_0000017 | 3300044658 | Bacteria | 199884 |
| 483 | Ga0466966_0000295 | 3300044684 | Bacteria | 32723 |
| 484 | Ga0453684_0266906 | 3300044712 | Bacteria | 1958 |
| 485 | Ga0466968_0035018 | 3300044735 | Bacteria | 2099 |
| 486 | Ga0466957_0000367 | 3300044842 | Bacteria | 22106 |
| 487 | Ga0466957_0015326 | 3300044842 | Bacteria | 4479 |
| 488 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 489 | Ga0495638_0033016 | 3300046460 | Bacteria | 3311 |
| 490 | Ga0495653_0060576 | 3300046463 | Bacteria | 2867 |
| 491 | Ga0495650_0053440 | 3300046471 | Unclassified | 1654 |
| 492 | Ga0495580_0042202 | 3300046472 | Bacteria | 3251 |
| 493 | Ga0495580_0075482 | 3300046472 | Unclassified | 2352 |
| 494 | Ga0495582_0032503 | 3300046473 | Unclassified | 2869 |
| 495 | Ga0495606_0003341 | 3300046507 | Bacteria | 17112 |
| 496 | Ga0495608_0067439 | 3300046511 | Bacteria | 2340 |
| 497 | Ga0495628_0022064 | 3300046516 | Bacteria | 5233 |
| 498 | Ga0495630_0011846 | 3300046517 | Bacteria | 6319 |
| 499 | Ga0495648_0002002 | 3300046524 | Bacteria | 19295 |
| 500 | Ga0495652_0129351 | 3300046529 | Bacteria | 2001 |
| 501 | Ga0495586_0009224 | 3300046535 | Bacteria | 5247 |
| 502 | Ga0495586_0158828 | 3300046535 | Unclassified | 1274 |
| 503 | Ga0495587_0025753 | 3300046536 | Bacteria | 3594 |
| 504 | Ga0495633_0024540 | 3300046558 | Bacteria | 2979 |
| 505 | Ga0495667_0034520 | 3300046559 | Bacteria | 3383 |
| 506 | Ga0495668_0001697 | 3300046616 | Bacteria | 20372 |
| 507 | Ga0495625_0043549 | 3300046660 | Unclassified | 3255 |
| 508 | Ga0495658_0016941 | 3300046683 | Unclassified | 3756 |
| 509 | Ga0495649_0026980 | 3300046694 | Bacteria | 3189 |
| 510 | Ga0495600_0075759 | 3300046809 | Unclassified | 2197 |
| 511 | Ga0495636_0000184 | 3300047318 | Bacteria | 24852 |
| 512 | Ga0495674_0034710 | 3300047319 | Unclassified | 4558 |
| 513 | Ga0495672_0052934 | 3300047320 | Bacteria | 2382 |
| 514 | Ga0495676_0186767 | 3300047321 | Bacteria | 1448 |
| 515 | Ga0495680_0037499 | 3300047322 | Bacteria | 3882 |
| 516 | Ga0495687_000031 | 3300047443 | Bacteria | 274659 |
| 517 | Ga0495675_0172955 | 3300047444 | Bacteria | 1326 |
| 518 | Ga0495684_0053521 | 3300047471 | Unclassified | 3080 |
| 519 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 520 | Ga0496100_0141985 | 3300048903 | Unclassified | 1703 |
| 521 | Ga0496104_0313801 | 3300048907 | Bacteria | 1481 |
| 522 | Ga0496109_0192296 | 3300048912 | Bacteria | 1918 |
| 523 | Ga0496109_0429066 | 3300048912 | Unclassified | 1249 |
| 524 | Ga0496110_0019814 | 3300048913 | Bacteria | 5669 |
| 525 | Ga0496115_0241398 | 3300048918 | Bacteria | 1489 |
| 526 | Ga0501298_011202 | 3300049521 | Unclassified | 1554 |
| 527 | Ga0501034_0022151 | 3300049571 | Bacteria | 6473 |
| 528 | Ga0501036_0094061 | 3300049572 | Unclassified | 2533 |
| 529 | Ga0501198_003248 | 3300049649 | Bacteria | 2217 |
| 530 | Ga0501223_015144 | 3300049663 | Bacteria | 1528 |
| 531 | Ga0501233_024237 | 3300049668 | Bacteria | 1326 |
| 532 | Ga0501242_000722 | 3300049674 | Unclassified | 3057 |
| 533 | Ga0501243_002907 | 3300049675 | Bacteria | 2521 |
| 534 | Ga0501251_001781 | 3300049681 | Bacteria | 2025 |
| 535 | Ga0501257_007725 | 3300049686 | Bacteria | 2406 |
| 536 | Ga0501221_008146 | 3300049704 | Bacteria | 1816 |
| 537 | Ga0501221_014661 | 3300049704 | Bacteria | 1461 |
| 538 | Ga0501225_0006624 | 3300049705 | Bacteria | 3379 |
| 539 | Ga0501266_003910 | 3300049763 | Bacteria | 1844 |
| 540 | Ga0501044_0006478 | 3300049823 | Bacteria | 12931 |
| 541 | nmdc:mga05p37_2793_c1 | 3300050507 | Bacteria | 20304 |
| 542 | Ga0495619_0042013 | 3300053085 | Unclassified | 2993 |
| 543 | Ga0500583_0000068 | 3300053092 | Bacteria | 64748 |
| 544 | Ga0500583_0001499 | 3300053092 | Bacteria | 6719 |
| 545 | Ga0500568_0007023 | 3300053139 | Bacteria | 5570 |
| 546 | Ga0500603_027821 | 3300053150 | Bacteria | 1439 |
| 547 | Ga0500616_0006698 | 3300053153 | Bacteria | 7477 |
| 548 | Ga0500616_0026690 | 3300053153 | Unclassified | 3195 |
| 549 | Ga0500622_0000926 | 3300053156 | Bacteria | 24930 |
| 550 | Ga0500622_0046200 | 3300053156 | Bacteria | 2252 |
| 551 | Ga0500636_0053601 | 3300053177 | Bacteria | 2367 |
| 552 | Ga0500637_0076844 | 3300053178 | Bacteria | 1926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044656 | Ga0466969_0153723 | Ga0466969_0153723_41_1018 | 325 |
| 2 | 3300025914 | Ga0207671_10160588 | Ga0207671_101605882 | 331 |
| 3 | 3300005327 | Ga0070658_10081985 | Ga0070658_100819853 | 333 |
| 4 | 3300005339 | Ga0070660_100020321 | Ga0070660_1000203213 | 333 |
| 5 | 3300005530 | Ga0070679_100136389 | Ga0070679_1001363893 | 333 |
| 6 | 3300005578 | Ga0068854_100282405 | Ga0068854_1002824052 | 333 |
| 7 | 3300005614 | Ga0068856_100339680 | Ga0068856_1003396802 | 333 |
| 8 | 3300005616 | Ga0068852_100000848 | Ga0068852_1000008488 | 333 |
| 9 | 3300005718 | Ga0068866_10082359 | Ga0068866_100823592 | 333 |
| 10 | 3300005843 | Ga0068860_100015775 | Ga0068860_1000157753 | 333 |
| 11 | 3300025899 | Ga0207642_10075620 | Ga0207642_100756202 | 333 |
| 12 | 3300025909 | Ga0207705_10012513 | Ga0207705_100125134 | 333 |
| 13 | 3300025921 | Ga0207652_10025521 | Ga0207652_100255213 | 333 |
| 14 | 3300026142 | Ga0207698_10034087 | Ga0207698_100340873 | 333 |
| 15 | 3300028381 | Ga0268264_10011860 | Ga0268264_100118606 | 333 |
| 16 | 3300005331 | Ga0070670_100103503 | Ga0070670_1001035033 | 335 |
| 17 | 3300014325 | Ga0163163_10238436 | Ga0163163_102384362 | 335 |
| 18 | 3300025925 | Ga0207650_10002954 | Ga0207650_100029543 | 335 |
| 19 | 3300041999 | Ga0439433_0015436 | Ga0439433_0015436_443_1453 | 335 |
| 20 | 3300042007 | Ga0439449_0015494 | Ga0439449_0015494_1243_2253 | 335 |
