F462915

General Info

Members Datasets Scaffolds Average Seq Length
553 227 552 357

Family's Representative Sequence

Representative Sequence 3300049521|Ga0501298_011202|Ga0501298_011202_173_1195
Length 340
Sequence MDILQFMQLVYAGSDAERRKLRFMYSQSGIQQRYSVIGDYSKPVHDWKFYPQSENLEPFPSLEQRMTLFNKYAPQLSVDAIRDSLNSVHSHKEVTHLITVSCTGMSAPGLDLQVMELMDFGKNIFRTSVNFMGCYAALHALKLADAICKAEKGAQVVIVCTELCTLHFQREGTLDNITSSLLFGDGSAALLITGEDSDLPGLYIDGFYSEIIAKGKRDMAWELSSSGFLMTLSGYVPELIEEDFKAIVQRAIGSEQIEDISHWCMHPGGKRILEAVSKSTGIENEAFKHSYNVLQQYGNLSSASIVFVLKEVLQQKTAIPKLFGAAFGPGLTVETFTAHR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
160 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
212 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
213 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 1.27
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000535 3300003320 Bacteria 24013
2 rootH2_10259783 3300003320 Bacteria 1406
3 rootL2_10221672 3300003322 Unclassified 3808
4 rootH1_10116572 3300003323 Bacteria 3812
5 rootH1_10121234 3300003323 Bacteria 1617
6 rootH1_10199503 3300003323 Bacteria 2530
7 Ga0070658_10001648 3300005327 Bacteria 18875
8 Ga0070658_10048378 3300005327 Bacteria 3443
9 Ga0070658_10081985 3300005327 Bacteria 2650
10 Ga0070676_10004865 3300005328 Bacteria 7113
11 Ga0070683_100025633 3300005329 Bacteria 5298
12 Ga0070683_100033730 3300005329 Bacteria 4669
13 Ga0070690_100047878 3300005330 Bacteria 2721
14 Ga0070670_100053373 3300005331 Unclassified 3471
15 Ga0070670_100103503 3300005331 Unclassified 2452
16 Ga0070670_100120903 3300005331 Bacteria 2259
17 Ga0070670_100200416 3300005331 Bacteria 1734
18 Ga0070670_100236328 3300005331 Unclassified 1591
19 Ga0068869_100048448 3300005334 Bacteria 3072
20 Ga0068869_100063697 3300005334 Bacteria 2710
21 Ga0068869_100108650 3300005334 Unclassified 2108
22 Ga0068869_100294395 3300005334 Bacteria 1309
23 Ga0070666_10000031 3300005335 Bacteria 132089
24 Ga0070666_10000358 3300005335 Bacteria 28682
25 Ga0070666_10048232 3300005335 Unclassified 2861
26 Ga0070666_10053892 3300005335 Bacteria 2713
27 Ga0070666_10118377 3300005335 Unclassified 1835
28 Ga0070666_10121372 3300005335 Bacteria 1812
29 Ga0068868_100000187 3300005338 Bacteria 41327
30 Ga0068868_100000427 3300005338 Bacteria 28309
31 Ga0068868_100003257 3300005338 Bacteria 11304
32 Ga0068868_100023458 3300005338 Unclassified 4670
33 Ga0068868_100128566 3300005338 Bacteria 2071
34 Ga0070660_100020321 3300005339 Bacteria 4879
35 Ga0070660_100078196 3300005339 Bacteria 2594
36 Ga0070689_100044843 3300005340 Bacteria 3403
37 Ga0070689_100098701 3300005340 Bacteria 2310
38 Ga0070661_100019232 3300005344 Bacteria 4865
39 Ga0070661_100108251 3300005344 Bacteria 2074
40 Ga0070668_100003714 3300005347 Bacteria 11263
41 Ga0070668_100180515 3300005347 Bacteria 1724
42 Ga0070669_100086199 3300005353 Bacteria 2346
43 Ga0070675_100007290 3300005354 Bacteria 8533
44 Ga0070675_100064519 3300005354 Bacteria 3028
45 Ga0070675_100167321 3300005354 Bacteria 1894
46 Ga0070675_100188121 3300005354 Bacteria 1788
47 Ga0070671_100004244 3300005355 Bacteria 11343
48 Ga0070671_100125386 3300005355 Bacteria 2162
49 Ga0070674_100062207 3300005356 Bacteria 2608
50 Ga0070674_100158238 3300005356 Bacteria 1716
51 Ga0070673_100000124 3300005364 Bacteria 35840
52 Ga0070673_100022372 3300005364 Unclassified 4600
53 Ga0070688_100069983 3300005365 Bacteria 2242
54 Ga0070688_100092656 3300005365 Bacteria 1977
55 Ga0070667_100000980 3300005367 Bacteria 26248
56 Ga0070667_100007822 3300005367 Bacteria 8866
57 Ga0070667_100011432 3300005367 Bacteria 7340
58 Ga0070667_100014894 3300005367 Bacteria 6425
59 Ga0070667_100053693 3300005367 Unclassified 3401
60 Ga0070678_100010622 3300005456 Bacteria 5636
61 Ga0070678_100057194 3300005456 Bacteria 2856
62 Ga0070678_100075904 3300005456 Bacteria 2530
63 Ga0070662_100009734 3300005457 Bacteria 6292
64 Ga0070662_100010835 3300005457 Bacteria 6003
65 Ga0070662_100011948 3300005457 Bacteria 5742
66 Ga0070662_100013483 3300005457 Bacteria 5438
67 Ga0070681_10035209 3300005458 Bacteria 5029
68 Ga0068867_100002368 3300005459 Bacteria 13255
69 Ga0068867_100066748 3300005459 Unclassified 2680
70 Ga0068867_100172446 3300005459 Bacteria 1714
71 Ga0068867_100276970 3300005459 Bacteria 1374
72 Ga0070698_100055718 3300005471 Bacteria 4007
73 Ga0070679_100136389 3300005530 Bacteria 2435
74 Ga0070684_100157993 3300005535 Bacteria 2056
75 Ga0068853_100002569 3300005539 Bacteria 13648
76 Ga0068853_100128415 3300005539 Unclassified 2267
77 Ga0068853_100179198 3300005539 Bacteria 1921
78 Ga0070672_100000105 3300005543 Bacteria 41868
79 Ga0070686_100001965 3300005544 Bacteria 11413
80 Ga0070686_100036727 3300005544 Bacteria 3036
81 Ga0070665_100000018 3300005548 Bacteria 434118
82 Ga0070665_100000635 3300005548 Bacteria 47836
83 Ga0070665_100076193 3300005548 Unclassified 3361
84 Ga0070665_100130947 3300005548 Bacteria 2511
85 Ga0068855_100003306 3300005563 Bacteria 19732
86 Ga0068855_100005625 3300005563 Bacteria 15291
87 Ga0068855_100019495 3300005563 Bacteria 8151
88 Ga0068855_100063337 3300005563 Bacteria 4315
89 Ga0068855_100097871 3300005563 Unclassified 3380
90 Ga0068855_100224203 3300005563 Bacteria 2107
91 Ga0070664_100001670 3300005564 Bacteria 17755
92 Ga0068857_100000287 3300005577 Bacteria 34776
93 Ga0068857_100007841 3300005577 Bacteria 9207
94 Ga0068854_100026109 3300005578 Bacteria 4012
95 Ga0068854_100147904 3300005578 Unclassified 1809
96 Ga0068854_100231846 3300005578 Unclassified 1466
97 Ga0068854_100282405 3300005578 Bacteria 1337
98 Ga0068856_100020480 3300005614 Bacteria 6424
99 Ga0068856_100044643 3300005614 Bacteria 4363
100 Ga0068856_100075596 3300005614 Bacteria 3336
101 Ga0068856_100126812 3300005614 Bacteria 2556
102 Ga0068856_100339680 3300005614 Bacteria 1520
103 Ga0068852_100000848 3300005616 Bacteria 20294
104 Ga0068852_100005012 3300005616 Bacteria 9417
105 Ga0068852_100008024 3300005616 Bacteria 7745
106 Ga0068859_100000045 3300005617 Bacteria 143607
107 Ga0068859_100017677 3300005617 Bacteria 7169
108 Ga0068859_100026115 3300005617 Bacteria 5858
109 Ga0068859_100072364 3300005617 Bacteria 3484
110 Ga0068859_100455501 3300005617 Bacteria 1375
111 Ga0068864_100001254 3300005618 Bacteria 21079
112 Ga0068864_100001485 3300005618 Bacteria 19316
113 Ga0068864_100124691 3300005618 Bacteria 2307
114 Ga0068864_100152802 3300005618 Bacteria 2092
115 Ga0068864_100284515 3300005618 Bacteria 1544
116 Ga0068866_10082359 3300005718 Bacteria 1731
117 Ga0068866_10089437 3300005718 Unclassified 1673
118 Ga0068861_100007098 3300005719 Bacteria 7665
119 Ga0068861_100235088 3300005719 Bacteria 1556
120 Ga0068851_10008746 3300005834 Bacteria 4691
121 Ga0068851_10104766 3300005834 Bacteria 1504
122 Ga0068863_100002352 3300005841 Bacteria 18798
123 Ga0068863_100066420 3300005841 Unclassified 3411
124 Ga0068863_100106235 3300005841 Bacteria 2671
125 Ga0068858_100003543 3300005842 Bacteria 15456
126 Ga0068858_100010584 3300005842 Bacteria 8734
127 Ga0068858_100211529 3300005842 Bacteria 1835
128 Ga0068858_100257317 3300005842 Bacteria 1659
129 Ga0068860_100000040 3300005843 Bacteria 231652
130 Ga0068860_100001418 3300005843 Bacteria 25953
131 Ga0068860_100003309 3300005843 Bacteria 16586
132 Ga0068860_100008301 3300005843 Bacteria 10335
133 Ga0068860_100015775 3300005843 Bacteria 7376
134 Ga0068860_100018642 3300005843 Bacteria 6750
135 Ga0068860_100019177 3300005843 Bacteria 6639
136 Ga0068860_100039499 3300005843 Unclassified 4514
137 Ga0068860_100076409 3300005843 Unclassified 3185
138 Ga0068862_100052368 3300005844 Bacteria 3492
139 Ga0068862_100092530 3300005844 Bacteria 2636
140 Ga0097621_100000499 3300006237 Bacteria 27492
141 Ga0097621_100011606 3300006237 Bacteria 6494
142 Ga0097621_100014541 3300006237 Bacteria 5894
143 Ga0097621_100034375 3300006237 Bacteria 4044
144 Ga0097621_100035931 3300006237 Unclassified 3960
145 Ga0097621_100134194 3300006237 Bacteria 2110
146 Ga0068871_100002567 3300006358 Bacteria 12404
147 Ga0068871_100008100 3300006358 Bacteria 7544
148 Ga0068871_100010053 3300006358 Bacteria 6880
149 Ga0068871_100052861 3300006358 Bacteria 3291
150 Ga0068871_100074980 3300006358 Bacteria 2792
151 Ga0068871_100124752 3300006358 Bacteria 2178
152 Ga0068871_100242605 3300006358 Bacteria 1567
153 Ga0068871_100242870 3300006358 Unclassified 1566
154 Ga0075434_100009056 3300006871 Bacteria 9272
155 Ga0068865_100001094 3300006881 Bacteria 15637
156 Ga0068865_100006917 3300006881 Bacteria 6954
157 Ga0068865_100016931 3300006881 Bacteria 4677
158 Ga0068865_100058475 3300006881 Bacteria 2693
159 Ga0097620_100000045 3300006931 Bacteria 143607
160 Ga0097620_100017677 3300006931 Bacteria 7169