| 21 | 3300006237 | Ga0097621_100000499 | Ga0097621_10000049915 | 337 |
| 22 | 3300006358 | Ga0068871_100002567 | Ga0068871_10000256710 | 337 |
| 23 | 3300048903 | Ga0496100_0141985 | Ga0496100_0141985_296_1312 | 337 |
| 24 | 3300005354 | Ga0070675_100167321 | Ga0070675_1001673211 | 338 |
| 25 | 3300005544 | Ga0070686_100036727 | Ga0070686_1000367271 | 338 |
| 26 | 3300005617 | Ga0068859_100017677 | Ga0068859_10001767710 | 338 |
| 27 | 3300006931 | Ga0097620_100017677 | Ga0097620_10001767710 | 338 |
| 28 | 3300009545 | Ga0105237_10329180 | Ga0105237_103291802 | 338 |
| 29 | 3300009553 | Ga0105249_10421385 | Ga0105249_104213852 | 338 |
| 30 | 3300013296 | Ga0157374_10000260 | Ga0157374_1000026035 | 338 |
| 31 | 3300013306 | Ga0163162_10004060 | Ga0163162_100040608 | 338 |
| 32 | 3300013306 | Ga0163162_10229514 | Ga0163162_102295142 | 338 |
| 33 | 3300013308 | Ga0157375_10115825 | Ga0157375_101158253 | 338 |
| 34 | 3300014325 | Ga0163163_10000279 | Ga0163163_1000027911 | 338 |
| 35 | 3300014745 | Ga0157377_10008716 | Ga0157377_100087162 | 338 |
| 36 | 3300014968 | Ga0157379_10476069 | Ga0157379_104760691 | 338 |
| 37 | 3300025940 | Ga0207691_10176593 | Ga0207691_101765932 | 338 |
| 38 | 3300035170 | Ga0373943_0085951 | Ga0373943_0085951_471_1487 | 338 |
| 39 | 3300041496 | Ga0451839_0329258 | Ga0451839_0329258_83_1099 | 338 |
| 40 | 3300046472 | Ga0495580_0042202 | Ga0495580_0042202_1385_2401 | 338 |
| 41 | 3300047320 | Ga0495672_0052934 | Ga0495672_0052934_1103_2119 | 338 |
| 42 | 3300047321 | Ga0495676_0186767 | Ga0495676_0186767_352_1368 | 338 |
| 43 | 3300048912 | Ga0496109_0429066 | Ga0496109_0429066_199_1215 | 338 |
| 44 | 3300048913 | Ga0496110_0019814 | Ga0496110_0019814_3335_4351 | 338 |
| 45 | 3300005327 | Ga0070658_10048378 | Ga0070658_100483783 | 339 |
| 46 | 3300005328 | Ga0070676_10004865 | Ga0070676_100048652 | 339 |
| 47 | 3300005331 | Ga0070670_100053373 | Ga0070670_1000533733 | 339 |
| 48 | 3300005334 | Ga0068869_100108650 | Ga0068869_1001086502 | 339 |
| 49 | 3300005335 | Ga0070666_10118377 | Ga0070666_101183772 | 339 |
| 50 | 3300005338 | Ga0068868_100003257 | Ga0068868_1000032577 | 339 |
| 51 | 3300005339 | Ga0070660_100078196 | Ga0070660_1000781962 | 339 |
| 52 | 3300005356 | Ga0070674_100158238 | Ga0070674_1001582382 | 339 |
| 53 | 3300005365 | Ga0070688_100069983 | Ga0070688_1000699832 | 339 |
| 54 | 3300005367 | Ga0070667_100011432 | Ga0070667_1000114327 | 339 |
| 55 | 3300005456 | Ga0070678_100075904 | Ga0070678_1000759044 | 339 |
| 56 | 3300005458 | Ga0070681_10035209 | Ga0070681_100352096 | 339 |
| 57 | 3300005459 | Ga0068867_100066748 | Ga0068867_1000667482 | 339 |
| 58 | 3300005539 | Ga0068853_100128415 | Ga0068853_1001284152 | 339 |
| 59 | 3300005548 | Ga0070665_100000018 | Ga0070665_100000018147 | 339 |
| 60 | 3300005548 | Ga0070665_100076193 | Ga0070665_1000761933 | 339 |
| 61 | 3300005563 | Ga0068855_100019495 | Ga0068855_1000194957 | 339 |
| 62 | 3300005578 | Ga0068854_100026109 | Ga0068854_1000261093 | 339 |
| 63 | 3300005578 | Ga0068854_100147904 | Ga0068854_1001479042 | 339 |
| 64 | 3300005578 | Ga0068854_100231846 | Ga0068854_1002318462 | 339 |
| 65 | 3300005614 | Ga0068856_100044643 | Ga0068856_1000446433 | 339 |
| 66 | 3300005614 | Ga0068856_100126812 | Ga0068856_1001268122 | 339 |
| 67 | 3300005616 | Ga0068852_100008024 | Ga0068852_1000080245 | 339 |
| 68 | 3300005617 | Ga0068859_100026115 | Ga0068859_1000261156 | 339 |
| 69 | 3300005718 | Ga0068866_10089437 | Ga0068866_100894372 | 339 |
| 70 | 3300005719 | Ga0068861_100235088 | Ga0068861_1002350882 | 339 |
| 71 | 3300005843 | Ga0068860_100000040 | Ga0068860_100000040188 | 339 |
| 72 | 3300005843 | Ga0068860_100039499 | Ga0068860_1000394995 | 339 |
| 73 | 3300006237 | Ga0097621_100035931 | Ga0097621_1000359313 | 339 |
| 74 | 3300006358 | Ga0068871_100008100 | Ga0068871_1000081003 | 339 |
| 75 | 3300006881 | Ga0068865_100006917 | Ga0068865_1000069175 | 339 |
| 76 | 3300006931 | Ga0097620_100026115 | Ga0097620_1000261156 | 339 |
| 77 | 3300009093 | Ga0105240_10019870 | Ga0105240_100198704 | 339 |
| 78 | 3300009093 | Ga0105240_10022478 | Ga0105240_100224787 | 339 |
| 79 | 3300009093 | Ga0105240_10097824 | Ga0105240_100978242 | 339 |
| 80 | 3300009176 | Ga0105242_10023228 | Ga0105242_100232282 | 339 |
| 81 | 3300009545 | Ga0105237_10001767 | Ga0105237_1000176720 | 339 |
| 82 | 3300009545 | Ga0105237_10060266 | Ga0105237_100602662 | 339 |
| 83 | 3300010375 | Ga0105239_10001180 | Ga0105239_100011805 | 339 |
| 84 | 3300013102 | Ga0157371_10148051 | Ga0157371_101480512 | 339 |
| 85 | 3300013104 | Ga0157370_10009358 | Ga0157370_100093587 | 339 |
| 86 | 3300013105 | Ga0157369_10073809 | Ga0157369_100738092 | 339 |
| 87 | 3300013105 | Ga0157369_10351240 | Ga0157369_103512402 | 339 |
| 88 | 3300013297 | Ga0157378_10329934 | Ga0157378_103299342 | 339 |
| 89 | 3300013297 | Ga0157378_10358304 | Ga0157378_103583042 | 339 |
| 90 | 3300013297 | Ga0157378_10371125 | Ga0157378_103711251 | 339 |
| 91 | 3300013306 | Ga0163162_10001336 | Ga0163162_100013365 | 339 |
| 92 | 3300013307 | Ga0157372_10000741 | Ga0157372_100007415 | 339 |
| 93 | 3300025893 | Ga0207682_10028902 | Ga0207682_100289022 | 339 |
| 94 | 3300025901 | Ga0207688_10030435 | Ga0207688_100304351 | 339 |
| 95 | 3300025903 | Ga0207680_10101793 | Ga0207680_101017932 | 339 |
| 96 | 3300025904 | Ga0207647_10002819 | Ga0207647_100028196 | 339 |
| 97 | 3300025907 | Ga0207645_10019981 | Ga0207645_100199812 | 339 |
| 98 | 3300025909 | Ga0207705_10032755 | Ga0207705_100327553 | 339 |
| 99 | 3300025912 | Ga0207707_10270127 | Ga0207707_102701272 | 339 |
| 100 | 3300025913 | Ga0207695_10028517 | Ga0207695_100285175 | 339 |
| 101 | 3300025914 | Ga0207671_10019242 | Ga0207671_100192423 | 339 |
| 102 | 3300025918 | Ga0207662_10021541 | Ga0207662_100215413 | 339 |
| 103 | 3300025923 | Ga0207681_10017517 | Ga0207681_100175172 | 339 |
| 104 | 3300025924 | Ga0207694_10033341 | Ga0207694_100333414 | 339 |
| 105 | 3300025931 | Ga0207644_10036096 | Ga0207644_100360964 | 339 |
| 106 | 3300025932 | Ga0207690_10011163 | Ga0207690_100111633 | 339 |
| 107 | 3300025934 | Ga0207686_10165759 | Ga0207686_101657592 | 339 |
| 108 | 3300025937 | Ga0207669_10102711 | Ga0207669_101027112 | 339 |
| 109 | 3300025940 | Ga0207691_10004759 | Ga0207691_100047595 | 339 |
| 110 | 3300025942 | Ga0207689_10018137 | Ga0207689_100181372 | 339 |
| 111 | 3300025942 | Ga0207689_10041033 | Ga0207689_100410333 | 339 |
| 112 | 3300025949 | Ga0207667_10000643 | Ga0207667_1000064312 | 339 |
| 113 | 3300025960 | Ga0207651_10159616 | Ga0207651_101596162 | 339 |
| 114 | 3300025961 | Ga0207712_10022982 | Ga0207712_100229825 | 339 |
| 115 | 3300025981 | Ga0207640_10178269 | Ga0207640_101782692 | 339 |
| 116 | 3300025986 | Ga0207658_10033838 | Ga0207658_100338383 | 339 |
| 117 | 3300026041 | Ga0207639_10032242 | Ga0207639_100322424 | 339 |
| 118 | 3300026078 | Ga0207702_10025199 | Ga0207702_100251994 | 339 |
| 119 | 3300026089 | Ga0207648_10027821 | Ga0207648_100278215 | 339 |
| 120 | 3300026116 | Ga0207674_10001630 | Ga0207674_1000163011 | 339 |
| 121 | 3300026118 | Ga0207675_100095057 | Ga0207675_1000950573 | 339 |
| 122 | 3300026121 | Ga0207683_10002013 | Ga0207683_1000201313 | 339 |
| 123 | 3300026121 | Ga0207683_10107571 | Ga0207683_101075712 | 339 |
| 124 | 3300026142 | Ga0207698_10032463 | Ga0207698_100324633 | 339 |
| 125 | 3300028379 | Ga0268266_10000026 | Ga0268266_10000026214 | 339 |
| 126 | 3300028379 | Ga0268266_10035267 | Ga0268266_100352673 | 339 |
| 127 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015111 | 339 |
| 128 | 3300028381 | Ga0268264_10000054 | Ga0268264_10000054162 | 339 |
| 129 | 3300028381 | Ga0268264_10046760 | Ga0268264_100467602 | 339 |
| 130 | 3300031507 | Ga0307509_10255934 | Ga0307509_102559342 | 339 |
| 131 | 3300031730 | Ga0307516_10033259 | Ga0307516_100332592 | 339 |
| 132 | 3300033180 | Ga0307510_10017333 | Ga0307510_100173338 | 339 |
| 133 | 3300037312 | Ga0395899_0061852 | Ga0395899_0061852_64_1089 | 339 |
| 134 | 3300037466 | Ga0395898_0013466 | Ga0395898_0013466_2261_3286 | 339 |
| 135 | 3300037471 | Ga0395905_0289476 | Ga0395905_0289476_396_1421 | 339 |
| 136 | 3300038443 | Ga0395901_0028050 | Ga0395901_0028050_85_1110 | 339 |
| 137 | 3300044735 | Ga0466968_0035018 | Ga0466968_0035018_366_1385 | 339 |
| 138 | 3300044842 | Ga0466957_0015326 | Ga0466957_0015326_1600_2625 | 339 |
| 139 | 3300046460 | Ga0495638_0033016 | Ga0495638_0033016_1638_2663 | 339 |
| 140 | 3300046471 | Ga0495650_0053440 | Ga0495650_0053440_611_1633 | 339 |
| 141 | 3300046507 | Ga0495606_0003341 | Ga0495606_0003341_12424_13443 | 339 |
| 142 | 3300046524 | Ga0495648_0002002 | Ga0495648_0002002_13034_14059 | 339 |
| 143 | 3300047443 | Ga0495687_000031 | Ga0495687_000031_128429_129454 | 339 |
| 144 | 3300047444 | Ga0495675_0172955 | Ga0495675_0172955_25_1047 | 339 |
| 145 | 3300049521 | Ga0501298_011202 | Ga0501298_011202_173_1195 | 339 |
| 146 | 3300049649 | Ga0501198_003248 | Ga0501198_003248_804_1826 | 339 |
| 147 | 3300049704 | Ga0501221_008146 | Ga0501221_008146_169_1191 | 339 |
| 148 | 3300049705 | Ga0501225_0006624 | Ga0501225_0006624_824_1846 | 339 |
| 149 | 3300049763 | Ga0501266_003910 | Ga0501266_003910_527_1549 | 339 |
| 150 | 3300049823 | Ga0501044_0006478 | Ga0501044_0006478_2838_3863 | 339 |
| 151 | 3300053156 | Ga0500622_0000926 | Ga0500622_0000926_21806_22831 | 339 |
| 152 | 3300005331 | Ga0070670_100236328 | Ga0070670_1002363281 | 340 |
| 153 | 3300005367 | Ga0070667_100014894 | Ga0070667_1000148945 | 340 |
| 154 | 3300005618 | Ga0068864_100152802 | Ga0068864_1001528022 | 340 |
| 155 | 3300005834 | Ga0068851_10008746 | Ga0068851_100087464 | 340 |
| 156 | 3300013104 | Ga0157370_10184844 | Ga0157370_101848442 | 340 |
| 157 | 3300025321 | Ga0207656_10016708 | Ga0207656_100167082 | 340 |
| 158 | 3300006358 | Ga0068871_100052861 | Ga0068871_1000528612 | 341 |
| 159 | 3300009101 | Ga0105247_10003520 | Ga0105247_1000352010 | 341 |
| 160 | 3300009148 | Ga0105243_10315371 | Ga0105243_103153712 | 341 |
| 161 | 3300009174 | Ga0105241_10001733 | Ga0105241_100017334 | 341 |
| 162 | 3300009176 | Ga0105242_10020808 | Ga0105242_100208083 | 341 |
| 163 | 3300009545 | Ga0105237_10054400 | Ga0105237_100544003 | 341 |
| 164 | 3300009553 | Ga0105249_10011083 | Ga0105249_100110835 | 341 |
| 165 | 3300013297 | Ga0157378_10172195 | Ga0157378_101721952 | 341 |
| 166 | 3300013306 | Ga0163162_10004258 | Ga0163162_1000425810 | 341 |
| 167 | 3300013308 | Ga0157375_10136431 | Ga0157375_101364312 | 341 |
| 168 | 3300014325 | Ga0163163_10135642 | Ga0163163_101356422 | 341 |
| 169 | 3300025945 | Ga0207679_10233787 | Ga0207679_102337872 | 341 |
| 170 | 3300049663 | Ga0501223_015144 | Ga0501223_015144_175_1203 | 341 |
| 171 | 3300049668 | Ga0501233_024237 | Ga0501233_024237_123_1151 | 341 |
| 172 | 3300049674 | Ga0501242_000722 | Ga0501242_000722_514_1542 | 341 |
| 173 | 3300049681 | Ga0501251_001781 | Ga0501251_001781_951_1979 | 341 |
| 174 | 3300049704 | Ga0501221_014661 | Ga0501221_014661_348_1376 | 341 |
| 175 | 3300005334 | Ga0068869_100294395 | Ga0068869_1002943951 | 345 |
| 176 | 3300005844 | Ga0068862_100052368 | Ga0068862_1000523682 | 345 |
| 177 | 3300009174 | Ga0105241_10337605 | Ga0105241_103376051 | 345 |
| 178 | 3300009553 | Ga0105249_10231433 | Ga0105249_102314332 | 345 |
| 179 | 3300025942 | Ga0207689_10301278 | Ga0207689_103012781 | 345 |
| 180 | 3300025986 | Ga0207658_10058596 | Ga0207658_100585963 | 345 |