161 Ga0097620_100026115 3300006931 Bacteria 5858
162 Ga0097620_100072356 3300006931 Bacteria 3484
163 Ga0097620_100455542 3300006931 Bacteria 1375
164 Ga0105240_10000472 3300009093 Bacteria 74359
165 Ga0105240_10019870 3300009093 Bacteria 8972
166 Ga0105240_10022478 3300009093 Bacteria 8358
167 Ga0105240_10033401 3300009093 Bacteria 6647
168 Ga0105240_10034849 3300009093 Bacteria 6489
169 Ga0105240_10097824 3300009093 Unclassified 3575
170 Ga0105240_10246023 3300009093 Bacteria 2071
171 Ga0111539_10073279 3300009094 Bacteria 4038
172 Ga0105245_10069796 3300009098 Bacteria 3187
173 Ga0105245_10169907 3300009098 Bacteria 2076
174 Ga0105247_10003520 3300009101 Bacteria 10181
175 Ga0105247_10033980 3300009101 Bacteria 3105
176 Ga0105247_10094027 3300009101 Bacteria 1906
177 Ga0114129_10082403 3300009147 Bacteria 4470
178 Ga0105243_10315371 3300009148 Bacteria 1423
179 Ga0105241_10001733 3300009174 Bacteria 16555
180 Ga0105241_10006485 3300009174 Bacteria 8628
181 Ga0105241_10006681 3300009174 Bacteria 8489
182 Ga0105241_10337605 3300009174 Bacteria 1304
183 Ga0105242_10010544 3300009176 Bacteria 7096
184 Ga0105242_10020808 3300009176 Bacteria 5146
185 Ga0105242_10023228 3300009176 Bacteria 4888
186 Ga0105242_10042593 3300009176 Bacteria 3667
187 Ga0105242_10072142 3300009176 Unclassified 2867
188 Ga0105248_10022859 3300009177 Bacteria 6942
189 Ga0105248_10038321 3300009177 Bacteria 5364
190 Ga0105237_10001767 3300009545 Bacteria 27942
191 Ga0105237_10022501 3300009545 Bacteria 6466
192 Ga0105237_10030614 3300009545 Bacteria 5465
193 Ga0105237_10054400 3300009545 Bacteria 4010
194 Ga0105237_10060266 3300009545 Unclassified 3797
195 Ga0105237_10329180 3300009545 Bacteria 1532
196 Ga0105238_10002017 3300009551 Bacteria 20488
197 Ga0105238_10142233 3300009551 Bacteria 2375
198 Ga0105249_10011083 3300009553 Bacteria 7922
199 Ga0105249_10011427 3300009553 Bacteria 7799
200 Ga0105249_10028339 3300009553 Bacteria 5055
201 Ga0105249_10028806 3300009553 Bacteria 5013
202 Ga0105249_10231433 3300009553 Bacteria 1823
203 Ga0105249_10421385 3300009553 Bacteria 1369
204 Ga0105239_10000155 3300010375 Bacteria 98415
205 Ga0105239_10001180 3300010375 Bacteria 35825
206 Ga0105239_10003358 3300010375 Bacteria 19664
207 Ga0105239_10031409 3300010375 Bacteria 5841
208 Ga0105239_10094105 3300010375 Bacteria 3309
209 Ga0105239_10240194 3300010375 Bacteria 2033
210 Ga0157373_10009844 3300013100 Bacteria 7047
211 Ga0157371_10000284 3300013102 Bacteria 68549
212 Ga0157371_10000725 3300013102 Bacteria 38633
213 Ga0157371_10009503 3300013102 Bacteria 7649
214 Ga0157371_10075116 3300013102 Bacteria 2393
215 Ga0157371_10148051 3300013102 Bacteria 1674
216 Ga0157370_10002079 3300013104 Bacteria 24513
217 Ga0157370_10009358 3300013104 Bacteria 10483
218 Ga0157370_10021147 3300013104 Bacteria 6488
219 Ga0157370_10184844 3300013104 Unclassified 1935
220 Ga0157369_10073809 3300013105 Bacteria 3659
221 Ga0157369_10341159 3300013105 Bacteria 1556
222 Ga0157369_10351240 3300013105 Bacteria 1531
223 Ga0157369_10569704 3300013105 Bacteria 1170
224 Ga0157374_10000025 3300013296 Bacteria 245131
225 Ga0157374_10000260 3300013296 Bacteria 48732
226 Ga0157374_10002980 3300013296 Bacteria 14179
227 Ga0157374_10027083 3300013296 Bacteria 5166
228 Ga0157374_10073925 3300013296 Unclassified 3217
229 Ga0157374_10079023 3300013296 Bacteria 3116
230 Ga0157374_10160909 3300013296 Bacteria 2187
231 Ga0157374_10205062 3300013296 Bacteria 1932
232 Ga0157378_10003039 3300013297 Bacteria 14913
233 Ga0157378_10012828 3300013297 Bacteria 7335
234 Ga0157378_10013251 3300013297 Bacteria 7209
235 Ga0157378_10071685 3300013297 Bacteria 3112
236 Ga0157378_10079114 3300013297 Bacteria 2968
237 Ga0157378_10172195 3300013297 Bacteria 2031
238 Ga0157378_10329934 3300013297 Unclassified 1485
239 Ga0157378_10358304 3300013297 Bacteria 1427
240 Ga0157378_10371125 3300013297 Bacteria 1403
241 Ga0163162_10000312 3300013306 Bacteria 45022
242 Ga0163162_10001336 3300013306 Bacteria 23007
243 Ga0163162_10001523 3300013306 Bacteria 21599
244 Ga0163162_10002647 3300013306 Bacteria 16974
245 Ga0163162_10004060 3300013306 Bacteria 14047
246 Ga0163162_10004258 3300013306 Bacteria 13763
247 Ga0163162_10007829 3300013306 Bacteria 10415
248 Ga0163162_10022439 3300013306 Bacteria 6218
249 Ga0163162_10055604 3300013306 Bacteria 3985
250 Ga0163162_10074114 3300013306 Bacteria 3462
251 Ga0163162_10074490 3300013306 Bacteria 3454
252 Ga0163162_10229514 3300013306 Bacteria 1986
253 Ga0157372_10000741 3300013307 Bacteria 35589
254 Ga0157372_10018758 3300013307 Bacteria 7443
255 Ga0157372_10078712 3300013307 Bacteria 3726
256 Ga0157372_10092124 3300013307 Bacteria 3447
257 Ga0157372_10114317 3300013307 Bacteria 3094
258 Ga0157372_10240973 3300013307 Bacteria 2099
259 Ga0157372_10487144 3300013307 Unclassified 1438
260 Ga0157375_10000686 3300013308 Bacteria 29989
261 Ga0157375_10002871 3300013308 Bacteria 14932
262 Ga0157375_10010009 3300013308 Bacteria 8337
263 Ga0157375_10082885 3300013308 Bacteria 3250
264 Ga0157375_10115825 3300013308 Bacteria 2783
265 Ga0157375_10136431 3300013308 Bacteria 2577
266 Ga0157375_10149918 3300013308 Unclassified 2467
267 Ga0157375_10233750 3300013308 Unclassified 1997
268 Ga0157375_10509143 3300013308 Bacteria 1368
269 Ga0163163_10000279 3300014325 Bacteria 50882
270 Ga0163163_10000346 3300014325 Bacteria 44619
271 Ga0163163_10012583 3300014325 Bacteria 7718
272 Ga0163163_10016396 3300014325 Bacteria 6884
273 Ga0163163_10135642 3300014325 Bacteria 2502
274 Ga0163163_10238436 3300014325 Bacteria 1868
275 Ga0157380_10077609 3300014326 Bacteria 2707
276 Ga0157380_10178655 3300014326 Bacteria 1863
277 Ga0157377_10008716 3300014745 Bacteria 4957
278 Ga0157377_10017063 3300014745 Unclassified 3750
279 Ga0157379_10000242 3300014968 Bacteria 42795
280 Ga0157379_10011127 3300014968 Bacteria 7844
281 Ga0157379_10032372 3300014968 Bacteria 4662
282 Ga0157379_10052461 3300014968 Bacteria 3643
283 Ga0157379_10476069 3300014968 Unclassified 1155
284 Ga0157376_10001139 3300014969 Bacteria 17447
285 Ga0157376_10002821 3300014969 Bacteria 11880
286 Ga0157376_10003968 3300014969 Bacteria 10230
287 Ga0157376_10007029 3300014969 Bacteria 7989
288 Ga0163161_10005088 3300017792 Bacteria 9153
289 Ga0163161_10006224 3300017792 Bacteria 8270
290 Ga0206352_10293594 3300020078 Bacteria 1379
291 Ga0207697_10009658 3300025315 Unclassified 4156
292 Ga0207656_10016708 3300025321 Unclassified 2861
293 Ga0207656_10023113 3300025321 Bacteria 2500
294 Ga0207682_10028902 3300025893 Unclassified 2215
295 Ga0207642_10075620 3300025899 Bacteria 1618
296 Ga0207710_10002713 3300025900 Bacteria 8106
297 Ga0207688_10030435 3300025901 Unclassified 2976
298 Ga0207680_10000141 3300025903 Bacteria 34433
299 Ga0207680_10003927 3300025903 Bacteria 7016
300 Ga0207680_10101793 3300025903 Unclassified 1847
301 Ga0207647_10002819 3300025904 Bacteria 13115
302 Ga0207647_10027231 3300025904 Bacteria 3729
303 Ga0207645_10001794 3300025907 Bacteria 17325
304 Ga0207645_10019981 3300025907 Unclassified 4384
305 Ga0207645_10138505 3300025907 Bacteria 1585
306 Ga0207645_10195010 3300025907 Bacteria 1332
307 Ga0207705_10007257 3300025909 Bacteria 8155
308 Ga0207705_10012513 3300025909 Bacteria 6127
309 Ga0207705_10017600 3300025909 Bacteria 5114
310 Ga0207705_10032755 3300025909 Bacteria 3714
311 Ga0207705_10043803 3300025909 Bacteria 3215
312 Ga0207654_10003695 3300025911 Bacteria 7718
313 Ga0207654_10029613 3300025911 Unclassified 3000
314 Ga0207707_10270127 3300025912 Unclassified 1474
315 Ga0207695_10000282 3300025913 Bacteria 126242
316 Ga0207695_10001688 3300025913 Bacteria 35472
317 Ga0207695_10004070 3300025913 Bacteria 20110
318 Ga0207695_10028517 3300025913 Bacteria 6188
319 Ga0207695_10059033 3300025913 Bacteria 3980
320 Ga0207695_10064026 3300025913 Unclassified 3788
321 Ga0207671_10011688 3300025914 Bacteria 7117
322 Ga0207671_10011870 3300025914 Bacteria 7049
323 Ga0207671_10019242 3300025914 Bacteria 5224
324 Ga0207671_10072568 3300025914 Unclassified 2569
325 Ga0207671_10160588 3300025914 Unclassified 1740
326 Ga0207662_10021541 3300025918 Bacteria 3686
327 Ga0207657_10023896 3300025919 Bacteria 5676
328 Ga0207649_10007908 3300025920 Bacteria 5787
329 Ga0207652_10000045 3300025921 Bacteria 125343
330 Ga0207652_10025521 3300025921 Bacteria 4915
331 Ga0207681_10011577 3300025923 Bacteria 5419
332 Ga0207681_10017517 3300025923 Unclassified 4499
333 Ga0207694_10033341 3300025924 Bacteria 3945
334 Ga0207694_10057411 3300025924 Unclassified 3026
335 Ga0207650_10002954 3300025925 Bacteria 11729
336 Ga0207650_10015410 3300025925 Bacteria 5323
337 Ga0207650_10102229 3300025925 Bacteria 2208
338 Ga0207687_10116816 3300025927 Bacteria 1989
339 Ga0207644_10036096 3300025931 Unclassified 3468
340 Ga0207644_10128751 3300025931 Bacteria 1935
341 Ga0207690_10011163 3300025932 Bacteria 5361
342 Ga0207690_10255535 3300025932 Bacteria 1355
343 Ga0207706_10003994 3300025933 Bacteria 13976
344 Ga0207706_10022319 3300025933 Bacteria 5679
345 Ga0207706_10059068 3300025933 Bacteria 3378
346 Ga0207686_10165759 3300025934 Unclassified 1553
347 Ga0207686_10202293 3300025934 Bacteria 1423
348 Ga0207709_10146863 3300025935 Unclassified 1628
349 Ga0207670_10006784 3300025936 Bacteria 6368
350 Ga0207670_10070587 3300025936 Bacteria 2413
351 Ga0207669_10102711 3300025937 Bacteria 1894
352 Ga0207669_10110333 3300025937 Bacteria 1842
353 Ga0207704_10009869 3300025938 Bacteria 4628
354 Ga0207704_10201391 3300025938 Bacteria 1457
355 Ga0207691_10000012 3300025940 Bacteria 147942
356 Ga0207691_10004759 3300025940 Bacteria 13125
357 Ga0207691_10176593 3300025940 Bacteria 1868
358 Ga0207689_10008936 3300025942 Bacteria 8687
359 Ga0207689_10009466 3300025942 Bacteria 8410
360 Ga0207689_10017516 3300025942 Bacteria 6060
361 Ga0207689_10018137 3300025942 Bacteria 5944
362 Ga0207689_10030002 3300025942 Bacteria 4534
363 Ga0207689_10041033 3300025942 Unclassified 3829
364 Ga0207689_10301278 3300025942 Bacteria 1329
365 Ga0207661_10004722 3300025944 Bacteria 9540
366 Ga0207679_10017260 3300025945 Unclassified 4811
367 Ga0207679_10169190 3300025945 Bacteria 1797
368 Ga0207679_10233787 3300025945 Bacteria 1554
369 Ga0207667_10000643 3300025949 Bacteria 45271
370 Ga0207667_10012455 3300025949 Bacteria 9797
371 Ga0207667_10026076 3300025949 Bacteria 6391
372 Ga0207667_10034450 3300025949 Bacteria 5437
373 Ga0207667_10045123 3300025949 Bacteria 4669
374 Ga0207667_10132420 3300025949 Bacteria 2568
375 Ga0207651_10000216 3300025960 Bacteria 24808
376 Ga0207651_10064393 3300025960 Bacteria 2566
377 Ga0207651_10108714 3300025960 Bacteria 2076
378 Ga0207651_10159616 3300025960 Unclassified 1766
379 Ga0207712_10010440 3300025961 Bacteria 5896
380 Ga0207712_10022982 3300025961 Bacteria 4111
381 Ga0207712_10027659 3300025961 Bacteria 3788
382 Ga0207712_10076659 3300025961 Bacteria 2421
383 Ga0207668_10001361 3300025972 Bacteria 14445
384 Ga0207640_10014955 3300025981 Bacteria 4480
385 Ga0207640_10178269 3300025981 Unclassified 1591
386 Ga0207658_10000374 3300025986 Bacteria 43784
387 Ga0207658_10008025 3300025986 Bacteria 7193
388 Ga0207658_10033838 3300025986 Unclassified 3648
389 Ga0207658_10057016 3300025986 Bacteria 2901
390 Ga0207658_10058596 3300025986 Bacteria 2867
391 Ga0207658_10108421 3300025986 Bacteria 2190
392 Ga0207677_10000984 3300026023 Bacteria 15691
393 Ga0207677_10006012 3300026023 Bacteria 6614
394 Ga0207677_10018387 3300026023 Unclassified 4193
395 Ga0207703_10019138 3300026035 Bacteria 5348
396 Ga0207703_10035352 3300026035 Bacteria 3970
397 Ga0207703_10185998 3300026035 Bacteria 1836
398 Ga0207639_10002390 3300026041 Bacteria 12590
399 Ga0207639_10032242 3300026041 Unclassified 3856
400 Ga0207678_10013503 3300026067 Bacteria 7170
401 Ga0207678_10031808 3300026067 Unclassified 4601
402 Ga0207702_10025199 3300026078 Bacteria 4936
403 Ga0207702_10026475 3300026078 Bacteria 4814
404 Ga0207641_10000133 3300026088 Bacteria 109199
405 Ga0207648_10010253 3300026089 Bacteria 8899
406 Ga0207648_10027821 3300026089 Bacteria 5016
407 Ga0207648_10056263 3300026089 Bacteria 3433
408 Ga0207648_10067242 3300026089 Bacteria 3125
409 Ga0207648_10083158 3300026089 Bacteria 2792
410 Ga0207648_10164609 3300026089 Bacteria 1959
411 Ga0207676_10000697 3300026095 Bacteria 26479
412 Ga0207676_10005018 3300026095 Bacteria 9372
413 Ga0207674_10001630 3300026116 Bacteria 28871
414 Ga0207674_10014867 3300026116 Bacteria 8583
415 Ga0207675_100005430 3300026118 Bacteria 12213
416 Ga0207675_100034881 3300026118 Bacteria 4691
417 Ga0207675_100095057 3300026118 Bacteria 2803
418 Ga0207683_10002013 3300026121 Bacteria 17984
419 Ga0207683_10025467 3300026121 Bacteria 5105
420 Ga0207683_10025629 3300026121 Bacteria 5088
421 Ga0207683_10107571 3300026121 Bacteria 2495
422 Ga0207698_10003512 3300026142 Bacteria 9452
423 Ga0207698_10009340 3300026142 Bacteria 6249
424 Ga0207698_10014863 3300026142 Bacteria 5190
425 Ga0207698_10032463 3300026142 Bacteria 3782
426 Ga0207698_10034087 3300026142 Bacteria 3707
427 Ga0268266_10000026 3300028379 Bacteria 434485
428 Ga0268266_10005379 3300028379 Bacteria 11960
429 Ga0268266_10035267 3300028379 Unclassified 4255
430 Ga0268266_10332080 3300028379 Bacteria 1425
431 Ga0268265_10009351 3300028380 Bacteria 6624
432 Ga0268265_10316991 3300028380 Bacteria 1410
433 Ga0268264_10000015 3300028381 Bacteria 508501
434 Ga0268264_10000019 3300028381 Bacteria 488112
435 Ga0268264_10000054 3300028381 Bacteria 317048
436 Ga0268264_10003975 3300028381 Bacteria 12651
437 Ga0268264_10008390 3300028381 Bacteria 8589
438 Ga0268264_10008474 3300028381 Bacteria 8550
439 Ga0268264_10008570 3300028381 Bacteria 8500
440 Ga0268264_10008865 3300028381 Bacteria 8337
441 Ga0268264_10011860 3300028381 Bacteria 7180
442 Ga0268264_10046760 3300028381 Unclassified 3595
443 Ga0307515_10000024 3300028794 Bacteria 393119
444 Ga0307511_10000228 3300030521 Bacteria 57237
445 Ga0307513_10168728 3300031456 Unclassified 2069
446 Ga0307513_10202106 3300031456 Bacteria 1827
447 Ga0307509_10015498 3300031507 Bacteria 8889
448 Ga0307509_10171864 3300031507 Bacteria 2045
449 Ga0307509_10255934 3300031507 Bacteria 1530
450 Ga0307508_10001024 3300031616 Bacteria 32462
451 Ga0307508_10218480 3300031616 Bacteria 1506
452 Ga0307516_10033259 3300031730 Bacteria 5188
453 Ga0307405_10005405 3300031731 Bacteria 6160
454 Ga0307413_10008468 3300031824 Bacteria 4858
455 Ga0307411_10061340 3300032005 Bacteria 2503
456 Ga0307510_10017333 3300033180 Bacteria 8497
457 Ga0373943_0085951 3300035170 Bacteria 1621
458 Ga0373955_0056898 3300035172 Unclassified 2147
459 Ga0373937_0006671 3300036401 Bacteria 9965
460 Ga0373937_0339533 3300036401 Unclassified 1422
461 Ga0395899_0007489 3300037312 Bacteria 8432
462 Ga0395899_0061852 3300037312 Bacteria 2757
463 Ga0395899_0063013 3300037312 Bacteria 2729
464 Ga0395900_0004195 3300037418 Bacteria 15298
465 Ga0395900_0008499 3300037418 Bacteria 10554
466 Ga0395898_0003718 3300037466 Bacteria 16922
467 Ga0395898_0013466 3300037466 Bacteria 8421
468 Ga0395898_0081915 3300037466 Bacteria 3111
469 Ga0395905_0289476 3300037471 Bacteria 1525
470 Ga0395901_0005062 3300038443 Bacteria 13315
471 Ga0395901_0028050 3300038443 Bacteria 5790
472 Ga0395901_0090262 3300038443 Bacteria 3207
473 Ga0451798_0707333 3300041458 Bacteria 1309
474 Ga0451839_0329258 3300041496 Bacteria 1383
475 Ga0451841_0745731 3300041498 Bacteria 1596
476 Ga0439433_0015436 3300041999 Bacteria 1686
477 Ga0439449_0015494 3300042007 Bacteria 2865
478 Ga0439457_000930 3300042014 Bacteria 8796
479 Ga0439462_0006134 3300042015 Bacteria 2979
480 Ga0466969_0000004 3300044656 Bacteria 168068
481 Ga0466969_0153723 3300044656 Bacteria 1059
482 Ga0466972_0000017 3300044658 Bacteria 199884
483 Ga0466966_0000295 3300044684 Bacteria 32723
484 Ga0453684_0266906 3300044712 Bacteria 1958
485 Ga0466968_0035018 3300044735 Bacteria 2099
486 Ga0466957_0000367 3300044842 Bacteria 22106
487 Ga0466957_0015326 3300044842 Bacteria 4479
488 Ga0466959_0000004 3300045049 Bacteria 216815
489 Ga0495638_0033016 3300046460 Bacteria 3311
490 Ga0495653_0060576 3300046463 Bacteria 2867
491 Ga0495650_0053440 3300046471 Unclassified 1654
492 Ga0495580_0042202 3300046472 Bacteria 3251
493 Ga0495580_0075482 3300046472 Unclassified 2352
494 Ga0495582_0032503 3300046473 Unclassified 2869
495 Ga0495606_0003341 3300046507 Bacteria 17112
496 Ga0495608_0067439 3300046511 Bacteria 2340
497 Ga0495628_0022064 3300046516 Bacteria 5233
498 Ga0495630_0011846 3300046517 Bacteria 6319
499 Ga0495648_0002002 3300046524 Bacteria 19295
500 Ga0495652_0129351 3300046529 Bacteria 2001
501 Ga0495586_0009224 3300046535 Bacteria 5247
502 Ga0495586_0158828 3300046535 Unclassified 1274
503 Ga0495587_0025753 3300046536 Bacteria 3594
504 Ga0495633_0024540 3300046558 Bacteria 2979
505 Ga0495667_0034520 3300046559 Bacteria 3383
506 Ga0495668_0001697 3300046616 Bacteria 20372
507 Ga0495625_0043549 3300046660 Unclassified 3255
508 Ga0495658_0016941 3300046683 Unclassified 3756
509 Ga0495649_0026980 3300046694 Bacteria 3189
510 Ga0495600_0075759 3300046809 Unclassified 2197
511 Ga0495636_0000184 3300047318 Bacteria 24852
512 Ga0495674_0034710 3300047319 Unclassified 4558
513 Ga0495672_0052934 3300047320 Bacteria 2382
514 Ga0495676_0186767 3300047321 Bacteria 1448
515 Ga0495680_0037499 3300047322 Bacteria 3882
516 Ga0495687_000031 3300047443 Bacteria 274659
517 Ga0495675_0172955 3300047444 Bacteria 1326