| 181 | 3300026089 | Ga0207648_10164609 | Ga0207648_101646092 | 345 |
| 182 | 3300005614 | Ga0068856_100075596 | Ga0068856_1000755963 | 353 |
| 183 | 3300013105 | Ga0157369_10569704 | Ga0157369_105697041 | 353 |
| 184 | 3300025949 | Ga0207667_10132420 | Ga0207667_101324202 | 353 |
| 185 | 3300031731 | Ga0307405_10005405 | Ga0307405_100054057 | 357 |
| 186 | 3300031824 | Ga0307413_10008468 | Ga0307413_100084684 | 357 |
| 187 | 3300032005 | Ga0307411_10061340 | Ga0307411_100613402 | 357 |
| 188 | 3300005354 | Ga0070675_100007290 | Ga0070675_1000072905 | 359 |
| 189 | 3300013307 | Ga0157372_10078712 | Ga0157372_100787122 | 359 |
| 190 | 3300014325 | Ga0163163_10012583 | Ga0163163_100125836 | 359 |
| 191 | 3300049675 | Ga0501243_002907 | Ga0501243_002907_1139_2221 | 359 |
| 192 | 3300049686 | Ga0501257_007725 | Ga0501257_007725_234_1316 | 359 |
| 193 | iso_pu_bacteria | 2738541278 | 2738724510 | 359 |
| 194 | 3300005331 | Ga0070670_100120903 | Ga0070670_1001209032 | 360 |
| 195 | 3300005355 | Ga0070671_100125386 | Ga0070671_1001253862 | 360 |
| 196 | 3300005564 | Ga0070664_100001670 | Ga0070664_1000016705 | 360 |
| 197 | 3300013296 | Ga0157374_10205062 | Ga0157374_102050621 | 360 |
| 198 | 3300025321 | Ga0207656_10023113 | Ga0207656_100231132 | 360 |
| 199 | 3300025925 | Ga0207650_10102229 | Ga0207650_101022292 | 360 |
| 200 | 3300025931 | Ga0207644_10128751 | Ga0207644_101287512 | 360 |
| 201 | 3300025944 | Ga0207661_10004722 | Ga0207661_100047229 | 360 |
| 202 | 3300005331 | Ga0070670_100200416 | Ga0070670_1002004161 | 361 |
| 203 | 3300005335 | Ga0070666_10048232 | Ga0070666_100482322 | 361 |
| 204 | 3300005338 | Ga0068868_100023458 | Ga0068868_1000234582 | 361 |
| 205 | 3300005355 | Ga0070671_100004244 | Ga0070671_1000042445 | 361 |
| 206 | 3300005367 | Ga0070667_100007822 | Ga0070667_1000078226 | 361 |
| 207 | 3300005456 | Ga0070678_100010622 | Ga0070678_1000106226 | 361 |
| 208 | 3300005618 | Ga0068864_100284515 | Ga0068864_1002845152 | 361 |
| 209 | 3300005841 | Ga0068863_100066420 | Ga0068863_1000664202 | 361 |
| 210 | 3300005841 | Ga0068863_100106235 | Ga0068863_1001062353 | 361 |
| 211 | 3300005842 | Ga0068858_100257317 | Ga0068858_1002573172 | 361 |
| 212 | 3300005843 | Ga0068860_100008301 | Ga0068860_1000083013 | 361 |
| 213 | 3300006871 | Ga0075434_100009056 | Ga0075434_1000090565 | 361 |
| 214 | 3300009177 | Ga0105248_10022859 | Ga0105248_100228597 | 361 |
| 215 | 3300013296 | Ga0157374_10027083 | Ga0157374_100270834 | 361 |
| 216 | 3300013297 | Ga0157378_10003039 | Ga0157378_100030394 | 361 |
| 217 | 3300013297 | Ga0157378_10012828 | Ga0157378_100128282 | 361 |
| 218 | 3300013306 | Ga0163162_10001523 | Ga0163162_1000152311 | 361 |
| 219 | 3300013308 | Ga0157375_10000686 | Ga0157375_1000068618 | 361 |
| 220 | 3300014325 | Ga0163163_10016396 | Ga0163163_100163968 | 361 |
| 221 | 3300014968 | Ga0157379_10011127 | Ga0157379_100111276 | 361 |
| 222 | 3300014969 | Ga0157376_10001139 | Ga0157376_100011397 | 361 |
| 223 | 3300025986 | Ga0207658_10008025 | Ga0207658_100080253 | 361 |
| 224 | 3300026023 | Ga0207677_10006012 | Ga0207677_100060126 | 361 |
| 225 | 3300026121 | Ga0207683_10025629 | Ga0207683_100256292 | 361 |
| 226 | 3300028381 | Ga0268264_10008865 | Ga0268264_100088653 | 361 |
| 227 | 3300047318 | Ga0495636_0000184 | Ga0495636_0000184_4945_6030 | 361 |
| 228 | 3300003320 | rootH2_10259783 | rootH2_102597831 | 362 |
| 229 | 3300003323 | rootH1_10199503 | rootH1_101995034 | 362 |
| 230 | 3300005329 | Ga0070683_100033730 | Ga0070683_1000337302 | 362 |
| 231 | 3300005330 | Ga0070690_100047878 | Ga0070690_1000478782 | 362 |
| 232 | 3300005334 | Ga0068869_100063697 | Ga0068869_1000636972 | 362 |
| 233 | 3300005335 | Ga0070666_10000031 | Ga0070666_1000003141 | 362 |
| 234 | 3300005335 | Ga0070666_10053892 | Ga0070666_100538921 | 362 |
| 235 | 3300005338 | Ga0068868_100000427 | Ga0068868_10000042715 | 362 |
| 236 | 3300005338 | Ga0068868_100128566 | Ga0068868_1001285662 | 362 |
| 237 | 3300005340 | Ga0070689_100044843 | Ga0070689_1000448433 | 362 |
| 238 | 3300005340 | Ga0070689_100098701 | Ga0070689_1000987012 | 362 |
| 239 | 3300005344 | Ga0070661_100019232 | Ga0070661_1000192322 | 362 |
| 240 | 3300005344 | Ga0070661_100108251 | Ga0070661_1001082512 | 362 |
| 241 | 3300005347 | Ga0070668_100180515 | Ga0070668_1001805151 | 362 |
| 242 | 3300005353 | Ga0070669_100086199 | Ga0070669_1000861993 | 362 |
| 243 | 3300005354 | Ga0070675_100064519 | Ga0070675_1000645193 | 362 |
| 244 | 3300005354 | Ga0070675_100188121 | Ga0070675_1001881211 | 362 |
| 245 | 3300005356 | Ga0070674_100062207 | Ga0070674_1000622071 | 362 |
| 246 | 3300005364 | Ga0070673_100022372 | Ga0070673_1000223723 | 362 |
| 247 | 3300005365 | Ga0070688_100092656 | Ga0070688_1000926561 | 362 |
| 248 | 3300005367 | Ga0070667_100053693 | Ga0070667_1000536933 | 362 |
| 249 | 3300005456 | Ga0070678_100057194 | Ga0070678_1000571943 | 362 |
| 250 | 3300005457 | Ga0070662_100009734 | Ga0070662_1000097344 | 362 |
| 251 | 3300005457 | Ga0070662_100011948 | Ga0070662_1000119484 | 362 |
| 252 | 3300005457 | Ga0070662_100013483 | Ga0070662_1000134835 | 362 |
| 253 | 3300005459 | Ga0068867_100276970 | Ga0068867_1002769702 | 362 |
| 254 | 3300005535 | Ga0070684_100157993 | Ga0070684_1001579931 | 362 |
| 255 | 3300005548 | Ga0070665_100130947 | Ga0070665_1001309473 | 362 |
| 256 | 3300005577 | Ga0068857_100007841 | Ga0068857_1000078414 | 362 |
| 257 | 3300005616 | Ga0068852_100005012 | Ga0068852_1000050122 | 362 |
| 258 | 3300005617 | Ga0068859_100000045 | Ga0068859_10000004599 | 362 |
| 259 | 3300005617 | Ga0068859_100072364 | Ga0068859_1000723645 | 362 |
| 260 | 3300005617 | Ga0068859_100455501 | Ga0068859_1004555011 | 362 |