518 Ga0495684_0053521 3300047471 Unclassified 3080
519 Ga0495686_0000005 3300047472 Bacteria 827143
520 Ga0496100_0141985 3300048903 Unclassified 1703
521 Ga0496104_0313801 3300048907 Bacteria 1481
522 Ga0496109_0192296 3300048912 Bacteria 1918
523 Ga0496109_0429066 3300048912 Unclassified 1249
524 Ga0496110_0019814 3300048913 Bacteria 5669
525 Ga0496115_0241398 3300048918 Bacteria 1489
526 Ga0501298_011202 3300049521 Unclassified 1554
527 Ga0501034_0022151 3300049571 Bacteria 6473
528 Ga0501036_0094061 3300049572 Unclassified 2533
529 Ga0501198_003248 3300049649 Bacteria 2217
530 Ga0501223_015144 3300049663 Bacteria 1528
531 Ga0501233_024237 3300049668 Bacteria 1326
532 Ga0501242_000722 3300049674 Unclassified 3057
533 Ga0501243_002907 3300049675 Bacteria 2521
534 Ga0501251_001781 3300049681 Bacteria 2025
535 Ga0501257_007725 3300049686 Bacteria 2406
536 Ga0501221_008146 3300049704 Bacteria 1816
537 Ga0501221_014661 3300049704 Bacteria 1461
538 Ga0501225_0006624 3300049705 Bacteria 3379
539 Ga0501266_003910 3300049763 Bacteria 1844
540 Ga0501044_0006478 3300049823 Bacteria 12931
541 nmdc:mga05p37_2793_c1 3300050507 Bacteria 20304
542 Ga0495619_0042013 3300053085 Unclassified 2993
543 Ga0500583_0000068 3300053092 Bacteria 64748
544 Ga0500583_0001499 3300053092 Bacteria 6719
545 Ga0500568_0007023 3300053139 Bacteria 5570
546 Ga0500603_027821 3300053150 Bacteria 1439
547 Ga0500616_0006698 3300053153 Bacteria 7477
548 Ga0500616_0026690 3300053153 Unclassified 3195
549 Ga0500622_0000926 3300053156 Bacteria 24930
550 Ga0500622_0046200 3300053156 Bacteria 2252
551 Ga0500636_0053601 3300053177 Bacteria 2367
552 Ga0500637_0076844 3300053178 Bacteria 1926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0153723 Ga0466969_0153723_41_1018 325
2 3300025914 Ga0207671_10160588 Ga0207671_101605882 331
3 3300005327 Ga0070658_10081985 Ga0070658_100819853 333
4 3300005339 Ga0070660_100020321 Ga0070660_1000203213 333
5 3300005530 Ga0070679_100136389 Ga0070679_1001363893 333
6 3300005578 Ga0068854_100282405 Ga0068854_1002824052 333
7 3300005614 Ga0068856_100339680 Ga0068856_1003396802 333
8 3300005616 Ga0068852_100000848 Ga0068852_1000008488 333
9 3300005718 Ga0068866_10082359 Ga0068866_100823592 333
10 3300005843 Ga0068860_100015775 Ga0068860_1000157753 333
11 3300025899 Ga0207642_10075620 Ga0207642_100756202 333
12 3300025909 Ga0207705_10012513 Ga0207705_100125134 333
13 3300025921 Ga0207652_10025521 Ga0207652_100255213 333
14 3300026142 Ga0207698_10034087 Ga0207698_100340873 333
15 3300028381 Ga0268264_10011860 Ga0268264_100118606 333
16 3300005331 Ga0070670_100103503 Ga0070670_1001035033 335
17 3300014325 Ga0163163_10238436 Ga0163163_102384362 335
18 3300025925 Ga0207650_10002954 Ga0207650_100029543 335
19 3300041999 Ga0439433_0015436 Ga0439433_0015436_443_1453 335
20 3300042007 Ga0439449_0015494 Ga0439449_0015494_1243_2253 335
21 3300006237 Ga0097621_100000499 Ga0097621_10000049915 337
22 3300006358 Ga0068871_100002567 Ga0068871_10000256710 337
23 3300048903 Ga0496100_0141985 Ga0496100_0141985_296_1312 337
24 3300005354 Ga0070675_100167321 Ga0070675_1001673211 338
25 3300005544 Ga0070686_100036727 Ga0070686_1000367271 338
26 3300005617 Ga0068859_100017677 Ga0068859_10001767710 338
27 3300006931 Ga0097620_100017677 Ga0097620_10001767710 338
28 3300009545 Ga0105237_10329180 Ga0105237_103291802 338
29 3300009553 Ga0105249_10421385 Ga0105249_104213852 338
30 3300013296 Ga0157374_10000260 Ga0157374_1000026035 338
31 3300013306 Ga0163162_10004060 Ga0163162_100040608 338
32 3300013306 Ga0163162_10229514 Ga0163162_102295142 338
33 3300013308 Ga0157375_10115825 Ga0157375_101158253 338
34 3300014325 Ga0163163_10000279 Ga0163163_1000027911 338
35 3300014745 Ga0157377_10008716 Ga0157377_100087162 338
36 3300014968 Ga0157379_10476069 Ga0157379_104760691 338
37 3300025940 Ga0207691_10176593 Ga0207691_101765932 338
38 3300035170 Ga0373943_0085951 Ga0373943_0085951_471_1487 338
39 3300041496 Ga0451839_0329258 Ga0451839_0329258_83_1099 338
40 3300046472 Ga0495580_0042202 Ga0495580_0042202_1385_2401 338
41 3300047320 Ga0495672_0052934 Ga0495672_0052934_1103_2119 338
42 3300047321 Ga0495676_0186767 Ga0495676_0186767_352_1368 338
43 3300048912 Ga0496109_0429066 Ga0496109_0429066_199_1215 338
44 3300048913 Ga0496110_0019814 Ga0496110_0019814_3335_4351 338
45 3300005327 Ga0070658_10048378 Ga0070658_100483783 339
46 3300005328 Ga0070676_10004865 Ga0070676_100048652 339
47 3300005331 Ga0070670_100053373 Ga0070670_1000533733 339
48 3300005334 Ga0068869_100108650 Ga0068869_1001086502 339
49 3300005335 Ga0070666_10118377 Ga0070666_101183772 339
50 3300005338 Ga0068868_100003257 Ga0068868_1000032577 339
51 3300005339 Ga0070660_100078196 Ga0070660_1000781962 339
52 3300005356 Ga0070674_100158238 Ga0070674_1001582382 339
53 3300005365 Ga0070688_100069983 Ga0070688_1000699832 339
54 3300005367 Ga0070667_100011432 Ga0070667_1000114327 339
55 3300005456 Ga0070678_100075904 Ga0070678_1000759044 339
56 3300005458 Ga0070681_10035209 Ga0070681_100352096 339
57 3300005459 Ga0068867_100066748 Ga0068867_1000667482 339
58 3300005539 Ga0068853_100128415 Ga0068853_1001284152 339
59 3300005548 Ga0070665_100000018 Ga0070665_100000018147 339
60 3300005548 Ga0070665_100076193 Ga0070665_1000761933 339
61 3300005563 Ga0068855_100019495 Ga0068855_1000194957 339
62 3300005578 Ga0068854_100026109 Ga0068854_1000261093 339
63 3300005578 Ga0068854_100147904 Ga0068854_1001479042 339
64 3300005578 Ga0068854_100231846 Ga0068854_1002318462 339
65 3300005614 Ga0068856_100044643 Ga0068856_1000446433 339
66 3300005614 Ga0068856_100126812 Ga0068856_1001268122 339
67 3300005616 Ga0068852_100008024 Ga0068852_1000080245 339
68 3300005617 Ga0068859_100026115 Ga0068859_1000261156 339
69 3300005718 Ga0068866_10089437 Ga0068866_100894372 339
70 3300005719 Ga0068861_100235088 Ga0068861_1002350882 339
71 3300005843 Ga0068860_100000040 Ga0068860_100000040188 339
72 3300005843 Ga0068860_100039499 Ga0068860_1000394995 339
73 3300006237 Ga0097621_100035931 Ga0097621_1000359313 339
74 3300006358 Ga0068871_100008100 Ga0068871_1000081003 339
75 3300006881 Ga0068865_100006917 Ga0068865_1000069175 339
76 3300006931 Ga0097620_100026115 Ga0097620_1000261156 339
77 3300009093 Ga0105240_10019870 Ga0105240_100198704 339
78 3300009093 Ga0105240_10022478 Ga0105240_100224787 339
79 3300009093 Ga0105240_10097824 Ga0105240_100978242 339
80 3300009176 Ga0105242_10023228 Ga0105242_100232282 339
81 3300009545 Ga0105237_10001767 Ga0105237_1000176720 339
82 3300009545 Ga0105237_10060266 Ga0105237_100602662 339
83 3300010375 Ga0105239_10001180 Ga0105239_100011805 339
84 3300013102 Ga0157371_10148051 Ga0157371_101480512 339
85 3300013104 Ga0157370_10009358 Ga0157370_100093587 339
86 3300013105 Ga0157369_10073809 Ga0157369_100738092 339
87 3300013105 Ga0157369_10351240 Ga0157369_103512402 339
88 3300013297 Ga0157378_10329934 Ga0157378_103299342 339
89 3300013297 Ga0157378_10358304 Ga0157378_103583042 339
90 3300013297 Ga0157378_10371125 Ga0157378_103711251 339
91 3300013306 Ga0163162_10001336 Ga0163162_100013365 339
92 3300013307 Ga0157372_10000741 Ga0157372_100007415 339
93 3300025893 Ga0207682_10028902 Ga0207682_100289022 339
94 3300025901 Ga0207688_10030435 Ga0207688_100304351 339
95 3300025903 Ga0207680_10101793 Ga0207680_101017932 339
96 3300025904 Ga0207647_10002819 Ga0207647_100028196 339
97 3300025907 Ga0207645_10019981 Ga0207645_100199812 339
98 3300025909 Ga0207705_10032755 Ga0207705_100327553 339
99 3300025912 Ga0207707_10270127 Ga0207707_102701272 339
100 3300025913 Ga0207695_10028517 Ga0207695_100285175 339
101 3300025914 Ga0207671_10019242 Ga0207671_100192423 339
102 3300025918 Ga0207662_10021541 Ga0207662_100215413 339
103 3300025923 Ga0207681_10017517 Ga0207681_100175172 339
104 3300025924 Ga0207694_10033341 Ga0207694_100333414 339
105 3300025931 Ga0207644_10036096 Ga0207644_100360964 339
106 3300025932 Ga0207690_10011163 Ga0207690_100111633 339
107 3300025934 Ga0207686_10165759 Ga0207686_101657592 339
108 3300025937 Ga0207669_10102711 Ga0207669_101027112 339
109 3300025940 Ga0207691_10004759 Ga0207691_100047595 339
110 3300025942 Ga0207689_10018137 Ga0207689_100181372 339
111 3300025942 Ga0207689_10041033 Ga0207689_100410333 339
112 3300025949 Ga0207667_10000643 Ga0207667_1000064312 339
113 3300025960 Ga0207651_10159616 Ga0207651_101596162 339
114 3300025961 Ga0207712_10022982 Ga0207712_100229825 339
115 3300025981 Ga0207640_10178269 Ga0207640_101782692 339
116 3300025986 Ga0207658_10033838 Ga0207658_100338383 339
117 3300026041 Ga0207639_10032242 Ga0207639_100322424 339
118 3300026078 Ga0207702_10025199 Ga0207702_100251994 339
119 3300026089 Ga0207648_10027821 Ga0207648_100278215 339