| 261 | 3300005618 | Ga0068864_100001485 | Ga0068864_10000148515 | 362 |
| 262 | 3300005618 | Ga0068864_100124691 | Ga0068864_1001246911 | 362 |
| 263 | 3300005834 | Ga0068851_10104766 | Ga0068851_101047662 | 362 |
| 264 | 3300005841 | Ga0068863_100002352 | Ga0068863_10000235214 | 362 |
| 265 | 3300005842 | Ga0068858_100003543 | Ga0068858_1000035436 | 362 |
| 266 | 3300005843 | Ga0068860_100003309 | Ga0068860_1000033093 | 362 |
| 267 | 3300005843 | Ga0068860_100076409 | Ga0068860_1000764092 | 362 |
| 268 | 3300006237 | Ga0097621_100014541 | Ga0097621_1000145413 | 362 |
| 269 | 3300006237 | Ga0097621_100134194 | Ga0097621_1001341942 | 362 |
| 270 | 3300006358 | Ga0068871_100124752 | Ga0068871_1001247522 | 362 |
| 271 | 3300006358 | Ga0068871_100242605 | Ga0068871_1002426052 | 362 |
| 272 | 3300006358 | Ga0068871_100242870 | Ga0068871_1002428702 | 362 |
| 273 | 3300006881 | Ga0068865_100058475 | Ga0068865_1000584752 | 362 |
| 274 | 3300006931 | Ga0097620_100000045 | Ga0097620_10000004541 | 362 |
| 275 | 3300006931 | Ga0097620_100072356 | Ga0097620_1000723562 | 362 |
| 276 | 3300006931 | Ga0097620_100455542 | Ga0097620_1004555421 | 362 |
| 277 | 3300009093 | Ga0105240_10034849 | Ga0105240_100348497 | 362 |
| 278 | 3300009098 | Ga0105245_10069796 | Ga0105245_100697962 | 362 |
| 279 | 3300009101 | Ga0105247_10094027 | Ga0105247_100940271 | 362 |
| 280 | 3300009147 | Ga0114129_10082403 | Ga0114129_100824034 | 362 |
| 281 | 3300009176 | Ga0105242_10010544 | Ga0105242_100105445 | 362 |
| 282 | 3300009176 | Ga0105242_10072142 | Ga0105242_100721423 | 362 |
| 283 | 3300009177 | Ga0105248_10038321 | Ga0105248_100383217 | 362 |
| 284 | 3300009553 | Ga0105249_10011427 | Ga0105249_100114277 | 362 |
| 285 | 3300010375 | Ga0105239_10003358 | Ga0105239_1000335814 | 362 |
| 286 | 3300013296 | Ga0157374_10079023 | Ga0157374_100790233 | 362 |
| 287 | 3300013297 | Ga0157378_10071685 | Ga0157378_100716853 | 362 |
| 288 | 3300013306 | Ga0163162_10007829 | Ga0163162_1000782912 | 362 |
| 289 | 3300013306 | Ga0163162_10022439 | Ga0163162_100224393 | 362 |
| 290 | 3300013306 | Ga0163162_10055604 | Ga0163162_100556042 | 362 |
| 291 | 3300013306 | Ga0163162_10074490 | Ga0163162_100744903 | 362 |
| 292 | 3300013307 | Ga0157372_10240973 | Ga0157372_102409732 | 362 |
| 293 | 3300013308 | Ga0157375_10010009 | Ga0157375_100100094 | 362 |
| 294 | 3300013308 | Ga0157375_10082885 | Ga0157375_100828851 | 362 |
| 295 | 3300013308 | Ga0157375_10509143 | Ga0157375_105091431 | 362 |
| 296 | 3300014326 | Ga0157380_10077609 | Ga0157380_100776092 | 362 |
| 297 | 3300014326 | Ga0157380_10178655 | Ga0157380_101786552 | 362 |
| 298 | 3300014745 | Ga0157377_10017063 | Ga0157377_100170633 | 362 |
| 299 | 3300014968 | Ga0157379_10032372 | Ga0157379_100323722 | 362 |
| 300 | 3300014969 | Ga0157376_10003968 | Ga0157376_100039683 | 362 |
| 301 | 3300014969 | Ga0157376_10007029 | Ga0157376_100070296 | 362 |
| 302 | 3300017792 | Ga0163161_10005088 | Ga0163161_100050889 | 362 |
| 303 | 3300017792 | Ga0163161_10006224 | Ga0163161_100062245 | 362 |
| 304 | 3300025315 | Ga0207697_10009658 | Ga0207697_100096582 | 362 |
| 305 | 3300025900 | Ga0207710_10002713 | Ga0207710_100027132 | 362 |
| 306 | 3300025903 | Ga0207680_10000141 | Ga0207680_1000014126 | 362 |
| 307 | 3300025907 | Ga0207645_10138505 | Ga0207645_101385052 | 362 |
| 308 | 3300025907 | Ga0207645_10195010 | Ga0207645_101950101 | 362 |
| 309 | 3300025911 | Ga0207654_10003695 | Ga0207654_100036952 | 362 |
| 310 | 3300025914 | Ga0207671_10011688 | Ga0207671_100116884 | 362 |
| 311 | 3300025920 | Ga0207649_10007908 | Ga0207649_100079082 | 362 |
| 312 | 3300025923 | Ga0207681_10011577 | Ga0207681_100115773 | 362 |
| 313 | 3300025932 | Ga0207690_10255535 | Ga0207690_102555351 | 362 |
| 314 | 3300025933 | Ga0207706_10003994 | Ga0207706_100039946 | 362 |
| 315 | 3300025933 | Ga0207706_10022319 | Ga0207706_100223195 | 362 |
| 316 | 3300025933 | Ga0207706_10059068 | Ga0207706_100590682 | 362 |
| 317 | 3300025934 | Ga0207686_10202293 | Ga0207686_102022931 | 362 |
| 318 | 3300025935 | Ga0207709_10146863 | Ga0207709_101468632 | 362 |
| 319 | 3300025936 | Ga0207670_10006784 | Ga0207670_100067848 | 362 |
| 320 | 3300025936 | Ga0207670_10070587 | Ga0207670_100705873 | 362 |
| 321 | 3300025937 | Ga0207669_10110333 | Ga0207669_101103332 | 362 |
| 322 | 3300025938 | Ga0207704_10201391 | Ga0207704_102013912 | 362 |
| 323 | 3300025942 | Ga0207689_10008936 | Ga0207689_100089363 | 362 |
| 324 | 3300025942 | Ga0207689_10009466 | Ga0207689_100094667 | 362 |
| 325 | 3300025942 | Ga0207689_10017516 | Ga0207689_100175162 | 362 |
| 326 | 3300025945 | Ga0207679_10017260 | Ga0207679_100172602 | 362 |
| 327 | 3300025945 | Ga0207679_10169190 | Ga0207679_101691902 | 362 |
| 328 | 3300025960 | Ga0207651_10064393 | Ga0207651_100643931 | 362 |
| 329 | 3300025960 | Ga0207651_10108714 | Ga0207651_101087142 | 362 |
| 330 | 3300025961 | Ga0207712_10027659 | Ga0207712_100276592 | 362 |
| 331 | 3300025961 | Ga0207712_10076659 | Ga0207712_100766592 | 362 |
| 332 | 3300025986 | Ga0207658_10057016 | Ga0207658_100570162 | 362 |
| 333 | 3300025986 | Ga0207658_10108421 | Ga0207658_101084212 | 362 |
| 334 | 3300026023 | Ga0207677_10018387 | Ga0207677_100183874 | 362 |
| 335 | 3300026035 | Ga0207703_10035352 | Ga0207703_100353523 | 362 |
| 336 | 3300026035 | Ga0207703_10185998 | Ga0207703_101859982 | 362 |
| 337 | 3300026067 | Ga0207678_10031808 | Ga0207678_100318082 | 362 |
| 338 | 3300026088 | Ga0207641_10000133 | Ga0207641_1000013386 | 362 |
| 339 | 3300026089 | Ga0207648_10056263 | Ga0207648_100562632 | 362 |
| 340 | 3300026089 | Ga0207648_10067242 | Ga0207648_100672423 | 362 |
| 341 | 3300026095 | Ga0207676_10005018 | Ga0207676_1000501810 | 362 |