120 3300026116 Ga0207674_10001630 Ga0207674_1000163011 339
121 3300026118 Ga0207675_100095057 Ga0207675_1000950573 339
122 3300026121 Ga0207683_10002013 Ga0207683_1000201313 339
123 3300026121 Ga0207683_10107571 Ga0207683_101075712 339
124 3300026142 Ga0207698_10032463 Ga0207698_100324633 339
125 3300028379 Ga0268266_10000026 Ga0268266_10000026214 339
126 3300028379 Ga0268266_10035267 Ga0268266_100352673 339
127 3300028381 Ga0268264_10000015 Ga0268264_10000015111 339
128 3300028381 Ga0268264_10000054 Ga0268264_10000054162 339
129 3300028381 Ga0268264_10046760 Ga0268264_100467602 339
130 3300031507 Ga0307509_10255934 Ga0307509_102559342 339
131 3300031730 Ga0307516_10033259 Ga0307516_100332592 339
132 3300033180 Ga0307510_10017333 Ga0307510_100173338 339
133 3300037312 Ga0395899_0061852 Ga0395899_0061852_64_1089 339
134 3300037466 Ga0395898_0013466 Ga0395898_0013466_2261_3286 339
135 3300037471 Ga0395905_0289476 Ga0395905_0289476_396_1421 339
136 3300038443 Ga0395901_0028050 Ga0395901_0028050_85_1110 339
137 3300044735 Ga0466968_0035018 Ga0466968_0035018_366_1385 339
138 3300044842 Ga0466957_0015326 Ga0466957_0015326_1600_2625 339
139 3300046460 Ga0495638_0033016 Ga0495638_0033016_1638_2663 339
140 3300046471 Ga0495650_0053440 Ga0495650_0053440_611_1633 339
141 3300046507 Ga0495606_0003341 Ga0495606_0003341_12424_13443 339
142 3300046524 Ga0495648_0002002 Ga0495648_0002002_13034_14059 339
143 3300047443 Ga0495687_000031 Ga0495687_000031_128429_129454 339
144 3300047444 Ga0495675_0172955 Ga0495675_0172955_25_1047 339
145 3300049521 Ga0501298_011202 Ga0501298_011202_173_1195 339
146 3300049649 Ga0501198_003248 Ga0501198_003248_804_1826 339
147 3300049704 Ga0501221_008146 Ga0501221_008146_169_1191 339
148 3300049705 Ga0501225_0006624 Ga0501225_0006624_824_1846 339
149 3300049763 Ga0501266_003910 Ga0501266_003910_527_1549 339
150 3300049823 Ga0501044_0006478 Ga0501044_0006478_2838_3863 339
151 3300053156 Ga0500622_0000926 Ga0500622_0000926_21806_22831 339
152 3300005331 Ga0070670_100236328 Ga0070670_1002363281 340
153 3300005367 Ga0070667_100014894 Ga0070667_1000148945 340
154 3300005618 Ga0068864_100152802 Ga0068864_1001528022 340
155 3300005834 Ga0068851_10008746 Ga0068851_100087464 340
156 3300013104 Ga0157370_10184844 Ga0157370_101848442 340
157 3300025321 Ga0207656_10016708 Ga0207656_100167082 340
158 3300006358 Ga0068871_100052861 Ga0068871_1000528612 341
159 3300009101 Ga0105247_10003520 Ga0105247_1000352010 341
160 3300009148 Ga0105243_10315371 Ga0105243_103153712 341
161 3300009174 Ga0105241_10001733 Ga0105241_100017334 341
162 3300009176 Ga0105242_10020808 Ga0105242_100208083 341
163 3300009545 Ga0105237_10054400 Ga0105237_100544003 341
164 3300009553 Ga0105249_10011083 Ga0105249_100110835 341
165 3300013297 Ga0157378_10172195 Ga0157378_101721952 341
166 3300013306 Ga0163162_10004258 Ga0163162_1000425810 341
167 3300013308 Ga0157375_10136431 Ga0157375_101364312 341
168 3300014325 Ga0163163_10135642 Ga0163163_101356422 341
169 3300025945 Ga0207679_10233787 Ga0207679_102337872 341
170 3300049663 Ga0501223_015144 Ga0501223_015144_175_1203 341
171 3300049668 Ga0501233_024237 Ga0501233_024237_123_1151 341
172 3300049674 Ga0501242_000722 Ga0501242_000722_514_1542 341
173 3300049681 Ga0501251_001781 Ga0501251_001781_951_1979 341
174 3300049704 Ga0501221_014661 Ga0501221_014661_348_1376 341
175 3300005334 Ga0068869_100294395 Ga0068869_1002943951 345
176 3300005844 Ga0068862_100052368 Ga0068862_1000523682 345
177 3300009174 Ga0105241_10337605 Ga0105241_103376051 345
178 3300009553 Ga0105249_10231433 Ga0105249_102314332 345
179 3300025942 Ga0207689_10301278 Ga0207689_103012781 345
180 3300025986 Ga0207658_10058596 Ga0207658_100585963 345
181 3300026089 Ga0207648_10164609 Ga0207648_101646092 345
182 3300005614 Ga0068856_100075596 Ga0068856_1000755963 353
183 3300013105 Ga0157369_10569704 Ga0157369_105697041 353
184 3300025949 Ga0207667_10132420 Ga0207667_101324202 353
185 3300031731 Ga0307405_10005405 Ga0307405_100054057 357
186 3300031824 Ga0307413_10008468 Ga0307413_100084684 357
187 3300032005 Ga0307411_10061340 Ga0307411_100613402 357
188 3300005354 Ga0070675_100007290 Ga0070675_1000072905 359
189 3300013307 Ga0157372_10078712 Ga0157372_100787122 359
190 3300014325 Ga0163163_10012583 Ga0163163_100125836 359
191 3300049675 Ga0501243_002907 Ga0501243_002907_1139_2221 359
192 3300049686 Ga0501257_007725 Ga0501257_007725_234_1316 359
193 iso_pu_bacteria 2738541278 2738724510 359
194 3300005331 Ga0070670_100120903 Ga0070670_1001209032 360
195 3300005355 Ga0070671_100125386 Ga0070671_1001253862 360
196 3300005564 Ga0070664_100001670 Ga0070664_1000016705 360
197 3300013296 Ga0157374_10205062 Ga0157374_102050621 360
198 3300025321 Ga0207656_10023113 Ga0207656_100231132 360
199 3300025925 Ga0207650_10102229 Ga0207650_101022292 360
200 3300025931 Ga0207644_10128751 Ga0207644_101287512 360
201 3300025944 Ga0207661_10004722 Ga0207661_100047229 360
202 3300005331 Ga0070670_100200416 Ga0070670_1002004161 361
203 3300005335 Ga0070666_10048232 Ga0070666_100482322 361
204 3300005338 Ga0068868_100023458 Ga0068868_1000234582 361
205 3300005355 Ga0070671_100004244 Ga0070671_1000042445 361
206 3300005367 Ga0070667_100007822 Ga0070667_1000078226 361
207 3300005456 Ga0070678_100010622 Ga0070678_1000106226 361
208 3300005618 Ga0068864_100284515 Ga0068864_1002845152 361
209 3300005841 Ga0068863_100066420 Ga0068863_1000664202 361
210 3300005841 Ga0068863_100106235 Ga0068863_1001062353 361
211 3300005842 Ga0068858_100257317 Ga0068858_1002573172 361
212 3300005843 Ga0068860_100008301 Ga0068860_1000083013 361
213 3300006871 Ga0075434_100009056 Ga0075434_1000090565 361
214 3300009177 Ga0105248_10022859 Ga0105248_100228597 361
215 3300013296 Ga0157374_10027083 Ga0157374_100270834 361
216 3300013297 Ga0157378_10003039 Ga0157378_100030394 361
217 3300013297 Ga0157378_10012828 Ga0157378_100128282 361
218 3300013306 Ga0163162_10001523 Ga0163162_1000152311 361
219 3300013308 Ga0157375_10000686 Ga0157375_1000068618 361
220 3300014325 Ga0163163_10016396 Ga0163163_100163968 361
221 3300014968 Ga0157379_10011127 Ga0157379_100111276 361
222 3300014969 Ga0157376_10001139 Ga0157376_100011397 361
223 3300025986 Ga0207658_10008025 Ga0207658_100080253 361
224 3300026023 Ga0207677_10006012 Ga0207677_100060126 361
225 3300026121 Ga0207683_10025629 Ga0207683_100256292 361
226 3300028381 Ga0268264_10008865 Ga0268264_100088653 361
227 3300047318 Ga0495636_0000184 Ga0495636_0000184_4945_6030 361
228 3300003320 rootH2_10259783 rootH2_102597831 362
229 3300003323 rootH1_10199503 rootH1_101995034 362
230 3300005329 Ga0070683_100033730 Ga0070683_1000337302 362
231 3300005330 Ga0070690_100047878 Ga0070690_1000478782 362
232 3300005334 Ga0068869_100063697 Ga0068869_1000636972 362
233 3300005335 Ga0070666_10000031 Ga0070666_1000003141 362
234 3300005335 Ga0070666_10053892 Ga0070666_100538921 362
235 3300005338 Ga0068868_100000427 Ga0068868_10000042715 362
236 3300005338 Ga0068868_100128566 Ga0068868_1001285662 362
237 3300005340 Ga0070689_100044843 Ga0070689_1000448433 362
238 3300005340 Ga0070689_100098701 Ga0070689_1000987012 362
239 3300005344 Ga0070661_100019232 Ga0070661_1000192322 362
240 3300005344 Ga0070661_100108251 Ga0070661_1001082512 362
241 3300005347 Ga0070668_100180515 Ga0070668_1001805151 362
242 3300005353 Ga0070669_100086199 Ga0070669_1000861993 362
243 3300005354 Ga0070675_100064519 Ga0070675_1000645193 362
244 3300005354 Ga0070675_100188121 Ga0070675_1001881211 362
245 3300005356 Ga0070674_100062207 Ga0070674_1000622071 362
246 3300005364 Ga0070673_100022372 Ga0070673_1000223723 362
247 3300005365 Ga0070688_100092656 Ga0070688_1000926561 362
248 3300005367 Ga0070667_100053693 Ga0070667_1000536933 362
249 3300005456 Ga0070678_100057194 Ga0070678_1000571943 362
250 3300005457 Ga0070662_100009734 Ga0070662_1000097344 362
251 3300005457 Ga0070662_100011948 Ga0070662_1000119484 362
252 3300005457 Ga0070662_100013483 Ga0070662_1000134835 362
253 3300005459 Ga0068867_100276970 Ga0068867_1002769702 362
254 3300005535 Ga0070684_100157993 Ga0070684_1001579931 362
255 3300005548 Ga0070665_100130947 Ga0070665_1001309473 362
256 3300005577 Ga0068857_100007841 Ga0068857_1000078414 362
257 3300005616 Ga0068852_100005012 Ga0068852_1000050122 362
258 3300005617 Ga0068859_100000045 Ga0068859_10000004599 362
259 3300005617 Ga0068859_100072364 Ga0068859_1000723645 362
260 3300005617 Ga0068859_100455501 Ga0068859_1004555011 362
261 3300005618 Ga0068864_100001485 Ga0068864_10000148515 362
262 3300005618 Ga0068864_100124691 Ga0068864_1001246911 362
263 3300005834 Ga0068851_10104766 Ga0068851_101047662 362
264 3300005841 Ga0068863_100002352 Ga0068863_10000235214 362