| 342 | 3300026116 | Ga0207674_10014867 | Ga0207674_100148672 | 362 |
| 343 | 3300026118 | Ga0207675_100034881 | Ga0207675_1000348814 | 362 |
| 344 | 3300026121 | Ga0207683_10025467 | Ga0207683_100254675 | 362 |
| 345 | 3300026142 | Ga0207698_10003512 | Ga0207698_1000351210 | 362 |
| 346 | 3300028379 | Ga0268266_10332080 | Ga0268266_103320802 | 362 |
| 347 | 3300028381 | Ga0268264_10008390 | Ga0268264_100083907 | 362 |
| 348 | 3300028794 | Ga0307515_10000024 | Ga0307515_10000024135 | 362 |
| 349 | 3300031507 | Ga0307509_10171864 | Ga0307509_101718642 | 362 |
| 350 | 3300036401 | Ga0373937_0006671 | Ga0373937_0006671_1789_2877 | 362 |
| 351 | 3300044656 | Ga0466969_0000004 | Ga0466969_0000004_80577_81671 | 362 |
| 352 | 3300044684 | Ga0466966_0000295 | Ga0466966_0000295_2319_3413 | 362 |
| 353 | 3300044842 | Ga0466957_0000367 | Ga0466957_0000367_13292_14386 | 362 |
| 354 | 3300045049 | Ga0466959_0000004 | Ga0466959_0000004_186273_187367 | 362 |
| 355 | 3300046463 | Ga0495653_0060576 | Ga0495653_0060576_364_1452 | 362 |
| 356 | 3300046511 | Ga0495608_0067439 | Ga0495608_0067439_238_1326 | 362 |
| 357 | 3300046516 | Ga0495628_0022064 | Ga0495628_0022064_2868_3956 | 362 |
| 358 | 3300046517 | Ga0495630_0011846 | Ga0495630_0011846_1443_2531 | 362 |
| 359 | 3300046529 | Ga0495652_0129351 | Ga0495652_0129351_464_1552 | 362 |
| 360 | 3300046535 | Ga0495586_0009224 | Ga0495586_0009224_2408_3496 | 362 |
| 361 | 3300046536 | Ga0495587_0025753 | Ga0495587_0025753_418_1506 | 362 |
| 362 | 3300046559 | Ga0495667_0034520 | Ga0495667_0034520_1919_3007 | 362 |
| 363 | 3300046660 | Ga0495625_0043549 | Ga0495625_0043549_2070_3170 | 362 |
| 364 | 3300047322 | Ga0495680_0037499 | Ga0495680_0037499_1782_2870 | 362 |
| 365 | 3300048918 | Ga0496115_0241398 | Ga0496115_0241398_178_1266 | 362 |
| 366 | 3300049571 | Ga0501034_0022151 | Ga0501034_0022151_2211_3299 | 362 |
| 367 | 3300049572 | Ga0501036_0094061 | Ga0501036_0094061_1331_2452 | 362 |
| 368 | 3300050507 | nmdc:mga05p37_2793_c1 | nmdc:mga05p37_2793_c1_18610_19704 | 362 |
| 369 | 3300053153 | Ga0500616_0006698 | Ga0500616_0006698_3421_4512 | 362 |
| 370 | 3300003320 | rootH2_10000535 | rootH2_1000053521 | 363 |
| 371 | 3300003322 | rootL2_10221672 | rootL2_102216723 | 363 |
| 372 | 3300003323 | rootH1_10116572 | rootH1_101165723 | 363 |
| 373 | 3300003323 | rootH1_10121234 | rootH1_101212342 | 363 |
| 374 | 3300005327 | Ga0070658_10001648 | Ga0070658_100016485 | 363 |
| 375 | 3300005329 | Ga0070683_100025633 | Ga0070683_1000256335 | 363 |
| 376 | 3300005334 | Ga0068869_100048448 | Ga0068869_1000484482 | 363 |
| 377 | 3300005335 | Ga0070666_10000358 | Ga0070666_100003582 | 363 |
| 378 | 3300005335 | Ga0070666_10121372 | Ga0070666_101213721 | 363 |
| 379 | 3300005338 | Ga0068868_100000187 | Ga0068868_10000018730 | 363 |
| 380 | 3300005347 | Ga0070668_100003714 | Ga0070668_1000037143 | 363 |
| 381 | 3300005364 | Ga0070673_100000124 | Ga0070673_10000012411 | 363 |
| 382 | 3300005367 | Ga0070667_100000980 | Ga0070667_10000098011 | 363 |
| 383 | 3300005457 | Ga0070662_100010835 | Ga0070662_1000108353 | 363 |
| 384 | 3300005459 | Ga0068867_100002368 | Ga0068867_1000023687 | 363 |
| 385 | 3300005459 | Ga0068867_100172446 | Ga0068867_1001724462 | 363 |
| 386 | 3300005471 | Ga0070698_100055718 | Ga0070698_1000557184 | 363 |
| 387 | 3300005539 | Ga0068853_100002569 | Ga0068853_1000025695 | 363 |
| 388 | 3300005539 | Ga0068853_100179198 | Ga0068853_1001791982 | 363 |
| 389 | 3300005543 | Ga0070672_100000105 | Ga0070672_10000010526 | 363 |
| 390 | 3300005544 | Ga0070686_100001965 | Ga0070686_1000019657 | 363 |
| 391 | 3300005548 | Ga0070665_100000635 | Ga0070665_10000063526 | 363 |
| 392 | 3300005563 | Ga0068855_100003306 | Ga0068855_10000330616 | 363 |
| 393 | 3300005563 | Ga0068855_100005625 | Ga0068855_1000056254 | 363 |
| 394 | 3300005563 | Ga0068855_100063337 | Ga0068855_1000633372 | 363 |
| 395 | 3300005563 | Ga0068855_100097871 | Ga0068855_1000978713 | 363 |
| 396 | 3300005563 | Ga0068855_100224203 | Ga0068855_1002242032 | 363 |
| 397 | 3300005577 | Ga0068857_100000287 | Ga0068857_10000028720 | 363 |
| 398 | 3300005614 | Ga0068856_100020480 | Ga0068856_1000204803 | 363 |
| 399 | 3300005618 | Ga0068864_100001254 | Ga0068864_1000012544 | 363 |
| 400 | 3300005719 | Ga0068861_100007098 | Ga0068861_1000070988 | 363 |
| 401 | 3300005842 | Ga0068858_100010584 | Ga0068858_10001058411 | 363 |
| 402 | 3300005842 | Ga0068858_100211529 | Ga0068858_1002115292 | 363 |
| 403 | 3300005843 | Ga0068860_100001418 | Ga0068860_10000141815 | 363 |
| 404 | 3300005843 | Ga0068860_100018642 | Ga0068860_1000186422 | 363 |
| 405 | 3300005843 | Ga0068860_100019177 | Ga0068860_1000191777 | 363 |
| 406 | 3300005844 | Ga0068862_100092530 | Ga0068862_1000925303 | 363 |
| 407 | 3300006237 | Ga0097621_100011606 | Ga0097621_1000116067 | 363 |
| 408 | 3300006237 | Ga0097621_100034375 | Ga0097621_1000343754 | 363 |
| 409 | 3300006358 | Ga0068871_100010053 | Ga0068871_1000100537 | 363 |
| 410 | 3300006358 | Ga0068871_100074980 | Ga0068871_1000749803 | 363 |
| 411 | 3300006881 | Ga0068865_100001094 | Ga0068865_10000109410 | 363 |
| 412 | 3300006881 | Ga0068865_100016931 | Ga0068865_1000169314 | 363 |
| 413 | 3300009093 | Ga0105240_10000472 | Ga0105240_100004725 | 363 |
| 414 | 3300009093 | Ga0105240_10033401 | Ga0105240_100334014 | 363 |
| 415 | 3300009093 | Ga0105240_10246023 | Ga0105240_102460232 | 363 |
| 416 | 3300009094 | Ga0111539_10073279 | Ga0111539_100732793 | 363 |
| 417 | 3300009098 | Ga0105245_10169907 | Ga0105245_101699072 | 363 |
| 418 | 3300009101 | Ga0105247_10033980 | Ga0105247_100339803 | 363 |
| 419 | 3300009174 | Ga0105241_10006485 | Ga0105241_100064855 | 363 |
| 420 | 3300009174 | Ga0105241_10006681 | Ga0105241_100066813 | 363 |