265 3300005842 Ga0068858_100003543 Ga0068858_1000035436 362
266 3300005843 Ga0068860_100003309 Ga0068860_1000033093 362
267 3300005843 Ga0068860_100076409 Ga0068860_1000764092 362
268 3300006237 Ga0097621_100014541 Ga0097621_1000145413 362
269 3300006237 Ga0097621_100134194 Ga0097621_1001341942 362
270 3300006358 Ga0068871_100124752 Ga0068871_1001247522 362
271 3300006358 Ga0068871_100242605 Ga0068871_1002426052 362
272 3300006358 Ga0068871_100242870 Ga0068871_1002428702 362
273 3300006881 Ga0068865_100058475 Ga0068865_1000584752 362
274 3300006931 Ga0097620_100000045 Ga0097620_10000004541 362
275 3300006931 Ga0097620_100072356 Ga0097620_1000723562 362
276 3300006931 Ga0097620_100455542 Ga0097620_1004555421 362
277 3300009093 Ga0105240_10034849 Ga0105240_100348497 362
278 3300009098 Ga0105245_10069796 Ga0105245_100697962 362
279 3300009101 Ga0105247_10094027 Ga0105247_100940271 362
280 3300009147 Ga0114129_10082403 Ga0114129_100824034 362
281 3300009176 Ga0105242_10010544 Ga0105242_100105445 362
282 3300009176 Ga0105242_10072142 Ga0105242_100721423 362
283 3300009177 Ga0105248_10038321 Ga0105248_100383217 362
284 3300009553 Ga0105249_10011427 Ga0105249_100114277 362
285 3300010375 Ga0105239_10003358 Ga0105239_1000335814 362
286 3300013296 Ga0157374_10079023 Ga0157374_100790233 362
287 3300013297 Ga0157378_10071685 Ga0157378_100716853 362
288 3300013306 Ga0163162_10007829 Ga0163162_1000782912 362
289 3300013306 Ga0163162_10022439 Ga0163162_100224393 362
290 3300013306 Ga0163162_10055604 Ga0163162_100556042 362
291 3300013306 Ga0163162_10074490 Ga0163162_100744903 362
292 3300013307 Ga0157372_10240973 Ga0157372_102409732 362
293 3300013308 Ga0157375_10010009 Ga0157375_100100094 362
294 3300013308 Ga0157375_10082885 Ga0157375_100828851 362
295 3300013308 Ga0157375_10509143 Ga0157375_105091431 362
296 3300014326 Ga0157380_10077609 Ga0157380_100776092 362
297 3300014326 Ga0157380_10178655 Ga0157380_101786552 362
298 3300014745 Ga0157377_10017063 Ga0157377_100170633 362
299 3300014968 Ga0157379_10032372 Ga0157379_100323722 362
300 3300014969 Ga0157376_10003968 Ga0157376_100039683 362
301 3300014969 Ga0157376_10007029 Ga0157376_100070296 362
302 3300017792 Ga0163161_10005088 Ga0163161_100050889 362
303 3300017792 Ga0163161_10006224 Ga0163161_100062245 362
304 3300025315 Ga0207697_10009658 Ga0207697_100096582 362
305 3300025900 Ga0207710_10002713 Ga0207710_100027132 362
306 3300025903 Ga0207680_10000141 Ga0207680_1000014126 362
307 3300025907 Ga0207645_10138505 Ga0207645_101385052 362
308 3300025907 Ga0207645_10195010 Ga0207645_101950101 362
309 3300025911 Ga0207654_10003695 Ga0207654_100036952 362
310 3300025914 Ga0207671_10011688 Ga0207671_100116884 362
311 3300025920 Ga0207649_10007908 Ga0207649_100079082 362
312 3300025923 Ga0207681_10011577 Ga0207681_100115773 362
313 3300025932 Ga0207690_10255535 Ga0207690_102555351 362
314 3300025933 Ga0207706_10003994 Ga0207706_100039946 362
315 3300025933 Ga0207706_10022319 Ga0207706_100223195 362
316 3300025933 Ga0207706_10059068 Ga0207706_100590682 362
317 3300025934 Ga0207686_10202293 Ga0207686_102022931 362
318 3300025935 Ga0207709_10146863 Ga0207709_101468632 362
319 3300025936 Ga0207670_10006784 Ga0207670_100067848 362
320 3300025936 Ga0207670_10070587 Ga0207670_100705873 362
321 3300025937 Ga0207669_10110333 Ga0207669_101103332 362
322 3300025938 Ga0207704_10201391 Ga0207704_102013912 362
323 3300025942 Ga0207689_10008936 Ga0207689_100089363 362
324 3300025942 Ga0207689_10009466 Ga0207689_100094667 362
325 3300025942 Ga0207689_10017516 Ga0207689_100175162 362
326 3300025945 Ga0207679_10017260 Ga0207679_100172602 362
327 3300025945 Ga0207679_10169190 Ga0207679_101691902 362
328 3300025960 Ga0207651_10064393 Ga0207651_100643931 362
329 3300025960 Ga0207651_10108714 Ga0207651_101087142 362
330 3300025961 Ga0207712_10027659 Ga0207712_100276592 362
331 3300025961 Ga0207712_10076659 Ga0207712_100766592 362
332 3300025986 Ga0207658_10057016 Ga0207658_100570162 362
333 3300025986 Ga0207658_10108421 Ga0207658_101084212 362
334 3300026023 Ga0207677_10018387 Ga0207677_100183874 362
335 3300026035 Ga0207703_10035352 Ga0207703_100353523 362
336 3300026035 Ga0207703_10185998 Ga0207703_101859982 362
337 3300026067 Ga0207678_10031808 Ga0207678_100318082 362
338 3300026088 Ga0207641_10000133 Ga0207641_1000013386 362
339 3300026089 Ga0207648_10056263 Ga0207648_100562632 362
340 3300026089 Ga0207648_10067242 Ga0207648_100672423 362
341 3300026095 Ga0207676_10005018 Ga0207676_1000501810 362
342 3300026116 Ga0207674_10014867 Ga0207674_100148672 362
343 3300026118 Ga0207675_100034881 Ga0207675_1000348814 362
344 3300026121 Ga0207683_10025467 Ga0207683_100254675 362
345 3300026142 Ga0207698_10003512 Ga0207698_1000351210 362
346 3300028379 Ga0268266_10332080 Ga0268266_103320802 362
347 3300028381 Ga0268264_10008390 Ga0268264_100083907 362
348 3300028794 Ga0307515_10000024 Ga0307515_10000024135 362
349 3300031507 Ga0307509_10171864 Ga0307509_101718642 362
350 3300036401 Ga0373937_0006671 Ga0373937_0006671_1789_2877 362
351 3300044656 Ga0466969_0000004 Ga0466969_0000004_80577_81671 362
352 3300044684 Ga0466966_0000295 Ga0466966_0000295_2319_3413 362
353 3300044842 Ga0466957_0000367 Ga0466957_0000367_13292_14386 362
354 3300045049 Ga0466959_0000004 Ga0466959_0000004_186273_187367 362
355 3300046463 Ga0495653_0060576 Ga0495653_0060576_364_1452 362
356 3300046511 Ga0495608_0067439 Ga0495608_0067439_238_1326 362
357 3300046516 Ga0495628_0022064 Ga0495628_0022064_2868_3956 362
358 3300046517 Ga0495630_0011846 Ga0495630_0011846_1443_2531 362
359 3300046529 Ga0495652_0129351 Ga0495652_0129351_464_1552 362
360 3300046535 Ga0495586_0009224 Ga0495586_0009224_2408_3496 362
361 3300046536 Ga0495587_0025753 Ga0495587_0025753_418_1506 362
362 3300046559 Ga0495667_0034520 Ga0495667_0034520_1919_3007 362
363 3300046660 Ga0495625_0043549 Ga0495625_0043549_2070_3170 362
364 3300047322 Ga0495680_0037499 Ga0495680_0037499_1782_2870 362
365 3300048918 Ga0496115_0241398 Ga0496115_0241398_178_1266 362
366 3300049571 Ga0501034_0022151 Ga0501034_0022151_2211_3299 362
367 3300049572 Ga0501036_0094061 Ga0501036_0094061_1331_2452 362
368 3300050507 nmdc:mga05p37_2793_c1 nmdc:mga05p37_2793_c1_18610_19704 362
369 3300053153 Ga0500616_0006698 Ga0500616_0006698_3421_4512 362
370 3300003320 rootH2_10000535 rootH2_1000053521 363
371 3300003322 rootL2_10221672 rootL2_102216723 363
372 3300003323 rootH1_10116572 rootH1_101165723 363
373 3300003323 rootH1_10121234 rootH1_101212342 363
374 3300005327 Ga0070658_10001648 Ga0070658_100016485 363
375 3300005329 Ga0070683_100025633 Ga0070683_1000256335 363
376 3300005334 Ga0068869_100048448 Ga0068869_1000484482 363
377 3300005335 Ga0070666_10000358 Ga0070666_100003582 363
378 3300005335 Ga0070666_10121372 Ga0070666_101213721 363
379 3300005338 Ga0068868_100000187 Ga0068868_10000018730 363
380 3300005347 Ga0070668_100003714 Ga0070668_1000037143 363
381 3300005364 Ga0070673_100000124 Ga0070673_10000012411 363
382 3300005367 Ga0070667_100000980 Ga0070667_10000098011 363
383 3300005457 Ga0070662_100010835 Ga0070662_1000108353 363
384 3300005459 Ga0068867_100002368 Ga0068867_1000023687 363
385 3300005459 Ga0068867_100172446 Ga0068867_1001724462 363
386 3300005471 Ga0070698_100055718 Ga0070698_1000557184 363
387 3300005539 Ga0068853_100002569 Ga0068853_1000025695 363
388 3300005539 Ga0068853_100179198 Ga0068853_1001791982 363
389 3300005543 Ga0070672_100000105 Ga0070672_10000010526 363
390 3300005544 Ga0070686_100001965 Ga0070686_1000019657 363
391 3300005548 Ga0070665_100000635 Ga0070665_10000063526 363
392 3300005563 Ga0068855_100003306 Ga0068855_10000330616 363
393 3300005563 Ga0068855_100005625 Ga0068855_1000056254 363
394 3300005563 Ga0068855_100063337 Ga0068855_1000633372 363
395 3300005563 Ga0068855_100097871 Ga0068855_1000978713 363
396 3300005563 Ga0068855_100224203 Ga0068855_1002242032 363
397 3300005577 Ga0068857_100000287 Ga0068857_10000028720 363
398 3300005614 Ga0068856_100020480 Ga0068856_1000204803 363
399 3300005618 Ga0068864_100001254 Ga0068864_1000012544 363
400 3300005719 Ga0068861_100007098 Ga0068861_1000070988 363
401 3300005842 Ga0068858_100010584 Ga0068858_10001058411 363
402 3300005842 Ga0068858_100211529 Ga0068858_1002115292 363
403 3300005843 Ga0068860_100001418 Ga0068860_10000141815 363
404 3300005843 Ga0068860_100018642 Ga0068860_1000186422 363
405 3300005843 Ga0068860_100019177 Ga0068860_1000191777 363
406 3300005844 Ga0068862_100092530 Ga0068862_1000925303 363
407 3300006237 Ga0097621_100011606 Ga0097621_1000116067 363
408 3300006237 Ga0097621_100034375 Ga0097621_1000343754 363
409 3300006358 Ga0068871_100010053 Ga0068871_1000100537 363
410 3300006358 Ga0068871_100074980 Ga0068871_1000749803 363
411 3300006881 Ga0068865_100001094 Ga0068865_10000109410 363
412 3300006881 Ga0068865_100016931 Ga0068865_1000169314 363
413 3300009093 Ga0105240_10000472 Ga0105240_100004725 363
414 3300009093 Ga0105240_10033401 Ga0105240_100334014 363
415 3300009093 Ga0105240_10246023 Ga0105240_102460232 363
416 3300009094 Ga0111539_10073279 Ga0111539_100732793 363
417 3300009098 Ga0105245_10169907 Ga0105245_101699072 363
418 3300009101 Ga0105247_10033980 Ga0105247_100339803 363
419 3300009174 Ga0105241_10006485 Ga0105241_100064855 363
420 3300009174 Ga0105241_10006681 Ga0105241_100066813 363
421 3300009176 Ga0105242_10042593 Ga0105242_100425933 363
422 3300009545 Ga0105237_10022501 Ga0105237_100225016 363
423 3300009545 Ga0105237_10030614 Ga0105237_100306144 363
424 3300009551 Ga0105238_10002017 Ga0105238_1000201713 363
425 3300009551 Ga0105238_10142233 Ga0105238_101422332 363
426 3300009553 Ga0105249_10028339 Ga0105249_100283396 363
427 3300009553 Ga0105249_10028806 Ga0105249_100288065 363
428 3300010375 Ga0105239_10000155 Ga0105239_1000015531 363
429 3300010375 Ga0105239_10031409 Ga0105239_100314092 363
430 3300010375 Ga0105239_10094105 Ga0105239_100941053 363
431 3300010375 Ga0105239_10240194 Ga0105239_102401942 363
432 3300013100 Ga0157373_10009844 Ga0157373_100098442 363
433 3300013102 Ga0157371_10000284 Ga0157371_1000028431 363
434 3300013102 Ga0157371_10000725 Ga0157371_1000072517 363
435 3300013102 Ga0157371_10009503 Ga0157371_100095033 363
436 3300013102 Ga0157371_10075116 Ga0157371_100751163 363
437 3300013104 Ga0157370_10002079 Ga0157370_100020792 363
438 3300013104 Ga0157370_10021147 Ga0157370_100211474 363
439 3300013105 Ga0157369_10341159 Ga0157369_103411592 363
440 3300013296 Ga0157374_10000025 Ga0157374_1000002585 363
441 3300013296 Ga0157374_10002980 Ga0157374_100029803 363
442 3300013296 Ga0157374_10073925 Ga0157374_100739253 363
443 3300013296 Ga0157374_10160909 Ga0157374_101609092 363
444 3300013297 Ga0157378_10013251 Ga0157378_100132513 363
445 3300013297 Ga0157378_10079114 Ga0157378_100791142 363
446 3300013306 Ga0163162_10000312 Ga0163162_1000031226 363
447 3300013306 Ga0163162_10002647 Ga0163162_100026474 363
448 3300013306 Ga0163162_10074114 Ga0163162_100741143 363
449 3300013307 Ga0157372_10018758 Ga0157372_100187584 363
450 3300013307 Ga0157372_10092124 Ga0157372_100921243 363
451 3300013307 Ga0157372_10114317 Ga0157372_101143173 363
452 3300013307 Ga0157372_10487144 Ga0157372_104871442 363
453 3300013308 Ga0157375_10002871 Ga0157375_1000287113 363
454 3300013308 Ga0157375_10149918 Ga0157375_101499183 363
455 3300013308 Ga0157375_10233750 Ga0157375_102337502 363
456 3300014325 Ga0163163_10000346 Ga0163163_1000034626 363
457 3300014968 Ga0157379_10000242 Ga0157379_1000024212 363
458 3300014968 Ga0157379_10052461 Ga0157379_100524612 363
459 3300014969 Ga0157376_10002821 Ga0157376_1000282112 363
460 3300020078 Ga0206352_10293594 Ga0206352_102935941 363
461 3300025903 Ga0207680_10003927 Ga0207680_100039272 363
462 3300025904 Ga0207647_10027231 Ga0207647_100272312 363
463 3300025907 Ga0207645_10001794 Ga0207645_100017943 363
464 3300025909 Ga0207705_10007257 Ga0207705_100072576 363
465 3300025909 Ga0207705_10017600 Ga0207705_100176006 363
466 3300025909 Ga0207705_10043803 Ga0207705_100438031 363
467 3300025911 Ga0207654_10029613 Ga0207654_100296133 363
468 3300025913 Ga0207695_10000282 Ga0207695_1000028250 363
469 3300025913 Ga0207695_10001688 Ga0207695_1000168828 363
470 3300025913 Ga0207695_10004070 Ga0207695_1000407013 363
471 3300025913 Ga0207695_10059033 Ga0207695_100590333 363
472 3300025913 Ga0207695_10064026 Ga0207695_100640264 363
473 3300025914 Ga0207671_10011870 Ga0207671_100118703 363
474 3300025914 Ga0207671_10072568 Ga0207671_100725682 363
475 3300025919 Ga0207657_10023896 Ga0207657_100238963 363
476 3300025921 Ga0207652_10000045 Ga0207652_1000004550 363
477 3300025924 Ga0207694_10057411 Ga0207694_100574113 363
478 3300025925 Ga0207650_10015410 Ga0207650_100154102 363
479 3300025927 Ga0207687_10116816 Ga0207687_101168162 363
480 3300025938 Ga0207704_10009869 Ga0207704_100098693 363
481 3300025940 Ga0207691_10000012 Ga0207691_1000001262 363
482 3300025942 Ga0207689_10030002 Ga0207689_100300022 363
483 3300025949 Ga0207667_10012455 Ga0207667_100124556 363
484 3300025949 Ga0207667_10026076 Ga0207667_100260765 363
485 3300025949 Ga0207667_10034450 Ga0207667_100344504 363
486 3300025949 Ga0207667_10045123 Ga0207667_100451234 363
487 3300025960 Ga0207651_10000216 Ga0207651_100002163 363
488 3300025961 Ga0207712_10010440 Ga0207712_100104404 363
489 3300025972 Ga0207668_10001361 Ga0207668_100013615 363
490 3300025981 Ga0207640_10014955 Ga0207640_100149554 363
491 3300025986 Ga0207658_10000374 Ga0207658_1000037431 363
492 3300026023 Ga0207677_10000984 Ga0207677_100009843 363
493 3300026035 Ga0207703_10019138 Ga0207703_100191382 363
494 3300026041 Ga0207639_10002390 Ga0207639_100023909 363
495 3300026067 Ga0207678_10013503 Ga0207678_100135033 363
496 3300026078 Ga0207702_10026475 Ga0207702_100264753 363
497 3300026089 Ga0207648_10010253 Ga0207648_100102534 363
498 3300026089 Ga0207648_10083158 Ga0207648_100831583 363
499 3300026095 Ga0207676_10000697 Ga0207676_100006974 363
500 3300026118 Ga0207675_100005430 Ga0207675_1000054303 363
501 3300026142 Ga0207698_10009340 Ga0207698_100093403 363
502 3300026142 Ga0207698_10014863 Ga0207698_100148634 363
503 3300028379 Ga0268266_10005379 Ga0268266_1000537911 363
504 3300028380 Ga0268265_10009351 Ga0268265_100093512 363
505 3300028380 Ga0268265_10316991 Ga0268265_103169911 363
506 3300028381 Ga0268264_10000019 Ga0268264_10000019208 363
507 3300028381 Ga0268264_10003975 Ga0268264_100039754 363
508 3300028381 Ga0268264_10008474 Ga0268264_100084748 363
509 3300028381 Ga0268264_10008570 Ga0268264_100085705 363
510 3300030521 Ga0307511_10000228 Ga0307511_1000022811 363
511 3300031456 Ga0307513_10168728 Ga0307513_101687283 363
512 3300031456 Ga0307513_10202106 Ga0307513_102021062 363
513 3300031507 Ga0307509_10015498 Ga0307509_100154987 363
514 3300031616 Ga0307508_10001024 Ga0307508_1000102424 363
515 3300031616 Ga0307508_10218480 Ga0307508_102184802 363
516 3300035172 Ga0373955_0056898 Ga0373955_0056898_472_1575 363
517 3300036401 Ga0373937_0339533 Ga0373937_0339533_241_1335 363
518 3300037312 Ga0395899_0007489 Ga0395899_0007489_3264_4361 363
519 3300037312 Ga0395899_0063013 Ga0395899_0063013_95_1192 363
520 3300037418 Ga0395900_0004195 Ga0395900_0004195_8948_10045 363
521 3300037418 Ga0395900_0008499 Ga0395900_0008499_3156_4253 363
522 3300037466 Ga0395898_0003718 Ga0395898_0003718_12102_13199 363
523 3300037466 Ga0395898_0081915 Ga0395898_0081915_56_1153 363
524 3300038443 Ga0395901_0005062 Ga0395901_0005062_8693_9790 363
525 3300038443 Ga0395901_0090262 Ga0395901_0090262_1440_2537 363
526 3300041458 Ga0451798_0707333 Ga0451798_0707333_176_1276 363
527 3300041498 Ga0451841_0745731 Ga0451841_0745731_300_1400 363
528 3300042014 Ga0439457_000930 Ga0439457_000930_4206_5306 363
529 3300042015 Ga0439462_0006134 Ga0439462_0006134_756_1856 363
530 3300044658 Ga0466972_0000017 Ga0466972_0000017_72899_73999 363
531 3300044712 Ga0453684_0266906 Ga0453684_0266906_439_1536 363
532 3300046472 Ga0495580_0075482 Ga0495580_0075482_406_1509 363
533 3300046473 Ga0495582_0032503 Ga0495582_0032503_103_1206 363
534 3300046535 Ga0495586_0158828 Ga0495586_0158828_52_1155 363
535 3300046558 Ga0495633_0024540 Ga0495633_0024540_1305_2399 363
536 3300046616 Ga0495668_0001697 Ga0495668_0001697_4664_5767 363
537 3300046683 Ga0495658_0016941 Ga0495658_0016941_46_1149 363
538 3300046694 Ga0495649_0026980 Ga0495649_0026980_1364_2455 363
539 3300046809 Ga0495600_0075759 Ga0495600_0075759_764_1867 363
540 3300047319 Ga0495674_0034710 Ga0495674_0034710_747_1850 363
541 3300047471 Ga0495684_0053521 Ga0495684_0053521_1442_2545 363
542 3300047472 Ga0495686_0000005 Ga0495686_0000005_5817_6908 363
543 3300048907 Ga0496104_0313801 Ga0496104_0313801_88_1191 363
544 3300048912 Ga0496109_0192296 Ga0496109_0192296_713_1807 363
545 3300053085 Ga0495619_0042013 Ga0495619_0042013_1600_2703 363
546 3300053092 Ga0500583_0000068 Ga0500583_0000068_1965_3065 363
547 3300053092 Ga0500583_0001499 Ga0500583_0001499_1498_2598 363
548 3300053139 Ga0500568_0007023 Ga0500568_0007023_4419_5510 363
549 3300053150 Ga0500603_027821 Ga0500603_027821_136_1236 363
550 3300053153 Ga0500616_0026690 Ga0500616_0026690_2055_3146 363
551 3300053156 Ga0500622_0046200 Ga0500622_0046200_199_1299 363
552 3300053177 Ga0500636_0053601 Ga0500636_0053601_375_1475 363
553 3300053178 Ga0500637_0076844 Ga0500637_0076844_363_1457 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

254

338

0.91

PF08392

FAE1_CUT1_RppA

FAE1/Type III polyketide synthase-like protein

60

200

0.9

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

131

204

0.9

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

5

197

0.87

PF02797

Chal_sti_synt_C

Chalcone and stilbene synthases, C-terminal domain

206

340

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h84-assembly1.cif.gz_B crystal structure of the c-terminal type iii polyketide synthase (pks iii) domain of 'steely1' (a type i/iii pks hybrid from dictyostelium) 0.9166 2 361
4jap-assembly2.cif.gz_A crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9064 1 363
4jd3-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9059 3 361
4b0n-assembly1.cif.gz_B crystal structure of pks-i from the brown algae ectocarpus siliculosus 0.9055 2 363
4jap-assembly2.cif.gz_A crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.904 1 363
ID Description Score Start End Superfamily
1tedA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9403 220 361 3.40.47.10
af_Q10QW1_350_518_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9308 280 359 3.40.47.10
1u0mB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9291 219 361 3.40.47.10
4jaoA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9261 220 363 3.40.47.10
af_A0A0R0EFL7_291_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9253 280 361 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7V8W2N5-F1-model_v4 Type III polyketide synthase 0.9777 1 363 GO:0016747
GO:0030639
AF-A0A7V8W2N5-F1-model_v4 Type III polyketide synthase 0.975 1 363 GO:0016747
GO:0030639
AF-A0A4V2AV97-F1-model_v4 Type III polyketide synthase 0.9678 1 223 GO:0016747
GO:0030639
AF-A0A3C1BIB7-F1-model_v4 Naringenin-chalcone synthase 0.9677 1 363 GO:0016747
GO:0030639
AF-A0A3E1NPK3-F1-model_v4 Type III polyketide synthase 0.9664 1 363 GO:0016747
GO:0030639

Feature Viewer

pLDDT pTM Quality
89.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map