| 421 | 3300009176 | Ga0105242_10042593 | Ga0105242_100425933 | 363 |
| 422 | 3300009545 | Ga0105237_10022501 | Ga0105237_100225016 | 363 |
| 423 | 3300009545 | Ga0105237_10030614 | Ga0105237_100306144 | 363 |
| 424 | 3300009551 | Ga0105238_10002017 | Ga0105238_1000201713 | 363 |
| 425 | 3300009551 | Ga0105238_10142233 | Ga0105238_101422332 | 363 |
| 426 | 3300009553 | Ga0105249_10028339 | Ga0105249_100283396 | 363 |
| 427 | 3300009553 | Ga0105249_10028806 | Ga0105249_100288065 | 363 |
| 428 | 3300010375 | Ga0105239_10000155 | Ga0105239_1000015531 | 363 |
| 429 | 3300010375 | Ga0105239_10031409 | Ga0105239_100314092 | 363 |
| 430 | 3300010375 | Ga0105239_10094105 | Ga0105239_100941053 | 363 |
| 431 | 3300010375 | Ga0105239_10240194 | Ga0105239_102401942 | 363 |
| 432 | 3300013100 | Ga0157373_10009844 | Ga0157373_100098442 | 363 |
| 433 | 3300013102 | Ga0157371_10000284 | Ga0157371_1000028431 | 363 |
| 434 | 3300013102 | Ga0157371_10000725 | Ga0157371_1000072517 | 363 |
| 435 | 3300013102 | Ga0157371_10009503 | Ga0157371_100095033 | 363 |
| 436 | 3300013102 | Ga0157371_10075116 | Ga0157371_100751163 | 363 |
| 437 | 3300013104 | Ga0157370_10002079 | Ga0157370_100020792 | 363 |
| 438 | 3300013104 | Ga0157370_10021147 | Ga0157370_100211474 | 363 |
| 439 | 3300013105 | Ga0157369_10341159 | Ga0157369_103411592 | 363 |
| 440 | 3300013296 | Ga0157374_10000025 | Ga0157374_1000002585 | 363 |
| 441 | 3300013296 | Ga0157374_10002980 | Ga0157374_100029803 | 363 |
| 442 | 3300013296 | Ga0157374_10073925 | Ga0157374_100739253 | 363 |
| 443 | 3300013296 | Ga0157374_10160909 | Ga0157374_101609092 | 363 |
| 444 | 3300013297 | Ga0157378_10013251 | Ga0157378_100132513 | 363 |
| 445 | 3300013297 | Ga0157378_10079114 | Ga0157378_100791142 | 363 |
| 446 | 3300013306 | Ga0163162_10000312 | Ga0163162_1000031226 | 363 |
| 447 | 3300013306 | Ga0163162_10002647 | Ga0163162_100026474 | 363 |
| 448 | 3300013306 | Ga0163162_10074114 | Ga0163162_100741143 | 363 |
| 449 | 3300013307 | Ga0157372_10018758 | Ga0157372_100187584 | 363 |
| 450 | 3300013307 | Ga0157372_10092124 | Ga0157372_100921243 | 363 |
| 451 | 3300013307 | Ga0157372_10114317 | Ga0157372_101143173 | 363 |
| 452 | 3300013307 | Ga0157372_10487144 | Ga0157372_104871442 | 363 |
| 453 | 3300013308 | Ga0157375_10002871 | Ga0157375_1000287113 | 363 |
| 454 | 3300013308 | Ga0157375_10149918 | Ga0157375_101499183 | 363 |
| 455 | 3300013308 | Ga0157375_10233750 | Ga0157375_102337502 | 363 |
| 456 | 3300014325 | Ga0163163_10000346 | Ga0163163_1000034626 | 363 |
| 457 | 3300014968 | Ga0157379_10000242 | Ga0157379_1000024212 | 363 |
| 458 | 3300014968 | Ga0157379_10052461 | Ga0157379_100524612 | 363 |
| 459 | 3300014969 | Ga0157376_10002821 | Ga0157376_1000282112 | 363 |
| 460 | 3300020078 | Ga0206352_10293594 | Ga0206352_102935941 | 363 |
| 461 | 3300025903 | Ga0207680_10003927 | Ga0207680_100039272 | 363 |
| 462 | 3300025904 | Ga0207647_10027231 | Ga0207647_100272312 | 363 |
| 463 | 3300025907 | Ga0207645_10001794 | Ga0207645_100017943 | 363 |
| 464 | 3300025909 | Ga0207705_10007257 | Ga0207705_100072576 | 363 |
| 465 | 3300025909 | Ga0207705_10017600 | Ga0207705_100176006 | 363 |
| 466 | 3300025909 | Ga0207705_10043803 | Ga0207705_100438031 | 363 |
| 467 | 3300025911 | Ga0207654_10029613 | Ga0207654_100296133 | 363 |
| 468 | 3300025913 | Ga0207695_10000282 | Ga0207695_1000028250 | 363 |
| 469 | 3300025913 | Ga0207695_10001688 | Ga0207695_1000168828 | 363 |
| 470 | 3300025913 | Ga0207695_10004070 | Ga0207695_1000407013 | 363 |
| 471 | 3300025913 | Ga0207695_10059033 | Ga0207695_100590333 | 363 |
| 472 | 3300025913 | Ga0207695_10064026 | Ga0207695_100640264 | 363 |
| 473 | 3300025914 | Ga0207671_10011870 | Ga0207671_100118703 | 363 |
| 474 | 3300025914 | Ga0207671_10072568 | Ga0207671_100725682 | 363 |
| 475 | 3300025919 | Ga0207657_10023896 | Ga0207657_100238963 | 363 |
| 476 | 3300025921 | Ga0207652_10000045 | Ga0207652_1000004550 | 363 |
| 477 | 3300025924 | Ga0207694_10057411 | Ga0207694_100574113 | 363 |
| 478 | 3300025925 | Ga0207650_10015410 | Ga0207650_100154102 | 363 |
| 479 | 3300025927 | Ga0207687_10116816 | Ga0207687_101168162 | 363 |
| 480 | 3300025938 | Ga0207704_10009869 | Ga0207704_100098693 | 363 |
| 481 | 3300025940 | Ga0207691_10000012 | Ga0207691_1000001262 | 363 |
| 482 | 3300025942 | Ga0207689_10030002 | Ga0207689_100300022 | 363 |
| 483 | 3300025949 | Ga0207667_10012455 | Ga0207667_100124556 | 363 |
| 484 | 3300025949 | Ga0207667_10026076 | Ga0207667_100260765 | 363 |
| 485 | 3300025949 | Ga0207667_10034450 | Ga0207667_100344504 | 363 |
| 486 | 3300025949 | Ga0207667_10045123 | Ga0207667_100451234 | 363 |
| 487 | 3300025960 | Ga0207651_10000216 | Ga0207651_100002163 | 363 |
| 488 | 3300025961 | Ga0207712_10010440 | Ga0207712_100104404 | 363 |
| 489 | 3300025972 | Ga0207668_10001361 | Ga0207668_100013615 | 363 |
| 490 | 3300025981 | Ga0207640_10014955 | Ga0207640_100149554 | 363 |
| 491 | 3300025986 | Ga0207658_10000374 | Ga0207658_1000037431 | 363 |
| 492 | 3300026023 | Ga0207677_10000984 | Ga0207677_100009843 | 363 |
| 493 | 3300026035 | Ga0207703_10019138 | Ga0207703_100191382 | 363 |
| 494 | 3300026041 | Ga0207639_10002390 | Ga0207639_100023909 | 363 |
| 495 | 3300026067 | Ga0207678_10013503 | Ga0207678_100135033 | 363 |
| 496 | 3300026078 | Ga0207702_10026475 | Ga0207702_100264753 | 363 |
| 497 | 3300026089 | Ga0207648_10010253 | Ga0207648_100102534 | 363 |
| 498 | 3300026089 | Ga0207648_10083158 | Ga0207648_100831583 | 363 |
| 499 | 3300026095 | Ga0207676_10000697 | Ga0207676_100006974 | 363 |
| 500 | 3300026118 | Ga0207675_100005430 | Ga0207675_1000054303 | 363 |
| 501 | 3300026142 | Ga0207698_10009340 | Ga0207698_100093403 | 363 |
| 502 | 3300026142 | Ga0207698_10014863 | Ga0207698_100148634 | 363 |
| 503 | 3300028379 | Ga0268266_10005379 | Ga0268266_1000537911 | 363 |
| 504 | 3300028380 | Ga0268265_10009351 | Ga0268265_100093512 | 363 |
| 505 | 3300028380 | Ga0268265_10316991 | Ga0268265_103169911 | 363 |
| 506 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019208 | 363 |
| 507 | 3300028381 | Ga0268264_10003975 | Ga0268264_100039754 | 363 |
| 508 | 3300028381 | Ga0268264_10008474 | Ga0268264_100084748 | 363 |
| 509 | 3300028381 | Ga0268264_10008570 | Ga0268264_100085705 | 363 |
| 510 | 3300030521 | Ga0307511_10000228 | Ga0307511_1000022811 | 363 |
| 511 | 3300031456 | Ga0307513_10168728 | Ga0307513_101687283 | 363 |
| 512 | 3300031456 | Ga0307513_10202106 | Ga0307513_102021062 | 363 |
| 513 | 3300031507 | Ga0307509_10015498 | Ga0307509_100154987 | 363 |
| 514 | 3300031616 | Ga0307508_10001024 | Ga0307508_1000102424 | 363 |
| 515 | 3300031616 | Ga0307508_10218480 | Ga0307508_102184802 | 363 |
| 516 | 3300035172 | Ga0373955_0056898 | Ga0373955_0056898_472_1575 | 363 |
| 517 | 3300036401 | Ga0373937_0339533 | Ga0373937_0339533_241_1335 | 363 |
| 518 | 3300037312 | Ga0395899_0007489 | Ga0395899_0007489_3264_4361 | 363 |
| 519 | 3300037312 | Ga0395899_0063013 | Ga0395899_0063013_95_1192 | 363 |
| 520 | 3300037418 | Ga0395900_0004195 | Ga0395900_0004195_8948_10045 | 363 |
| 521 | 3300037418 | Ga0395900_0008499 | Ga0395900_0008499_3156_4253 | 363 |
| 522 | 3300037466 | Ga0395898_0003718 | Ga0395898_0003718_12102_13199 | 363 |
| 523 | 3300037466 | Ga0395898_0081915 | Ga0395898_0081915_56_1153 | 363 |
| 524 | 3300038443 | Ga0395901_0005062 | Ga0395901_0005062_8693_9790 | 363 |
| 525 | 3300038443 | Ga0395901_0090262 | Ga0395901_0090262_1440_2537 | 363 |
| 526 | 3300041458 | Ga0451798_0707333 | Ga0451798_0707333_176_1276 | 363 |
| 527 | 3300041498 | Ga0451841_0745731 | Ga0451841_0745731_300_1400 | 363 |
| 528 | 3300042014 | Ga0439457_000930 | Ga0439457_000930_4206_5306 | 363 |
| 529 | 3300042015 | Ga0439462_0006134 | Ga0439462_0006134_756_1856 | 363 |
| 530 | 3300044658 | Ga0466972_0000017 | Ga0466972_0000017_72899_73999 | 363 |
| 531 | 3300044712 | Ga0453684_0266906 | Ga0453684_0266906_439_1536 | 363 |
| 532 | 3300046472 | Ga0495580_0075482 | Ga0495580_0075482_406_1509 | 363 |
| 533 | 3300046473 | Ga0495582_0032503 | Ga0495582_0032503_103_1206 | 363 |
| 534 | 3300046535 | Ga0495586_0158828 | Ga0495586_0158828_52_1155 | 363 |
| 535 | 3300046558 | Ga0495633_0024540 | Ga0495633_0024540_1305_2399 | 363 |
| 536 | 3300046616 | Ga0495668_0001697 | Ga0495668_0001697_4664_5767 | 363 |
| 537 | 3300046683 | Ga0495658_0016941 | Ga0495658_0016941_46_1149 | 363 |
| 538 | 3300046694 | Ga0495649_0026980 | Ga0495649_0026980_1364_2455 | 363 |
| 539 | 3300046809 | Ga0495600_0075759 | Ga0495600_0075759_764_1867 | 363 |
| 540 | 3300047319 | Ga0495674_0034710 | Ga0495674_0034710_747_1850 | 363 |
| 541 | 3300047471 | Ga0495684_0053521 | Ga0495684_0053521_1442_2545 | 363 |
| 542 | 3300047472 | Ga0495686_0000005 | Ga0495686_0000005_5817_6908 | 363 |
| 543 | 3300048907 | Ga0496104_0313801 | Ga0496104_0313801_88_1191 | 363 |
| 544 | 3300048912 | Ga0496109_0192296 | Ga0496109_0192296_713_1807 | 363 |
| 545 | 3300053085 | Ga0495619_0042013 | Ga0495619_0042013_1600_2703 | 363 |
| 546 | 3300053092 | Ga0500583_0000068 | Ga0500583_0000068_1965_3065 | 363 |
| 547 | 3300053092 | Ga0500583_0001499 | Ga0500583_0001499_1498_2598 | 363 |
| 548 | 3300053139 | Ga0500568_0007023 | Ga0500568_0007023_4419_5510 | 363 |
| 549 | 3300053150 | Ga0500603_027821 | Ga0500603_027821_136_1236 | 363 |
| 550 | 3300053153 | Ga0500616_0026690 | Ga0500616_0026690_2055_3146 | 363 |
| 551 | 3300053156 | Ga0500622_0046200 | Ga0500622_0046200_199_1299 | 363 |
| 552 | 3300053177 | Ga0500636_0053601 | Ga0500636_0053601_375_1475 | 363 |
| 553 | 3300053178 | Ga0500637_0076844 | Ga0500637_0076844_363_1457 | 363 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h84-assembly1.cif.gz_B | crystal structure of the c-terminal type iii polyketide synthase (pks iii) domain of 'steely1' (a type i/iii pks hybrid from dictyostelium) | 0.9166 | 2 | 361 |
| 4jap-assembly2.cif.gz_A | crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones | 0.9064 | 1 | 363 |
| 4jd3-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones | 0.9059 | 3 | 361 |
| 4b0n-assembly1.cif.gz_B | crystal structure of pks-i from the brown algae ectocarpus siliculosus | 0.9055 | 2 | 363 |
| 4jap-assembly2.cif.gz_A | crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones | 0.904 | 1 | 363 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tedA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9403 | 220 | 361 | 3.40.47.10 |
| af_Q10QW1_350_518_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9308 | 280 | 359 | 3.40.47.10 |
| 1u0mB02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9291 | 219 | 361 | 3.40.47.10 |
| 4jaoA02 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9261 | 220 | 363 | 3.40.47.10 |
| af_A0A0R0EFL7_291_413_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9253 | 280 | 361 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8W2N5-F1-model_v4 | Type III polyketide synthase | 0.9777 | 1 | 363 |
GO:0016747
GO:0030639 |
| AF-A0A7V8W2N5-F1-model_v4 | Type III polyketide synthase | 0.975 | 1 | 363 |
GO:0016747
GO:0030639 |
| AF-A0A4V2AV97-F1-model_v4 | Type III polyketide synthase | 0.9678 | 1 | 223 |
GO:0016747
GO:0030639 |
| AF-A0A3C1BIB7-F1-model_v4 | Naringenin-chalcone synthase | 0.9677 | 1 | 363 |
GO:0016747
GO:0030639 |
| AF-A0A3E1NPK3-F1-model_v4 | Type III polyketide synthase | 0.9664 | 1 | 363 |
GO:0016747
GO:0030639 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar