F462913

General Info

Members Datasets Scaffolds Average Seq Length
553 234 553 455

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0044365|Ga0496112_0044365_1129_2595
Length 488
Sequence VACLRRANRLDRALTKHVALIGFMGAGKTTLGEETARRLNWLLKDVDQVVEASQSRSIPELFAEGESVFRDVELRVVRGLLAHPRPSVIALGGGAVTTPEVRGLLHDHAVTVWIDEDVDTCWERVRGTDRPLAQDEAEFRRLFDERHPLYAAAADAVVRDADDIVLAAAGVRVGRGALRRLGELVPGDGQVALVSDPNVAGIYGMDAQLALGGRLAQVHELPLGEDAKTISALDRLWQDLRLDRSGTVVALGGGCTTDAAGFAAATYLRGIPWVPVPTSLVAQVDAAIGGKTGIDLPQGKNLVGSFHWPVRTIIDPALLETLPPAQRLEGMAEVVKTGLLAGEPLWELPDDELVRRCASFKAALCLRDPEDNAERKMLNLGHTFAHALEAAAGYEGLSHGRAVALGLLAALRLSGGRLSGRDIGQVEEILRPKPVKVDRERAWQAMQRDKKNVGGELRLVLIGEDGPEWDVAVPAEDVRRELDALIAG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 14.1
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10147574 3300005327 Bacteria 1968
2 Ga0070683_100002787 3300005329 Bacteria 13976
3 Ga0070683_100092238 3300005329 Bacteria 2845
4 Ga0070690_100103245 3300005330 Bacteria 1893
5 Ga0070680_100026368 3300005336 Bacteria 4648
6 Ga0070680_100097872 3300005336 Bacteria 2433
7 Ga0070680_100243614 3300005336 Bacteria 1520
8 Ga0070682_100019819 3300005337 Bacteria 3950
9 Ga0070682_100042246 3300005337 Bacteria 2813
10 Ga0068868_100038305 3300005338 Bacteria 3721
11 Ga0070660_100008515 3300005339 Bacteria 7179
12 Ga0070660_100022105 3300005339 Bacteria 4699
13 Ga0070691_10027327 3300005341 Bacteria 2662
14 Ga0070714_100021353 3300005435 Bacteria 5298
15 Ga0070714_100130249 3300005435 Bacteria 2248
16 Ga0070714_100163274 3300005435 Bacteria 2017
17 Ga0070713_100045051 3300005436 Bacteria 3613
18 Ga0070713_100055254 3300005436 Bacteria 3298
19 Ga0070713_100190735 3300005436 Bacteria 1846
20 Ga0070710_10001590 3300005437 Bacteria 10722
21 Ga0070710_10020109 3300005437 Bacteria 3459
22 Ga0070711_100005385 3300005439 Bacteria 7655
23 Ga0070711_100009007 3300005439 Bacteria 6127
24 Ga0070711_100163962 3300005439 Bacteria 1687
25 Ga0070705_100055551 3300005440 Bacteria 2328
26 Ga0070700_100013906 3300005441 Bacteria 4531
27 Ga0070708_100020147 3300005445 Bacteria 5618
28 Ga0070708_100025940 3300005445 Bacteria 5012
29 Ga0070663_100018013 3300005455 Bacteria 4621
30 Ga0070678_100027748 3300005456 Bacteria 3849
31 Ga0070681_10046805 3300005458 Bacteria 4324
32 Ga0070706_100002089 3300005467 Bacteria 20346
33 Ga0070706_100054927 3300005467 Bacteria 3676
34 Ga0070706_100169990 3300005467 Bacteria 2035
35 Ga0070707_100000736 3300005468 Bacteria 32520
36 Ga0070707_100001273 3300005468 Bacteria 24807
37 Ga0070707_100018978 3300005468 Bacteria 6477
38 Ga0070707_100225462 3300005468 Bacteria 1825
39 Ga0070707_100296720 3300005468 Bacteria 1570
40 Ga0070698_100010276 3300005471 Bacteria 9999
41 Ga0070698_100016163 3300005471 Bacteria 7880
42 Ga0070698_100024678 3300005471 Bacteria 6271
43 Ga0070698_100088976 3300005471 Bacteria 3072
44 Ga0070698_100162872 3300005471 Bacteria 2174
45 Ga0070699_100028631 3300005518 Bacteria 4804
46 Ga0070699_100085700 3300005518 Bacteria 2749
47 Ga0070679_100086916 3300005530 Bacteria 3113
48 Ga0070679_100098170 3300005530 Bacteria 2917
49 Ga0070679_100161104 3300005530 Bacteria 2218
50 Ga0070679_100293685 3300005530 Bacteria 1576
51 Ga0070684_100021195 3300005535 Bacteria 5402
52 Ga0070684_100047821 3300005535 Bacteria 3709
53 Ga0070684_100151272 3300005535 Bacteria 2103
54 Ga0070684_100179417 3300005535 Bacteria 1925
55 Ga0070686_100041358 3300005544 Bacteria 2881
56 Ga0070686_100048181 3300005544 Bacteria 2699
57 Ga0070695_100000023 3300005545 Bacteria 60293
58 Ga0070696_100097446 3300005546 Bacteria 2103
59 Ga0068855_100039573 3300005563 Bacteria 5598
60 Ga0068855_100076760 3300005563 Bacteria 3876
61 Ga0068856_100004494 3300005614 Bacteria 13869
62 Ga0070702_100018393 3300005615 Bacteria 3626
63 Ga0068864_100058340 3300005618 Bacteria 3335
64 Ga0068861_100049503 3300005719 Bacteria 3182
65 Ga0081455_10027516 3300005937 Bacteria 5211
66 Ga0081538_10014854 3300005981 Bacteria 6068
67 Ga0081540_1001884 3300005983 Bacteria 17556
68 Ga0081539_10002903 3300005985 Bacteria 22670
69 Ga0070717_10003907 3300006028 Bacteria 10721
70 Ga0070717_10018851 3300006028 Bacteria 5397
71 Ga0070717_10022558 3300006028 Bacteria 4975
72 Ga0070717_10030392 3300006028 Bacteria 4340
73 Ga0070717_10040702 3300006028 Bacteria 3786
74 Ga0075432_10010379 3300006058 Bacteria 3159
75 Ga0070715_10007105 3300006163 Bacteria 3840
76 Ga0070712_100052940 3300006175 Bacteria 2833
77 Ga0075428_100200927 3300006844 Bacteria 2155
78 Ga0075433_10007908 3300006852 Bacteria 8457
79 Ga0075433_10020701 3300006852 Bacteria 5506
80 Ga0075433_10074172 3300006852 Bacteria 2994
81 Ga0075434_100013194 3300006871 Bacteria 7851
82 Ga0075434_100035968 3300006871 Bacteria 4897
83 Ga0075429_100052446 3300006880 Bacteria 3549
84 Ga0075436_100002736 3300006914 Bacteria 12126
85 Ga0075436_100041892 3300006914 Bacteria 3158
86 Ga0075436_100044442 3300006914 Bacteria 3063
87 Ga0075435_100000579 3300007076 Bacteria 22387
88 Ga0075435_100001676 3300007076 Bacteria 14382
89 Ga0075435_100036783 3300007076 Bacteria 3893
90 Ga0111539_10001928 3300009094 Bacteria 27646
91 Ga0111539_10219406 3300009094 Bacteria 2215
92 Ga0111539_10356086 3300009094 Bacteria 1703
93 Ga0105245_10005774 3300009098 Bacteria 10857
94 Ga0105245_10014739 3300009098 Bacteria 6808
95 Ga0105245_10085538 3300009098 Bacteria 2890
96 Ga0105245_10110840 3300009098 Bacteria 2552
97 Ga0105245_10159705 3300009098 Bacteria 2138
98 Ga0114129_10002630 3300009147 Bacteria 24990
99 Ga0114129_10044266 3300009147 Bacteria 6262
100 Ga0114129_10171551 3300009147 Bacteria 2957
101 Ga0114129_10179373 3300009147 Bacteria 2883
102 Ga0105242_10038235 3300009176 Bacteria 3859
103 Ga0105242_10087126 3300009176 Bacteria 2622
104 Ga0105237_10101443 3300009545 Bacteria 2870
105 Ga0157370_10005484 3300013104 Bacteria 14227
106 Ga0157370_10010689 3300013104 Bacteria 9656
107 Ga0157369_10008456 3300013105 Bacteria 11805
108 Ga0157369_10038348 3300013105 Bacteria 5240
109 Ga0157375_10003176 3300013308 Bacteria 14277
110 Ga0182008_10002973 3300014497 Bacteria 10433
111 Ga0157379_10071265 3300014968 Bacteria 3109
112 Ga0157376_10017745 3300014969 Bacteria 5438
113 Ga0182006_1043204 3300015261 Bacteria 1762
114 Ga0206354_10286303 3300020081 Bacteria 3867
115 Ga0206353_11257401 3300020082 Bacteria 17170
116 Ga0207653_10007342 3300025885 Bacteria 3435
117 Ga0207692_10018241 3300025898 Bacteria 3146
118 Ga0207699_10059306 3300025906 Bacteria 2293
119 Ga0207684_10004837 3300025910 Bacteria 12604
120 Ga0207684_10102878 3300025910 Bacteria 2442
121 Ga0207707_10100991 3300025912 Bacteria 2521
122 Ga0207707_10195325 3300025912 Bacteria 1765
123 Ga0207671_10068278 3300025914 Bacteria 2648
124 Ga0207693_10000198 3300025915 Bacteria 54576
125 Ga0207693_10007712 3300025915 Bacteria 8836
126 Ga0207693_10008363 3300025915 Bacteria 8468
127 Ga0207693_10009671 3300025915 Bacteria 7850
128 Ga0207693_10059093 3300025915 Bacteria 3003
129 Ga0207660_10041793 3300025917 Bacteria 3214
130 Ga0207657_10016396 3300025919 Bacteria 7147
131 Ga0207657_10024716 3300025919 Bacteria 5555
132 Ga0207652_10223975 3300025921 Bacteria 1695
133 Ga0207646_10002219 3300025922 Bacteria 23119
134 Ga0207646_10004655 3300025922 Bacteria 14797
135 Ga0207681_10126008 3300025923 Bacteria 1886
136 Ga0207687_10139227 3300025927 Bacteria 1839
137 Ga0207700_10038025 3300025928 Bacteria 3490
138 Ga0207700_10162115 3300025928 Bacteria 1858
139 Ga0207664_10005271 3300025929 Bacteria 8832
140 Ga0207664_10032010 3300025929 Bacteria 4028
141 Ga0207664_10037991 3300025929 Bacteria 3730
142 Ga0207706_10011285 3300025933 Bacteria 8142
143 Ga0207706_10178576 3300025933 Bacteria 1865
144 Ga0207665_10000197 3300025939 Bacteria 40246
145 Ga0207665_10005170 3300025939 Bacteria 8713
146 Ga0207691_10181656 3300025940 Bacteria 1838
147 Ga0207711_10135444 3300025941 Unclassified 2212
148 Ga0207661_10016534 3300025944 Bacteria 5445
149 Ga0207661_10017872 3300025944 Bacteria 5258
150 Ga0207661_10125382 3300025944 Bacteria 2192
151 Ga0207668_10029028 3300025972 Bacteria 3623
152 Ga0207678_10027462 3300026067 Bacteria 4965
153 Ga0207678_10220475 3300026067 Bacteria 1623
154 Ga0207708_10009298 3300026075 Bacteria 7276
155 Ga0207702_10006207 3300026078 Bacteria 10334
156 Ga0207648_10002132 3300026089 Bacteria 21520
157 Ga0207675_100004186 3300026118 Bacteria 13960
158 Ga0207675_100181309 3300026118 Bacteria 2016
159 Ga0207683_10029845 3300026121 Bacteria 4722
160 Ga0207683_10098762 3300026121 Bacteria 2605
161 Ga0207698_10150922 3300026142 Bacteria 2017
162 Ga0207428_10013176 3300027907 Bacteria 7239
163 Ga0265319_1001059 3300028563 Bacteria 17170
164 Ga0265334_10007596 3300028573 Bacteria 4645
165 Ga0265318_10001637 3300028577 Bacteria 12919
166 Ga0265318_10003407 3300028577 Bacteria 7986
167 Ga0265338_10004619 3300028800 Bacteria 18512
168 Ga0265338_10005076 3300028800 Bacteria 17375
169 Ga0265338_10125573 3300028800 Bacteria 2036
170 Ga0265330_10016974 3300031235 Bacteria 3356
171 Ga0265330_10047333 3300031235 Bacteria 1893
172 Ga0265328_10010907 3300031239 Bacteria 3647
173 Ga0265320_10017712 3300031240 Bacteria 3947
174 Ga0265320_10040777 3300031240 Bacteria 2312
175 Ga0265325_10018259 3300031241 Bacteria 3889
176 Ga0265325_10028698 3300031241 Bacteria 2996
177 Ga0265340_10059216 3300031247 Bacteria 1838
178 Ga0265339_10004983 3300031249 Bacteria 8940
179 Ga0265331_10023049 3300031250 Bacteria 3168
180 Ga0265327_10023772 3300031251 Bacteria 3618
181 Ga0265327_10025765 3300031251 Bacteria 3421
182 Ga0265316_10025321 3300031344 Bacteria 4953
183 Ga0265316_10053801 3300031344 Bacteria 3153
184 Ga0265313_10016189 3300031595 Bacteria 4298
185 Ga0265314_10005893 3300031711 Bacteria 10961
186 Ga0265342_10025222 3300031712 Bacteria 3741
187 Ga0265342_10038371 3300031712 Bacteria 2917
188 Ga0373926_0018619 3300035083 Bacteria 2390
189 Ga0373936_0043462 3300035113 Bacteria 1806
190 Ga0373941_0015705 3300035115 Bacteria 2047
191 Ga0373960_0016274 3300035121 Bacteria 1911
192 Ga0373943_0003173 3300035170 Bacteria 7463
193 Ga0373943_0013462 3300035170 Bacteria 3695
194 Ga0373943_0031502 3300035170 Bacteria 2516
195 Ga0373927_0028600 3300035695 Bacteria 3636
196 Ga0373947_0001279 3300035725 Bacteria 15509
197 Ga0373947_0010190 3300035725 Bacteria 5396
198 Ga0373947_0038701 3300035725 Bacteria 2835
199 Ga0373937_0060417 3300036401 Bacteria 3483
200 Ga0373925_0001456 3300037068 Bacteria 20442
201 Ga0395899_0004144 3300037312 Bacteria 11391
202 Ga0395899_0007114 3300037312 Bacteria 8657
203 Ga0395899_0028568 3300037312 Bacteria 4198
204 Ga0395899_0030874 3300037312 Bacteria 4028
205 Ga0395899_0044205 3300037312 Bacteria 3320
206 Ga0395899_0079820 3300037312 Bacteria 2383
207 Ga0395899_0149461 3300037312 Bacteria 1656
208 Ga0395900_0005056 3300037418 Bacteria 13836
209 Ga0395900_0008595 3300037418 Bacteria 10492
210 Ga0395900_0016527 3300037418 Bacteria 7527
211 Ga0395900_0024289 3300037418 Bacteria 6206
212 Ga0395900_0030925 3300037418 Bacteria 5498
213 Ga0395900_0043110 3300037418 Bacteria 4649
214 Ga0395900_0050166 3300037418 Bacteria 4299
215 Ga0395900_0054382 3300037418 Bacteria 4122
216 Ga0395900_0073531 3300037418 Bacteria 3515
217 Ga0395900_0126617 3300037418 Bacteria 2620
218 Ga0395900_0266910 3300037418 Bacteria 1707
219 Ga0395898_0006932 3300037466 Bacteria 12043
220 Ga0395898_0008878 3300037466 Bacteria 10587
221 Ga0395898_0010279 3300037466 Bacteria 9794
222 Ga0395898_0015998 3300037466 Bacteria 7684
223 Ga0395898_0019348 3300037466 Bacteria 6931
224 Ga0395898_0031845 3300037466 Bacteria 5267
225 Ga0395898_0041537 3300037466 Bacteria 4542
226 Ga0395898_0047572 3300037466 Bacteria 4209
227 Ga0395898_0177134 3300037466 Bacteria 2038
228 Ga0395898_0303662 3300037466 Bacteria 1522
229 Ga0395898_0351975 3300037466 Bacteria 1404
230 Ga0395905_0002930 3300037471 Bacteria 18574
231 Ga0395905_0006934 3300037471 Bacteria 11329
232 Ga0395905_0007022 3300037471 Bacteria 11255
233 Ga0395905_0011779 3300037471 Bacteria 8443
234 Ga0395905_0012413 3300037471 Bacteria 8200
235 Ga0395905_0022282 3300037471 Bacteria 5993
236 Ga0395905_0035578 3300037471 Bacteria 4677
237 Ga0395905_0069044 3300037471 Bacteria 3310
238 Ga0395901_0004146 3300038443 Bacteria 14623
239 Ga0395901_0009150 3300038443 Bacteria 10032
240 Ga0395901_0020678 3300038443 Bacteria 6737
241 Ga0395901_0026455 3300038443 Bacteria 5956
242 Ga0395901_0033046 3300038443 Bacteria 5338
243 Ga0395901_0034280 3300038443 Bacteria 5242
244 Ga0395901_0067732 3300038443 Bacteria 3718
245 Ga0395901_0075445 3300038443 Bacteria 3517
246 Ga0395901_0150034 3300038443 Bacteria 2450
247 Ga0395901_0175745 3300038443 Bacteria 2246
248 Ga0436360_1320551 3300039438 Bacteria 1929
249 Ga0439433_0003796 3300041999 Bacteria 3248
250 Ga0439441_003139 3300042001 Bacteria 2403
251 Ga0439446_0004144 3300042156 Bacteria 3655
252 Ga0466969_0001820 3300044656 Bacteria 11388
253 Ga0466961_0021458 3300044693 Bacteria 4156
254 Ga0466961_0059646 3300044693 Bacteria 2426
255 Ga0466961_0117836 3300044693 Bacteria 1668
256 Ga0466963_0000518 3300044694 Bacteria 18034
257 Ga0466963_0003462 3300044694 Bacteria 9043
258 Ga0466963_0009739 3300044694 Bacteria 5797
259 Ga0466963_0011497 3300044694 Bacteria 5391
260 Ga0466963_0012038 3300044694 Bacteria 5284
261 Ga0466963_0015702 3300044694 Bacteria 4696
262 Ga0466963_0016045 3300044694 Bacteria 4651
263 Ga0466963_0018541 3300044694 Bacteria 4353
264 Ga0466963_0052155 3300044694 Bacteria 2713
265 Ga0466963_0053911 3300044694 Bacteria 2671
266 Ga0466963_0059039 3300044694 Bacteria 2559
267 Ga0466963_0065364 3300044694 Bacteria 2438
268 Ga0466963_0163594 3300044694 Bacteria 1549
269 Ga0466964_0001008 3300044706 Bacteria 9347
270 Ga0466964_0003578 3300044706 Bacteria 5676
271 Ga0466964_0012047 3300044706 Bacteria 3271
272 Ga0466964_0044427 3300044706 Bacteria 1805
273 Ga0466971_0011727 3300044719 Bacteria 3839
274 Ga0466971_0047373 3300044719 Bacteria 1932
275 Ga0466968_0000984 3300044735 Bacteria 10030
276 Ga0466968_0003485 3300044735 Bacteria 5819
277 Ga0466968_0008612 3300044735 Bacteria 3910
278 Ga0466968_0036833 3300044735 Bacteria 2050
279 Ga0466968_0066912 3300044735 Bacteria 1557
280 Ga0466957_0005617 3300044842 Bacteria 7050
281 Ga0466957_0018705 3300044842 Bacteria 4070
282 Ga0466957_0023144 3300044842 Bacteria 3670
283 Ga0466957_0031556 3300044842 Bacteria 3167
284 Ga0466957_0102279 3300044842 Bacteria 1807
285 Ga0466959_0013448 3300045049 Bacteria 5931
286 Ga0466959_0031281 3300045049 Bacteria 3938
287 Ga0451576_0163520 3300045051 Bacteria 2323
288 Ga0466958_0001119 3300045836 Bacteria 12370
289 Ga0466958_0010910 3300045836 Bacteria 5103
290 Ga0466958_0011491 3300045836 Bacteria 4986
291 Ga0466958_0013018 3300045836 Bacteria 4726
292 Ga0466958_0023697 3300045836 Bacteria 3606
293 Ga0466958_0035521 3300045836 Bacteria 2978
294 Ga0466958_0075408 3300045836 Bacteria 2069
295 Ga0466967_0000215 3300045976 Bacteria 24572
296 Ga0466967_0002633 3300045976 Bacteria 11303
297 Ga0466967_0004694 3300045976 Bacteria 9282
298 Ga0466967_0008665 3300045976 Bacteria 7481
299 Ga0466967_0010632 3300045976 Bacteria 6915
300 Ga0466967_0011472 3300045976 Bacteria 6715
301 Ga0466967_0012538 3300045976 Bacteria 6490
302 Ga0466967_0021924 3300045976 Bacteria 5199
303 Ga0466967_0044730 3300045976 Bacteria 3842
304 Ga0466967_0052580 3300045976 Bacteria 3576
305 Ga0466967_0056012 3300045976 Bacteria 3475
306 Ga0466967_0114388 3300045976 Bacteria 2484
307 Ga0466967_0117806 3300045976 Bacteria 2449
308 Ga0466967_0129048 3300045976 Bacteria 2345
309 Ga0466967_0148982 3300045976 Bacteria 2185
310 Ga0466967_0168275 3300045976 Bacteria 2060
311 Ga0495592_0000597 3300046454 Bacteria 25448
312 Ga0495592_0003845 3300046454 Bacteria 10858
313 Ga0495592_0086273 3300046454 Bacteria 2261
314 Ga0495603_0000450 3300046455 Bacteria 22609
315 Ga0495629_0001473 3300046459 Bacteria 18571
316 Ga0495629_0007112 3300046459 Bacteria 8244
317 Ga0495629_0034375 3300046459 Bacteria 3584
318 Ga0495641_0001513 3300046461 Bacteria 19794
319 Ga0495641_0013562 3300046461 Bacteria 4466
320 Ga0495651_0000008 3300046462 Bacteria 156989
321 Ga0495651_0086787 3300046462 Bacteria 2353
322 Ga0495653_0000725 3300046463 Bacteria 25130
323 Ga0495653_0032755 3300046463 Bacteria 4124
324 Ga0495653_0052434 3300046463 Bacteria 3126
325 Ga0495653_0061380 3300046463 Bacteria 2845
326 Ga0495580_0006863 3300046472 Bacteria 9209
327 Ga0495580_0040667 3300046472 Bacteria 3320
328 Ga0495582_0000711 3300046473 Bacteria 18383
329 Ga0495582_0008066 3300046473 Bacteria 5812
330 Ga0495582_0052075 3300046473 Bacteria 2258
331 Ga0495639_0000520 3300046475 Bacteria 18060
332 Ga0495639_0024573 3300046475 Bacteria 2653
333 Ga0495664_0016797 3300046477 Bacteria 4176
334 Ga0495664_0053361 3300046477 Bacteria 2404
335 Ga0495664_0074459 3300046477 Bacteria 2031
336 Ga0495594_0001436 3300046499 Bacteria 12355
337 Ga0495594_0056014 3300046499 Bacteria 2175
338 Ga0495607_0023628 3300046501 Bacteria 3845
339 Ga0495608_0000957 3300046511 Bacteria 20357
340 Ga0495608_0074310 3300046511 Bacteria 2215
341 Ga0495608_0127465 3300046511 Bacteria 1630
342 Ga0495618_0002854 3300046514 Bacteria 10943
343 Ga0495618_0019968 3300046514 Bacteria 4123
344 Ga0495628_0000105 3300046516 Bacteria 68159
345 Ga0495628_0177868 3300046516 Bacteria 1611
346 Ga0495630_0001692 3300046517 Bacteria 15385
347 Ga0495630_0010267 3300046517 Bacteria 6756
348 Ga0495630_0068616 3300046517 Bacteria 2667
349 Ga0495666_0000272 3300046526 Bacteria 22361
350 Ga0495666_0011671 3300046526 Bacteria 4380
351 Ga0495652_0001221 3300046529 Bacteria 28813
352 Ga0495652_0008764 3300046529 Bacteria 9205
353 Ga0495652_0032894 3300046529 Bacteria 4532
354 Ga0495652_0185802 3300046529 Bacteria 1590
355 Ga0495665_0001436 3300046531 Bacteria 12777
356 Ga0495665_0039270 3300046531 Bacteria 2522
357 Ga0495640_0026292 3300046533 Bacteria 4207
358 Ga0495640_0158659 3300046533 Bacteria 1451
359 Ga0495586_0031982 3300046535 Bacteria 2820
360 Ga0495587_0000048 3300046536 Bacteria 105358
361 Ga0495645_0000029 3300046543 Bacteria 113119
362 Ga0495667_0044697 3300046559 Bacteria 2933
363 Ga0495667_0088446 3300046559 Bacteria 2008
364 Ga0495634_0021950 3300046642 Bacteria 4503
365 Ga0495634_0025274 3300046642 Bacteria 4158
366 Ga0495634_0045959 3300046642 Bacteria 2948
367 Ga0495635_0028500 3300046663 Bacteria 3882
368 Ga0495635_0057167 3300046663 Bacteria 2684
369 Ga0495635_0076700 3300046663 Bacteria 2290
370 Ga0495588_0000857 3300046674 Bacteria 13453
371 Ga0495657_0007940 3300046675 Bacteria 8137
372 Ga0495657_0047066 3300046675 Bacteria 2918
373 Ga0495599_0000110 3300046678 Bacteria 55240
374 Ga0495623_0000379 3300046679 Bacteria 29118
375 Ga0495623_0137413 3300046679 Unclassified 1457
376 Ga0495646_0002891 3300046680 Bacteria 10637
377 Ga0495646_0038682 3300046680 Bacteria 2944
378 Ga0495646_0061681 3300046680 Bacteria 2232
379 Ga0495647_0000245 3300046681 Bacteria 14888
380 Ga0495658_0000675 3300046683 Bacteria 18488
381 Ga0495658_0064418 3300046683 Bacteria 2112
382 Ga0495613_0006283 3300046689 Bacteria 8885
383 Ga0495613_0057824 3300046689 Bacteria 2847
384 Ga0495613_0079252 3300046689 Bacteria 2388
385 Ga0495624_0018866 3300046690 Bacteria 4609
386 Ga0495624_0044760 3300046690 Bacteria 2820
387 Ga0495624_0060654 3300046690 Bacteria 2371
388 Ga0495581_0019156 3300047315 Bacteria 3972
389 Ga0495604_0000687 3300047317 Bacteria 28670
390 Ga0495674_0026681 3300047319 Bacteria 5284
391 Ga0495676_0000602 3300047321 Bacteria 29783
392 Ga0495676_0019704 3300047321 Bacteria 5930
393 Ga0495680_0011528 3300047322 Bacteria 7819
394 Ga0495680_0053256 3300047322 Bacteria 3150
395 Ga0495675_0000419 3300047444 Bacteria 28791
396 Ga0495684_0013033 3300047471 Bacteria 6417
397 Ga0495684_0068032 3300047471 Bacteria 2708
398 Ga0495684_0135856 3300047471 Bacteria 1845
399 Ga0495593_0000863 3300047673 Bacteria 17564
400 Ga0495602_0001409 3300048088 Bacteria 23791
401 Ga0495602_0052498 3300048088 Bacteria 3620
402 Ga0495614_0000132 3300048089 Bacteria 26286
403 Ga0496100_0064186 3300048903 Bacteria 2429
404 Ga0496101_0111629 3300048904 Bacteria 2058
405 Ga0496102_0005223 3300048905 Bacteria 11027
406 Ga0496102_0031576 3300048905 Bacteria 4752
407 Ga0496102_0107343 3300048905 Bacteria 2599
408 Ga0496102_0120253 3300048905 Bacteria 2453
409 Ga0496102_0194329 3300048905 Bacteria 1912
410 Ga0496102_0203938 3300048905 Bacteria 1864
411 Ga0496103_0040604 3300048906 Bacteria 2859
412 Ga0496103_0044226 3300048906 Bacteria 2743
413 Ga0496104_0000977 3300048907 Bacteria 24462
414 Ga0496104_0001337 3300048907 Bacteria 21325
415 Ga0496104_0006401 3300048907 Bacteria 10356
416 Ga0496104_0027991 3300048907 Bacteria 5220
417 Ga0496104_0037468 3300048907 Bacteria 4535
418 Ga0496104_0074386 3300048907 Bacteria 3234
419 Ga0496104_0116472 3300048907 Bacteria 2564
420 Ga0496105_0002654 3300048908 Bacteria 13026
421 Ga0496105_0006474 3300048908 Bacteria 9001
422 Ga0496105_0027308 3300048908 Bacteria 4661
423 Ga0496105_0030208 3300048908 Bacteria 4440
424 Ga0496105_0055423 3300048908 Bacteria 3273
425 Ga0496105_0060729 3300048908 Bacteria 3119
426 Ga0496105_0068146 3300048908 Bacteria 2939
427 Ga0496105_0185920 3300048908 Bacteria 1700
428 Ga0496106_0016435 3300048909 Bacteria 5475
429 Ga0496106_0046647 3300048909 Bacteria 3258
430 Ga0496106_0071848 3300048909 Bacteria 2645
431 Ga0496107_0002059 3300048910 Bacteria 12861
432 Ga0496107_0145618 3300048910 Bacteria 1752
433 Ga0496108_0000272 3300048911 Bacteria 44414
434 Ga0496108_0000473 3300048911 Bacteria 32225
435 Ga0496108_0009090 3300048911 Bacteria 8046
436 Ga0496108_0014268 3300048911 Bacteria 6483
437 Ga0496108_0026913 3300048911 Bacteria 4746
438 Ga0496108_0031484 3300048911 Bacteria 4402
439 Ga0496108_0059181 3300048911 Bacteria 3221
440 Ga0496109_0000857 3300048912 Bacteria 25402
441 Ga0496109_0001789 3300048912 Bacteria 17869
442 Ga0496109_0001891 3300048912 Bacteria 17380
443 Ga0496109_0007450 3300048912 Bacteria 9265
444 Ga0496109_0045880 3300048912 Bacteria 3967
445 Ga0496109_0063963 3300048912 Bacteria 3365
446 Ga0496109_0214523 3300048912 Bacteria 1810
447 Ga0496110_0001277 3300048913 Bacteria 18022
448 Ga0496110_0001545 3300048913 Bacteria 16749
449 Ga0496110_0019310 3300048913 Bacteria 5733
450 Ga0496110_0111175 3300048913 Bacteria 2462
451 Ga0496110_0182078 3300048913 Unclassified 1908
452 Ga0496110_0246090 3300048913 Bacteria 1627
453 Ga0496111_0001182 3300048914 Bacteria 14531
454 Ga0496111_0002257 3300048914 Bacteria 11581
455 Ga0496111_0005116 3300048914 Bacteria 8350
456 Ga0496111_0013548 3300048914 Bacteria 5554
457 Ga0496111_0075944 3300048914 Bacteria 2449
458 Ga0496111_0118303 3300048914 Bacteria 1956
459 Ga0496112_0001515 3300048915 Bacteria 17883
460 Ga0496112_0013792 3300048915 Bacteria 7475
461 Ga0496112_0014155 3300048915 Bacteria 7390
462 Ga0496112_0026349 3300048915 Bacteria 5591
463 Ga0496112_0044365 3300048915 Bacteria 4356
464 Ga0496112_0077189 3300048915 Bacteria 3294
465 Ga0496112_0096162 3300048915 Bacteria 2932
466 Ga0496112_0112909 3300048915 Bacteria 2688
467 Ga0496113_0000040 3300048916 Bacteria 55517
468 Ga0496113_0025600 3300048916 Bacteria 4208
469 Ga0496113_0078575 3300048916 Bacteria 2525
470 Ga0496113_0089839 3300048916 Unclassified 2365
471 Ga0496113_0102117 3300048916 Bacteria 2223
472 Ga0496113_0166368 3300048916 Bacteria 1745
473 Ga0496114_0019761 3300048917 Bacteria 5460
474 Ga0496114_0024418 3300048917 Bacteria 4934
475 Ga0496114_0041623 3300048917 Bacteria 3808
476 Ga0496114_0163796 3300048917 Bacteria 1935
477 Ga0496115_0003551 3300048918 Bacteria 11223
478 Ga0496115_0031760 3300048918 Bacteria 4163
479 Ga0496115_0049895 3300048918 Bacteria 3351
480 Ga0496115_0068958 3300048918 Bacteria 2863
481 Ga0501031_0005441 3300049568 Bacteria 8289
482 Ga0501031_0054773 3300049568 Bacteria 2598
483 Ga0501032_0033753 3300049569 Bacteria 3506
484 Ga0501033_0042923 3300049570 Bacteria 3370
485 Ga0501034_0047696 3300049571 Bacteria 4324
486 Ga0501036_0004334 3300049572 Bacteria 11454
487 Ga0501038_0079630 3300049574 Bacteria 2762
488 Ga0501039_0001308 3300049575 Bacteria 18206
489 Ga0501039_0066739 3300049575 Bacteria 2793
490 Ga0501040_0020791 3300049576 Bacteria 4376
491 Ga0501040_0025343 3300049576 Bacteria 3987
492 Ga0501040_0101227 3300049576 Bacteria 2010
493 Ga0501041_0003653 3300049577 Bacteria 8853
494 Ga0501042_0003274 3300049578 Bacteria 10134
495 Ga0501046_0054257 3300049580 Bacteria 3154
496 Ga0501048_0047132 3300049582 Bacteria 3075
497 Ga0501067_0002463 3300049583 Bacteria 10212
498 Ga0501067_0023056 3300049583 Bacteria 3448
499 Ga0501068_0007776 3300049584 Bacteria 5938
500 Ga0501069_0081322 3300049585 Bacteria 1825
501 Ga0501070_0005438 3300049586 Bacteria 10873
502 Ga0501070_0007027 3300049586 Bacteria 9576
503 Ga0501070_0011769 3300049586 Bacteria 7390
504 Ga0501070_0106192 3300049586 Bacteria 2321
505 Ga0501071_0004653 3300049587 Bacteria 8718
506 Ga0501072_0007897 3300049588 Bacteria 8079
507 Ga0501074_0014194 3300049590 Bacteria 5794
508 Ga0501074_0022361 3300049590 Bacteria 4593
509 Ga0501075_0024524 3300049591 Bacteria 4424
510 Ga0501077_0013661 3300049593 Bacteria 5089
511 Ga0501077_0041231 3300049593 Bacteria 2940
512 Ga0501079_0003331 3300049741 Bacteria 11787
513 Ga0501079_0167427 3300049741 Bacteria 1714
514 Ga0501080_0119901 3300049742 Bacteria 2438
515 Ga0501080_0252351 3300049742 Bacteria 1608
516 Ga0501083_0005190 3300049744 Bacteria 9216
517 Ga0501035_0076668 3300049822 Bacteria 2956
518 Ga0501045_0001410 3300049824 Bacteria 16040
519 Ga0501045_0003106 3300049824 Bacteria 11356
520 nmdc:mga05p37_20642_c1 3300050507 Bacteria 7970
521 nmdc:mga05p37_2406_c1 3300050507 Bacteria 21776
522 nmdc:mga05p37_73426_c1 3300050507 Bacteria 4210
523 nmdc:mga08y16_186314_c1 3300050511 Bacteria 2153
524 nmdc:mga08y16_249655_c1 3300050511 Bacteria 1834
525 nmdc:mga08y16_46181_c1 3300050511 Bacteria 4560
526 nmdc:mga0n895_66523_c1 3300050512 Bacteria 3569
527 nmdc:mga0rr50_172478_c1 3300050513 Bacteria 1764
528 nmdc:mga0rr50_19021_c1 3300050513 Bacteria 4626
529 nmdc:mga0a205_117780_c1 3300050515 Bacteria 2554
530 nmdc:mga0a205_148100_c1 3300050515 Bacteria 2248
531 nmdc:mga0a205_5953_c1 3300050515 Bacteria 10994
532 Ga0495601_0000340 3300053077 Bacteria 24567
533 Ga0495601_0020585 3300053077 Bacteria 4030
534 Ga0495601_0040461 3300053077 Bacteria 2918
535 Ga0495601_0043183 3300053077 Bacteria 2831
536 Ga0495601_0098497 3300053077 Bacteria 1887
537 Ga0495612_0021355 3300053078 Bacteria 2597
538 Ga0495612_0037794 3300053078 Bacteria 1961
539 Ga0495612_0051693 3300053078 Bacteria 1689
540 Ga0495595_0001185 3300053084 Bacteria 10134
541 Ga0495595_0021365 3300053084 Bacteria 2827
542 Ga0495595_0057566 3300053084 Bacteria 1813
543 Ga0495619_0001752 3300053085 Bacteria 14426
544 Ga0495619_0049831 3300053085 Bacteria 2763
545 Ga0495619_0080627 3300053085 Bacteria 2190
546 Ga0495619_0088496 3300053085 Bacteria 2094
547 Ga0500566_0098407 3300053094 Bacteria 1607
548 Ga0501084_0027489 3300054114 Bacteria 4752
549 Ga0501084_0079059 3300054114 Bacteria 2756
550 Ga0466962_0001837 3300061719 Bacteria 9996
551 Ga0466962_0009133 3300061719 Bacteria 4748
552 Ga0466962_0019961 3300061719 Bacteria 3221
553 Ga0530510_0005142 3300061734 Bacteria 9027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015261 Ga0182006_1043204 Ga0182006_10432042 361
2 3300048908 Ga0496105_0185920 Ga0496105_0185920_505_1668 384
3 3300044693 Ga0466961_0059646 Ga0466961_0059646_24_1205 393
4 3300046679 Ga0495623_0137413 Ga0495623_0137413_25_1206 393
5 3300026118 Ga0207675_100004186 Ga0207675_1000041869 394
6 3300048913 Ga0496110_0182078 Ga0496110_0182078_172_1536 394
7 3300025972 Ga0207668_10029028 Ga0207668_100290284 396
8 3300044735 Ga0466968_0036833 Ga0466968_0036833_625_1950 396
9 3300044694 Ga0466963_0018541 Ga0466963_0018541_516_1880 400
10 3300045836 Ga0466958_0011491 Ga0466958_0011491_1022_2386 400
11 3300045976 Ga0466967_0056012 Ga0466967_0056012_1463_2827 400
12 3300046517 Ga0495630_0010267 Ga0495630_0010267_3159_4520 401
13 3300005436 Ga0070713_100190735 Ga0070713_1001907351 403
14 3300009094 Ga0111539_10356086 Ga0111539_103560862 403
15 3300025928 Ga0207700_10162115 Ga0207700_101621152 403
16 3300005981 Ga0081538_10014854 Ga0081538_100148544 406
17 3300025927 Ga0207687_10139227 Ga0207687_101392272 406
18 3300037312 Ga0395899_0149461 Ga0395899_0149461_316_1599 406
19 3300037418 Ga0395900_0266910 Ga0395900_0266910_44_1369 406
20 3300037466 Ga0395898_0351975 Ga0395898_0351975_44_1369 406
21 3300046501 Ga0495607_0023628 Ga0495607_0023628_2248_3594 406
22 3300046690 Ga0495624_0060654 Ga0495624_0060654_215_1561 406
23 3300048912 Ga0496109_0063963 Ga0496109_0063963_204_1550 406
24 3300037466 Ga0395898_0177134 Ga0395898_0177134_358_1707 407
25 3300038443 Ga0395901_0175745 Ga0395901_0175745_437_1783 407
26 3300048911 Ga0496108_0026913 Ga0496108_0026913_3317_4663 407
27 3300005439 Ga0070711_100009007 Ga0070711_1000090076 409
28 3300006175 Ga0070712_100052940 Ga0070712_1000529403 409
29 3300009098 Ga0105245_10159705 Ga0105245_101597053 409
30 3300025915 Ga0207693_10059093 Ga0207693_100590933 409
31 3300047471 Ga0495684_0013033 Ga0495684_0013033_2727_4073 409
32 3300048904 Ga0496101_0111629 Ga0496101_0111629_621_2006 409
33 3300048905 Ga0496102_0107343 Ga0496102_0107343_811_2196 409
34 3300048907 Ga0496104_0074386 Ga0496104_0074386_305_1690 409
35 3300048908 Ga0496105_0027308 Ga0496105_0027308_1497_2882 409
36 3300048909 Ga0496106_0016435 Ga0496106_0016435_453_1838 409
37 3300048911 Ga0496108_0031484 Ga0496108_0031484_659_2044 409
38 3300048912 Ga0496109_0045880 Ga0496109_0045880_1449_2834 409
39 3300048917 Ga0496114_0024418 Ga0496114_0024418_1545_2930 409
40 3300048918 Ga0496115_0031760 Ga0496115_0031760_1152_2498 409
41 3300048918 Ga0496115_0068958 Ga0496115_0068958_1427_2812 409
42 3300053084 Ga0495595_0001185 Ga0495595_0001185_6772_8118 409
43 3300053085 Ga0495619_0080627 Ga0495619_0080627_647_1993 409
44 3300006852 Ga0075433_10074172 Ga0075433_100741722 410
45 3300014497 Ga0182008_10002973 Ga0182008_100029736 410
46 3300048907 Ga0496104_0000977 Ga0496104_0000977_13828_15174 410
47 3300048911 Ga0496108_0059181 Ga0496108_0059181_1554_2900 410
48 3300048912 Ga0496109_0001789 Ga0496109_0001789_4345_5691 410
49 3300050512 nmdc:mga0n895_66523_c1 nmdc:mga0n895_66523_c1_2148_3494 410
50 3300050515 nmdc:mga0a205_117780_c1 nmdc:mga0a205_117780_c1_517_1863 410
51 3300009094 Ga0111539_10001928 Ga0111539_1000192810 411
52 3300046675 Ga0495657_0047066 Ga0495657_0047066_1330_2676 411
53 3300050511 nmdc:mga08y16_46181_c1 nmdc:mga08y16_46181_c1_2761_4143 411
54 3300050513 nmdc:mga0rr50_172478_c1 nmdc:mga0rr50_172478_c1_15_1289 411
55 3300046463 Ga0495653_0061380 Ga0495653_0061380_434_1780 412
56 3300046473 Ga0495582_0052075 Ga0495582_0052075_13_1362 413
57 3300046516 Ga0495628_0177868 Ga0495628_0177868_150_1478 413
58 3300048918 Ga0496115_0049895 Ga0496115_0049895_851_2197 413
59 3300006844 Ga0075428_100200927 Ga0075428_1002009272 417
60 3300009147 Ga0114129_10171551 Ga0114129_101715512 417
61 3300049576 Ga0501040_0101227 Ga0501040_0101227_258_1694 417
62 3300048907 Ga0496104_0006401 Ga0496104_0006401_7066_8472 418
63 3300048908 Ga0496105_0006474 Ga0496105_0006474_3244_4650 418
64 3300046511 Ga0495608_0127465 Ga0495608_0127465_58_1467 419
65 3300053077 Ga0495601_0098497 Ga0495601_0098497_70_1476 420
66 3300044735 Ga0466968_0066912 Ga0466968_0066912_101_1447 421
67 3300045049 Ga0466959_0031281 Ga0466959_0031281_1916_3262 421
68 3300037418 Ga0395900_0050166 Ga0395900_0050166_1039_2412 422
69 3300005468 Ga0070707_100225462 Ga0070707_1002254622 423
70 3300025923 Ga0207681_10126008 Ga0207681_101260081 423
71 3300045836 Ga0466958_0023697 Ga0466958_0023697_2118_3464 423
72 3300005471 Ga0070698_100088976 Ga0070698_1000889762 424
73 3300048909 Ga0496106_0046647 Ga0496106_0046647_971_2395 424
74 3300048916 Ga0496113_0166368 Ga0496113_0166368_96_1520 424
75 3300005471 Ga0070698_100162872 Ga0070698_1001628721 425
76 3300025915 Ga0207693_10008363 Ga0207693_1000836312 425
77 3300035113 Ga0373936_0043462 Ga0373936_0043462_306_1655 425
78 3300005468 Ga0070707_100296720 Ga0070707_1002967202 426
79 3300005546 Ga0070696_100097446 Ga0070696_1000974461 426
80 3300037418 Ga0395900_0126617 Ga0395900_0126617_636_1973 426
81 3300037466 Ga0395898_0031845 Ga0395898_0031845_2816_4153 426
82 3300038443 Ga0395901_0034280 Ga0395901_0034280_1584_2921 426
83 3300045051 Ga0451576_0163520 Ga0451576_0163520_618_1997 426
84 3300005338 Ga0068868_100038305 Ga0068868_1000383052 427
85 3300009176 Ga0105242_10087126 Ga0105242_100871263 427
86 3300025885 Ga0207653_10007342 Ga0207653_100073422 427
87 3300025915 Ga0207693_10009671 Ga0207693_100096712 427
88 3300037312 Ga0395899_0028568 Ga0395899_0028568_2033_3367 427
89 3300037418 Ga0395900_0030925 Ga0395900_0030925_2522_3856 427
90 3300037466 Ga0395898_0041537 Ga0395898_0041537_1566_2900 427
91 3300037471 Ga0395905_0022282 Ga0395905_0022282_1643_2977 427
92 3300038443 Ga0395901_0033046 Ga0395901_0033046_1643_2977 427
93 3300048906 Ga0496103_0040604 Ga0496103_0040604_169_1572 427
94 3300049571 Ga0501034_0047696 Ga0501034_0047696_2653_4041 427
95 3300049586 Ga0501070_0005438 Ga0501070_0005438_8160_9548 427
96 3300049590 Ga0501074_0014194 Ga0501074_0014194_2119_3507 427
97 3300049742 Ga0501080_0119901 Ga0501080_0119901_684_2072 427
98 3300009098 Ga0105245_10005774 Ga0105245_100057749 428
99 3300013308 Ga0157375_10003176 Ga0157375_100031761 428
100 3300025941 Ga0207711_10135444 Ga0207711_101354442 428
101 3300046559 Ga0495667_0044697 Ga0495667_0044697_1389_2771 428
102 3300047322 Ga0495680_0053256 Ga0495680_0053256_1514_2896 428
103 3300048908 Ga0496105_0068146 Ga0496105_0068146_89_1435 428
104 3300048912 Ga0496109_0007450 Ga0496109_0007450_4940_6286 428
105 3300048914 Ga0496111_0002257 Ga0496111_0002257_341_1687 428
106 3300048916 Ga0496113_0089839 Ga0496113_0089839_21_1367 428
107 3300028800 Ga0265338_10005076 Ga0265338_1000507610 429
108 3300046559 Ga0495667_0088446 Ga0495667_0088446_524_1930 429
109 3300005339 Ga0070660_100008515 Ga0070660_1000085156 430
110 3300005435 Ga0070714_100130249 Ga0070714_1001302492 430
111 3300005530 Ga0070679_100086916 Ga0070679_1000869163 430
112 3300005530 Ga0070679_100293685 Ga0070679_1002936852 430
113 3300013104 Ga0157370_10010689 Ga0157370_100106898 430
114 3300013105 Ga0157369_10008456 Ga0157369_100084566 430
115 3300020081 Ga0206354_10286303 Ga0206354_102863032 430
116 3300025929 Ga0207664_10037991 Ga0207664_100379912 430
117 3300025944 Ga0207661_10017872 Ga0207661_100178722 430
118 3300037418 Ga0395900_0043110 Ga0395900_0043110_1694_3049 430
119 3300037466 Ga0395898_0019348 Ga0395898_0019348_4242_5642 430
120 3300037471 Ga0395905_0007022 Ga0395905_0007022_2324_3724 430
121 3300038443 Ga0395901_0075445 Ga0395901_0075445_1383_2738 430
122 3300039438 Ga0436360_1320551 Ga0436360_1320551_273_1655 430
123 3300044694 Ga0466963_0009739 Ga0466963_0009739_3605_4969 430
124 3300044694 Ga0466963_0059039 Ga0466963_0059039_452_1816 430
125 3300045836 Ga0466958_0035521 Ga0466958_0035521_15_1376 430
126 3300045836 Ga0466958_0075408 Ga0466958_0075408_483_1847 430
127 3300045976 Ga0466967_0044730 Ga0466967_0044730_1599_2963 430
128 3300045976 Ga0466967_0052580 Ga0466967_0052580_1951_3315 430
129 3300049586 Ga0501070_0007027 Ga0501070_0007027_5725_7092 430
130 3300049588 Ga0501072_0007897 Ga0501072_0007897_4326_5693 430
131 3300049590 Ga0501074_0022361 Ga0501074_0022361_2917_4284 430
132 3300049744 Ga0501083_0005190 Ga0501083_0005190_2794_4161 430
133 3300005336 Ga0070680_100097872 Ga0070680_1000978722 431
134 3300037471 Ga0395905_0035578 Ga0395905_0035578_2674_4074 431
135 3300005329 Ga0070683_100092238 Ga0070683_1000922383 432
136 3300005435 Ga0070714_100163274 Ga0070714_1001632741 432
137 3300013104 Ga0157370_10005484 Ga0157370_100054843 432
138 3300013105 Ga0157369_10038348 Ga0157369_100383485 432
139 3300035170 Ga0373943_0031502 Ga0373943_0031502_615_2012 432
140 3300044694 Ga0466963_0163594 Ga0466963_0163594_18_1415 432
141 3300044842 Ga0466957_0031556 Ga0466957_0031556_476_1873 432
142 3300045976 Ga0466967_0004694 Ga0466967_0004694_3055_4434 432
143 3300045976 Ga0466967_0008665 Ga0466967_0008665_4982_6379 432
144 3300045976 Ga0466967_0117806 Ga0466967_0117806_1037_2416 432
145 3300046499 Ga0495594_0056014 Ga0495594_0056014_673_2070 432
146 3300005445 Ga0070708_100025940 Ga0070708_1000259406 433
147 3300005467 Ga0070706_100002089 Ga0070706_1000020899 433
148 3300005468 Ga0070707_100000736 Ga0070707_1000007364 433
149 3300005518 Ga0070699_100028631 Ga0070699_1000286312 433
150 3300005544 Ga0070686_100048181 Ga0070686_1000481813 433
151 3300005563 Ga0068855_100039573 Ga0068855_1000395734 433
152 3300009098 Ga0105245_10110840 Ga0105245_101108402 433
153 3300014968 Ga0157379_10071265 Ga0157379_100712653 433
154 3300025910 Ga0207684_10004837 Ga0207684_100048374 433
155 3300025922 Ga0207646_10002219 Ga0207646_1000221910 433
156 3300025933 Ga0207706_10178576 Ga0207706_101785762 433
157 3300035725 Ga0373947_0038701 Ga0373947_0038701_1110_2468 433
158 3300042001 Ga0439441_003139 Ga0439441_003139_629_2008 433
159 3300046462 Ga0495651_0086787 Ga0495651_0086787_431_1843 433
160 3300046517 Ga0495630_0068616 Ga0495630_0068616_1281_2639 433
161 3300046642 Ga0495634_0021950 Ga0495634_0021950_1896_3254 433
162 3300046689 Ga0495613_0057824 Ga0495613_0057824_613_1971 433
163 3300048905 Ga0496102_0203938 Ga0496102_0203938_27_1427 433
164 3300048911 Ga0496108_0000473 Ga0496108_0000473_19_1419 433
165 3300048912 Ga0496109_0001891 Ga0496109_0001891_1788_3188 433
166 3300048913 Ga0496110_0001277 Ga0496110_0001277_5746_7146 433
167 3300048914 Ga0496111_0005116 Ga0496111_0005116_4087_5487 433
168 3300048916 Ga0496113_0025600 Ga0496113_0025600_2268_3668 433
169 3300048917 Ga0496114_0041623 Ga0496114_0041623_1005_2405 433
170 3300005330 Ga0070690_100103245 Ga0070690_1001032452 434
171 3300005336 Ga0070680_100026368 Ga0070680_1000263683 434
172 3300005337 Ga0070682_100019819 Ga0070682_1000198193 434
173 3300005341 Ga0070691_10027327 Ga0070691_100273272 434
174 3300005439 Ga0070711_100163962 Ga0070711_1001639621 434
175 3300005440 Ga0070705_100055551 Ga0070705_1000555513 434
176 3300005441 Ga0070700_100013906 Ga0070700_1000139066 434
177 3300005455 Ga0070663_100018013 Ga0070663_1000180132 434
178 3300005456 Ga0070678_100027748 Ga0070678_1000277483 434
179 3300005530 Ga0070679_100098170 Ga0070679_1000981702 434
180 3300005535 Ga0070684_100179417 Ga0070684_1001794171 434
181 3300005544 Ga0070686_100041358 Ga0070686_1000413583 434
182 3300005614 Ga0068856_100004494 Ga0068856_10000449412 434
183 3300005615 Ga0070702_100018393 Ga0070702_1000183933 434
184 3300005618 Ga0068864_100058340 Ga0068864_1000583404 434
185 3300005719 Ga0068861_100049503 Ga0068861_1000495032 434
186 3300005985 Ga0081539_10002903 Ga0081539_100029033 434
187 3300006028 Ga0070717_10030392 Ga0070717_100303922 434
188 3300009098 Ga0105245_10014739 Ga0105245_100147393 434
189 3300009176 Ga0105242_10038235 Ga0105242_100382354 434
190 3300014969 Ga0157376_10017745 Ga0157376_100177452 434
191 3300025906 Ga0207699_10059306 Ga0207699_100593062 434
192 3300025915 Ga0207693_10007712 Ga0207693_100077126 434
193 3300025917 Ga0207660_10041793 Ga0207660_100417932 434
194 3300025933 Ga0207706_10011285 Ga0207706_100112856 434
195 3300025939 Ga0207665_10005170 Ga0207665_100051704 434
196 3300026067 Ga0207678_10027462 Ga0207678_100274625 434
197 3300026067 Ga0207678_10220475 Ga0207678_102204752 434
198 3300026075 Ga0207708_10009298 Ga0207708_100092986 434
199 3300026078 Ga0207702_10006207 Ga0207702_100062076 434
200 3300026089 Ga0207648_10002132 Ga0207648_100021322 434
201 3300026121 Ga0207683_10029845 Ga0207683_100298452 434
202 3300026121 Ga0207683_10098762 Ga0207683_100987622 434
203 3300035115 Ga0373941_0015705 Ga0373941_0015705_287_1693 434
204 3300035170 Ga0373943_0013462 Ga0373943_0013462_842_2245 434
205 3300035725 Ga0373947_0010190 Ga0373947_0010190_930_2333 434
206 3300037312 Ga0395899_0044205 Ga0395899_0044205_1749_3152 434
207 3300037312 Ga0395899_0079820 Ga0395899_0079820_520_1890 434
208 3300037466 Ga0395898_0006932 Ga0395898_0006932_3374_4777 434
209 3300037471 Ga0395905_0069044 Ga0395905_0069044_915_2276 434
210 3300038443 Ga0395901_0026455 Ga0395901_0026455_784_2187 434
211 3300041999 Ga0439433_0003796 Ga0439433_0003796_1337_2707 434
212 3300042156 Ga0439446_0004144 Ga0439446_0004144_1565_2935 434
213 3300046455 Ga0495603_0000450 Ga0495603_0000450_2061_3464 434
214 3300046461 Ga0495641_0013562 Ga0495641_0013562_2942_4345 434
215 3300046472 Ga0495580_0040667 Ga0495580_0040667_1290_2693 434
216 3300046473 Ga0495582_0008066 Ga0495582_0008066_4286_5689 434
217 3300046475 Ga0495639_0024573 Ga0495639_0024573_1045_2448 434
218 3300046499 Ga0495594_0001436 Ga0495594_0001436_8783_10186 434
219 3300046526 Ga0495666_0011671 Ga0495666_0011671_123_1526 434
220 3300046531 Ga0495665_0039270 Ga0495665_0039270_35_1396 434
221 3300046674 Ga0495588_0000857 Ga0495588_0000857_9060_10463 434
222 3300046683 Ga0495658_0064418 Ga0495658_0064418_589_1992 434
223 3300047321 Ga0495676_0000602 Ga0495676_0000602_2384_3787 434
224 3300048903 Ga0496100_0064186 Ga0496100_0064186_979_2382 434
225 3300048905 Ga0496102_0031576 Ga0496102_0031576_1148_2554 434
226 3300048905 Ga0496102_0120253 Ga0496102_0120253_248_1651 434
227 3300048906 Ga0496103_0044226 Ga0496103_0044226_190_1596 434
228 3300048907 Ga0496104_0001337 Ga0496104_0001337_19052_20455 434
229 3300048907 Ga0496104_0037468 Ga0496104_0037468_1183_2586 434
230 3300048907 Ga0496104_0116472 Ga0496104_0116472_1148_2554 434
231 3300048908 Ga0496105_0002654 Ga0496105_0002654_2705_4108 434
232 3300048908 Ga0496105_0055423 Ga0496105_0055423_1825_3231 434
233 3300048908 Ga0496105_0060729 Ga0496105_0060729_1137_2540 434
234 3300048909 Ga0496106_0071848 Ga0496106_0071848_37_1398 434
235 3300048911 Ga0496108_0000272 Ga0496108_0000272_14977_16380 434
236 3300048912 Ga0496109_0000857 Ga0496109_0000857_14978_16381 434
237 3300048913 Ga0496110_0001545 Ga0496110_0001545_10159_11562 434
238 3300048913 Ga0496110_0111175 Ga0496110_0111175_394_1797 434
239 3300048913 Ga0496110_0246090 Ga0496110_0246090_30_1436 434
240 3300048914 Ga0496111_0001182 Ga0496111_0001182_8327_9730 434
241 3300048914 Ga0496111_0118303 Ga0496111_0118303_292_1695 434
242 3300048915 Ga0496112_0026349 Ga0496112_0026349_1677_3080 434
243 3300048915 Ga0496112_0112909 Ga0496112_0112909_1015_2421 434
244 3300048916 Ga0496113_0000040 Ga0496113_0000040_24921_26324 434
245 3300048917 Ga0496114_0163796 Ga0496114_0163796_468_1871 434
246 3300048918 Ga0496115_0003551 Ga0496115_0003551_8669_10072 434
247 3300050507 nmdc:mga05p37_20642_c1 nmdc:mga05p37_20642_c1_1176_2537 434
248 3300005435 Ga0070714_100021353 Ga0070714_1000213536 435
249 3300005436 Ga0070713_100055254 Ga0070713_1000552544 435
250 3300005437 Ga0070710_10020109 Ga0070710_100201092 435
251 3300005445 Ga0070708_100020147 Ga0070708_1000201474 435
252 3300005467 Ga0070706_100169990 Ga0070706_1001699902 435
253 3300005471 Ga0070698_100010276 Ga0070698_1000102761 435
254 3300005937 Ga0081455_10027516 Ga0081455_100275164 435
255 3300005983 Ga0081540_1001884 Ga0081540_10018845 435
256 3300006058 Ga0075432_10010379 Ga0075432_100103793 435
257 3300006163 Ga0070715_10007105 Ga0070715_100071054 435
258 3300006880 Ga0075429_100052446 Ga0075429_1000524462 435
259 3300006914 Ga0075436_100044442 Ga0075436_1000444422 435
260 3300007076 Ga0075435_100036783 Ga0075435_1000367832 435
261 3300009147 Ga0114129_10179373 Ga0114129_101793733 435
262 3300025910 Ga0207684_10102878 Ga0207684_101028782 435
263 3300025921 Ga0207652_10223975 Ga0207652_102239752 435
264 3300025939 Ga0207665_10000197 Ga0207665_1000019731 435
265 3300027907 Ga0207428_10013176 Ga0207428_100131765 435
266 3300035121 Ga0373960_0016274 Ga0373960_0016274_50_1456 435
267 3300037312 Ga0395899_0004144 Ga0395899_0004144_7929_9335 435
268 3300037418 Ga0395900_0024289 Ga0395900_0024289_3713_5119 435
269 3300037466 Ga0395898_0010279 Ga0395898_0010279_1703_3109 435
270 3300037471 Ga0395905_0006934 Ga0395905_0006934_1701_3107 435
271 3300044694 Ga0466963_0015702 Ga0466963_0015702_2957_4303 435
272 3300044842 Ga0466957_0018705 Ga0466957_0018705_990_2336 435
273 3300045836 Ga0466958_0010910 Ga0466958_0010910_3187_4533 435
274 3300045976 Ga0466967_0148982 Ga0466967_0148982_571_1917 435
275 3300048905 Ga0496102_0005223 Ga0496102_0005223_5121_6467 435
276 3300048910 Ga0496107_0002059 Ga0496107_0002059_6234_7580 435
277 3300048911 Ga0496108_0009090 Ga0496108_0009090_5938_7284 435
278 3300048917 Ga0496114_0019761 Ga0496114_0019761_2108_3454 435
279 3300049583 Ga0501067_0002463 Ga0501067_0002463_306_1712 435
280 3300049586 Ga0501070_0106192 Ga0501070_0106192_17_1423 435
281 3300050511 nmdc:mga08y16_249655_c1 nmdc:mga08y16_249655_c1_390_1796 435
282 3300050515 nmdc:mga0a205_148100_c1 nmdc:mga0a205_148100_c1_150_1556 435
283 3300061734 Ga0530510_0005142 Ga0530510_0005142_3916_5322 435
284 3300005329 Ga0070683_100002787 Ga0070683_1000027878 436
285 3300005336 Ga0070680_100243614 Ga0070680_1002436141 436
286 3300005535 Ga0070684_100047821 Ga0070684_1000478212 436
287 3300020082 Ga0206353_11257401 Ga0206353_112574016 436
288 3300025944 Ga0207661_10016534 Ga0207661_100165343 436
289 3300028573 Ga0265334_10007596 Ga0265334_100075966 436
290 3300031595 Ga0265313_10016189 Ga0265313_100161893 436
291 3300044694 Ga0466963_0053911 Ga0466963_0053911_1216_2526 436
292 3300044706 Ga0466964_0012047 Ga0466964_0012047_1532_2842 436
293 3300044842 Ga0466957_0102279 Ga0466957_0102279_163_1473 436
294 3300045976 Ga0466967_0011472 Ga0466967_0011472_950_2260 436
295 3300045976 Ga0466967_0012538 Ga0466967_0012538_3575_4885 436
296 3300053085 Ga0495619_0049831 Ga0495619_0049831_447_1757 436
297 3300049742 Ga0501080_0252351 Ga0501080_0252351_183_1571 437
298 3300005468 Ga0070707_100018978 Ga0070707_1000189784 438
299 3300026118 Ga0207675_100181309 Ga0207675_1001813092 438
300 3300044706 Ga0466964_0001008 Ga0466964_0001008_536_1903 438
301 3300025940 Ga0207691_10181656 Ga0207691_101816562 439
302 3300048915 Ga0496112_0014155 Ga0496112_0014155_4364_5779 439
303 3300049741 Ga0501079_0167427 Ga0501079_0167427_198_1637 439
304 3300005437 Ga0070710_10001590 Ga0070710_100015902 441
305 3300005439 Ga0070711_100005385 Ga0070711_1000053854 441
306 3300005468 Ga0070707_100001273 Ga0070707_1000012737 441
307 3300006028 Ga0070717_10003907 Ga0070717_100039072 441
308 3300006028 Ga0070717_10022558 Ga0070717_100225583 441
309 3300025898 Ga0207692_10018241 Ga0207692_100182413 441
310 3300025915 Ga0207693_10000198 Ga0207693_100001989 441
311 3300025922 Ga0207646_10004655 Ga0207646_1000465512 441
312 3300025929 Ga0207664_10032010 Ga0207664_100320104 441
313 3300035083 Ga0373926_0018619 Ga0373926_0018619_128_1501 441
314 3300035170 Ga0373943_0003173 Ga0373943_0003173_2026_3399 441
315 3300035695 Ga0373927_0028600 Ga0373927_0028600_730_2103 441
316 3300035725 Ga0373947_0001279 Ga0373947_0001279_6205_7578 441
317 3300037068 Ga0373925_0001456 Ga0373925_0001456_10690_12063 441
318 3300037312 Ga0395899_0030874 Ga0395899_0030874_427_1848 441
319 3300037418 Ga0395900_0005056 Ga0395900_0005056_7931_9352 441
320 3300037466 Ga0395898_0047572 Ga0395898_0047572_1358_2779 441
321 3300037471 Ga0395905_0002930 Ga0395905_0002930_3690_5111 441
322 3300038443 Ga0395901_0004146 Ga0395901_0004146_8499_9920 441
323 3300038443 Ga0395901_0020678 Ga0395901_0020678_4771_6195 441
324 3300044656 Ga0466969_0001820 Ga0466969_0001820_1367_2815 441
325 3300044694 Ga0466963_0000518 Ga0466963_0000518_12850_14298 441
326 3300044694 Ga0466963_0016045 Ga0466963_0016045_1064_2437 441
327 3300044694 Ga0466963_0065364 Ga0466963_0065364_830_2203 441
328 3300044719 Ga0466971_0047373 Ga0466971_0047373_541_1914 441
329 3300044735 Ga0466968_0000984 Ga0466968_0000984_8394_9767 441
330 3300044842 Ga0466957_0005617 Ga0466957_0005617_2787_4235 441
331 3300045049 Ga0466959_0013448 Ga0466959_0013448_3693_5066 441
332 3300045836 Ga0466958_0013018 Ga0466958_0013018_1064_2437 441
333 3300045976 Ga0466967_0010632 Ga0466967_0010632_1076_2449 441
334 3300045976 Ga0466967_0114388 Ga0466967_0114388_381_1754 441
335 3300045976 Ga0466967_0129048 Ga0466967_0129048_11_1384 441
336 3300045976 Ga0466967_0168275 Ga0466967_0168275_391_1764 441
337 3300046454 Ga0495592_0003845 Ga0495592_0003845_8788_10161 441
338 3300046454 Ga0495592_0086273 Ga0495592_0086273_655_2028 441
339 3300046459 Ga0495629_0001473 Ga0495629_0001473_2533_3906 441
340 3300046459 Ga0495629_0007112 Ga0495629_0007112_3530_4903 441
341 3300046459 Ga0495629_0034375 Ga0495629_0034375_1777_3150 441
342 3300046461 Ga0495641_0001513 Ga0495641_0001513_9931_11304 441
343 3300046463 Ga0495653_0032755 Ga0495653_0032755_466_1839 441
344 3300046463 Ga0495653_0052434 Ga0495653_0052434_19_1392 441
345 3300046472 Ga0495580_0006863 Ga0495580_0006863_7481_8854 441
346 3300046473 Ga0495582_0000711 Ga0495582_0000711_11091_12464 441
347 3300046475 Ga0495639_0000520 Ga0495639_0000520_11516_12889 441
348 3300046477 Ga0495664_0016797 Ga0495664_0016797_1083_2456 441
349 3300046514 Ga0495618_0019968 Ga0495618_0019968_604_1977 441
350 3300046517 Ga0495630_0001692 Ga0495630_0001692_8111_9484 441
351 3300046526 Ga0495666_0000272 Ga0495666_0000272_14748_16121 441
352 3300046529 Ga0495652_0008764 Ga0495652_0008764_890_2263 441
353 3300046529 Ga0495652_0032894 Ga0495652_0032894_799_2172 441
354 3300046529 Ga0495652_0185802 Ga0495652_0185802_115_1488 441
355 3300046531 Ga0495665_0001436 Ga0495665_0001436_10377_11750 441
356 3300046533 Ga0495640_0026292 Ga0495640_0026292_2342_3715 441
357 3300046535 Ga0495586_0031982 Ga0495586_0031982_955_2328 441
358 3300046642 Ga0495634_0025274 Ga0495634_0025274_2688_4061 441
359 3300046642 Ga0495634_0045959 Ga0495634_0045959_1083_2456 441
360 3300046663 Ga0495635_0057167 Ga0495635_0057167_357_1730 441
361 3300046663 Ga0495635_0076700 Ga0495635_0076700_876_2249 441
362 3300046680 Ga0495646_0038682 Ga0495646_0038682_66_1439 441
363 3300046680 Ga0495646_0061681 Ga0495646_0061681_287_1660 441
364 3300046681 Ga0495647_0000245 Ga0495647_0000245_6805_8178 441
365 3300046683 Ga0495658_0000675 Ga0495658_0000675_9920_11293 441
366 3300046689 Ga0495613_0006283 Ga0495613_0006283_6874_8247 441
367 3300046690 Ga0495624_0044760 Ga0495624_0044760_955_2328 441
368 3300047315 Ga0495581_0019156 Ga0495581_0019156_1645_3018 441
369 3300047321 Ga0495676_0019704 Ga0495676_0019704_4065_5438 441
370 3300047471 Ga0495684_0068032 Ga0495684_0068032_575_1948 441
371 3300047471 Ga0495684_0135856 Ga0495684_0135856_116_1489 441
372 3300047673 Ga0495593_0000863 Ga0495593_0000863_5770_7143 441
373 3300048088 Ga0495602_0052498 Ga0495602_0052498_1690_3063 441
374 3300048089 Ga0495614_0000132 Ga0495614_0000132_18559_19932 441
375 3300049568 Ga0501031_0005441 Ga0501031_0005441_5046_6425 441
376 3300049568 Ga0501031_0054773 Ga0501031_0054773_838_2265 441
377 3300049569 Ga0501032_0033753 Ga0501032_0033753_192_1619 441
378 3300049570 Ga0501033_0042923 Ga0501033_0042923_1726_3105 441
379 3300049572 Ga0501036_0004334 Ga0501036_0004334_9463_10842 441
380 3300049574 Ga0501038_0079630 Ga0501038_0079630_165_1592 441
381 3300049575 Ga0501039_0001308 Ga0501039_0001308_9922_11301 441
382 3300049575 Ga0501039_0066739 Ga0501039_0066739_364_1791 441
383 3300049576 Ga0501040_0020791 Ga0501040_0020791_1299_2678 441
384 3300049576 Ga0501040_0025343 Ga0501040_0025343_34_1461 441
385 3300049577 Ga0501041_0003653 Ga0501041_0003653_3088_4467 441
386 3300049578 Ga0501042_0003274 Ga0501042_0003274_6614_7993 441
387 3300049580 Ga0501046_0054257 Ga0501046_0054257_521_1948 441
388 3300049582 Ga0501048_0047132 Ga0501048_0047132_1613_3040 441
389 3300049584 Ga0501068_0007776 Ga0501068_0007776_732_2111 441
390 3300049586 Ga0501070_0011769 Ga0501070_0011769_234_1613 441
391 3300049587 Ga0501071_0004653 Ga0501071_0004653_5706_7133 441
392 3300049591 Ga0501075_0024524 Ga0501075_0024524_2490_3917 441
393 3300049593 Ga0501077_0013661 Ga0501077_0013661_474_1853 441
394 3300049593 Ga0501077_0041231 Ga0501077_0041231_1202_2629 441
395 3300049741 Ga0501079_0003331 Ga0501079_0003331_1768_3147 441
396 3300049822 Ga0501035_0076668 Ga0501035_0076668_1435_2814 441
397 3300049824 Ga0501045_0001410 Ga0501045_0001410_12846_14273 441
398 3300049824 Ga0501045_0003106 Ga0501045_0003106_9818_11197 441
399 3300053077 Ga0495601_0043183 Ga0495601_0043183_504_1877 441
400 3300053078 Ga0495612_0021355 Ga0495612_0021355_244_1617 441
401 3300053078 Ga0495612_0037794 Ga0495612_0037794_15_1388 441
402 3300053084 Ga0495595_0021365 Ga0495595_0021365_1158_2531 441
403 3300053085 Ga0495619_0088496 Ga0495619_0088496_640_2013 441
404 3300053094 Ga0500566_0098407 Ga0500566_0098407_139_1512 441
405 3300054114 Ga0501084_0027489 Ga0501084_0027489_1604_3031 441
406 3300054114 Ga0501084_0079059 Ga0501084_0079059_60_1439 441
407 3300061719 Ga0466962_0001837 Ga0466962_0001837_3401_4774 441
408 3300061719 Ga0466962_0009133 Ga0466962_0009133_3206_4579 441
409 3300005337 Ga0070682_100042246 Ga0070682_1000422461 442
410 3300005458 Ga0070681_10046805 Ga0070681_100468051 442
411 3300005467 Ga0070706_100054927 Ga0070706_1000549273 442
412 3300005471 Ga0070698_100016163 Ga0070698_1000161635 442
413 3300005518 Ga0070699_100085700 Ga0070699_1000857003 442
414 3300005530 Ga0070679_100161104 Ga0070679_1001611042 442
415 3300005535 Ga0070684_100151272 Ga0070684_1001512722 442
416 3300006852 Ga0075433_10007908 Ga0075433_100079086 442
417 3300006852 Ga0075433_10020701 Ga0075433_100207015 442
418 3300006871 Ga0075434_100013194 Ga0075434_1000131945 442
419 3300006871 Ga0075434_100035968 Ga0075434_1000359686 442
420 3300006914 Ga0075436_100002736 Ga0075436_1000027368 442
421 3300006914 Ga0075436_100041892 Ga0075436_1000418922 442
422 3300007076 Ga0075435_100000579 Ga0075435_10000057923 442
423 3300007076 Ga0075435_100001676 Ga0075435_1000016763 442
424 3300009094 Ga0111539_10219406 Ga0111539_102194063 442
425 3300009147 Ga0114129_10002630 Ga0114129_1000263022 442
426 3300009147 Ga0114129_10044266 Ga0114129_100442662 442
427 3300025912 Ga0207707_10100991 Ga0207707_101009912 442
428 3300025919 Ga0207657_10016396 Ga0207657_100163963 442
429 3300025919 Ga0207657_10024716 Ga0207657_100247164 442
430 3300028563 Ga0265319_1001059 Ga0265319_10010594 442
431 3300028577 Ga0265318_10001637 Ga0265318_100016374 442
432 3300028577 Ga0265318_10003407 Ga0265318_100034077 442
433 3300028800 Ga0265338_10125573 Ga0265338_101255732 442
434 3300031235 Ga0265330_10016974 Ga0265330_100169743 442
435 3300031235 Ga0265330_10047333 Ga0265330_100473332 442
436 3300031239 Ga0265328_10010907 Ga0265328_100109072 442
437 3300031240 Ga0265320_10017712 Ga0265320_100177123 442
438 3300031240 Ga0265320_10040777 Ga0265320_100407772 442
439 3300031241 Ga0265325_10018259 Ga0265325_100182593 442
440 3300031241 Ga0265325_10028698 Ga0265325_100286982 442
441 3300031247 Ga0265340_10059216 Ga0265340_100592162 442
442 3300031249 Ga0265339_10004983 Ga0265339_100049836 442
443 3300031250 Ga0265331_10023049 Ga0265331_100230493 442
444 3300031251 Ga0265327_10023772 Ga0265327_100237723 442
445 3300031251 Ga0265327_10025765 Ga0265327_100257652 442
446 3300031344 Ga0265316_10025321 Ga0265316_100253214 442
447 3300031344 Ga0265316_10053801 Ga0265316_100538012 442
448 3300031711 Ga0265314_10005893 Ga0265314_100058936 442
449 3300031712 Ga0265342_10025222 Ga0265342_100252223 442
450 3300031712 Ga0265342_10038371 Ga0265342_100383712 442
451 3300037312 Ga0395899_0007114 Ga0395899_0007114_7056_8438 442
452 3300037418 Ga0395900_0008595 Ga0395900_0008595_8148_9560 442
453 3300037418 Ga0395900_0016527 Ga0395900_0016527_5891_7273 442
454 3300037418 Ga0395900_0054382 Ga0395900_0054382_391_1773 442
455 3300037466 Ga0395898_0008878 Ga0395898_0008878_5136_6548 442
456 3300037466 Ga0395898_0015998 Ga0395898_0015998_255_1637 442
457 3300037466 Ga0395898_0303662 Ga0395898_0303662_47_1468 442
458 3300037471 Ga0395905_0011779 Ga0395905_0011779_5265_6677 442
459 3300037471 Ga0395905_0012413 Ga0395905_0012413_6564_7946 442
460 3300038443 Ga0395901_0009150 Ga0395901_0009150_2643_4025 442
461 3300038443 Ga0395901_0067732 Ga0395901_0067732_296_1708 442
462 3300038443 Ga0395901_0150034 Ga0395901_0150034_106_1488 442
463 3300044706 Ga0466964_0044427 Ga0466964_0044427_120_1541 442
464 3300044735 Ga0466968_0008612 Ga0466968_0008612_1569_2990 442
465 3300045976 Ga0466967_0000215 Ga0466967_0000215_22576_23997 442
466 3300046663 Ga0495635_0028500 Ga0495635_0028500_343_1794 442
467 3300048905 Ga0496102_0194329 Ga0496102_0194329_466_1848 442
468 3300048907 Ga0496104_0027991 Ga0496104_0027991_2783_4165 442
469 3300048908 Ga0496105_0030208 Ga0496105_0030208_1925_3307 442
470 3300048912 Ga0496109_0214523 Ga0496109_0214523_181_1632 442
471 3300048913 Ga0496110_0019310 Ga0496110_0019310_1775_3157 442
472 3300048914 Ga0496111_0013548 Ga0496111_0013548_3067_4449 442
473 3300048914 Ga0496111_0075944 Ga0496111_0075944_211_1662 442
474 3300048915 Ga0496112_0001515 Ga0496112_0001515_1950_3332 442
475 3300048915 Ga0496112_0013792 Ga0496112_0013792_4306_5730 442
476 3300048915 Ga0496112_0044365 Ga0496112_0044365_1129_2595 442
477 3300048915 Ga0496112_0077189 Ga0496112_0077189_1444_2826 442
478 3300048916 Ga0496113_0078575 Ga0496113_0078575_551_1972 442
479 3300050507 nmdc:mga05p37_2406_c1 nmdc:mga05p37_2406_c1_19992_21374 442
480 3300050507 nmdc:mga05p37_73426_c1 nmdc:mga05p37_73426_c1_276_1658 442
481 3300050511 nmdc:mga08y16_186314_c1 nmdc:mga08y16_186314_c1_576_1961 442
482 3300050513 nmdc:mga0rr50_19021_c1 nmdc:mga0rr50_19021_c1_772_2157 442
483 3300050515 nmdc:mga0a205_5953_c1 nmdc:mga0a205_5953_c1_1207_2592 442
484 3300005327 Ga0070658_10147574 Ga0070658_101475742 443
485 3300005339 Ga0070660_100022105 Ga0070660_1000221055 443
486 3300005436 Ga0070713_100045051 Ga0070713_1000450514 443
487 3300005471 Ga0070698_100024678 Ga0070698_1000246786 443
488 3300005535 Ga0070684_100021195 Ga0070684_1000211955 443
489 3300005545 Ga0070695_100000023 Ga0070695_10000002315 443
490 3300005563 Ga0068855_100076760 Ga0068855_1000767603 443
491 3300006028 Ga0070717_10018851 Ga0070717_100188516 443
492 3300006028 Ga0070717_10040702 Ga0070717_100407023 443
493 3300009098 Ga0105245_10085538 Ga0105245_100855383 443
494 3300009545 Ga0105237_10101443 Ga0105237_101014433 443
495 3300025912 Ga0207707_10195325 Ga0207707_101953252 443
496 3300025914 Ga0207671_10068278 Ga0207671_100682783 443
497 3300025928 Ga0207700_10038025 Ga0207700_100380252 443
498 3300025929 Ga0207664_10005271 Ga0207664_100052715 443
499 3300025944 Ga0207661_10125382 Ga0207661_101253822 443
500 3300026142 Ga0207698_10150922 Ga0207698_101509222 443
501 3300028800 Ga0265338_10004619 Ga0265338_1000461917 443
502 3300036401 Ga0373937_0060417 Ga0373937_0060417_138_1475 443
503 3300037418 Ga0395900_0073531 Ga0395900_0073531_1060_2499 443
504 3300044693 Ga0466961_0021458 Ga0466961_0021458_1853_3238 443
505 3300044693 Ga0466961_0117836 Ga0466961_0117836_311_1642 443
506 3300044694 Ga0466963_0003462 Ga0466963_0003462_7500_8831 443
507 3300044694 Ga0466963_0011497 Ga0466963_0011497_1166_2497 443
508 3300044694 Ga0466963_0012038 Ga0466963_0012038_2616_3953 443
509 3300044694 Ga0466963_0052155 Ga0466963_0052155_319_1704 443
510 3300044706 Ga0466964_0003578 Ga0466964_0003578_3186_4523 443
511 3300044719 Ga0466971_0011727 Ga0466971_0011727_2161_3492 443
512 3300044735 Ga0466968_0003485 Ga0466968_0003485_2235_3620 443
513 3300044842 Ga0466957_0023144 Ga0466957_0023144_1599_2984 443
514 3300045836 Ga0466958_0001119 Ga0466958_0001119_6090_7421 443
515 3300045976 Ga0466967_0002633 Ga0466967_0002633_9408_10739 443
516 3300045976 Ga0466967_0021924 Ga0466967_0021924_1583_2968 443
517 3300046454 Ga0495592_0000597 Ga0495592_0000597_11434_12771 443
518 3300046462 Ga0495651_0000008 Ga0495651_0000008_142954_144291 443
519 3300046463 Ga0495653_0000725 Ga0495653_0000725_11377_12714 443
520 3300046477 Ga0495664_0053361 Ga0495664_0053361_289_1740 443
521 3300046477 Ga0495664_0074459 Ga0495664_0074459_11_1342 443
522 3300046511 Ga0495608_0000957 Ga0495608_0000957_6648_7985 443
523 3300046511 Ga0495608_0074310 Ga0495608_0074310_96_1427 443
524 3300046514 Ga0495618_0002854 Ga0495618_0002854_3964_5301 443
525 3300046516 Ga0495628_0000105 Ga0495628_0000105_13053_14390 443
526 3300046529 Ga0495652_0001221 Ga0495652_0001221_16052_17389 443
527 3300046533 Ga0495640_0158659 Ga0495640_0158659_104_1441 443
528 3300046536 Ga0495587_0000048 Ga0495587_0000048_16053_17390 443
529 3300046543 Ga0495645_0000029 Ga0495645_0000029_95730_97067 443
530 3300046675 Ga0495657_0007940 Ga0495657_0007940_1981_3318 443
531 3300046678 Ga0495599_0000110 Ga0495599_0000110_16052_17389 443
532 3300046679 Ga0495623_0000379 Ga0495623_0000379_11762_13099 443
533 3300046680 Ga0495646_0002891 Ga0495646_0002891_1596_2933 443
534 3300046689 Ga0495613_0079252 Ga0495613_0079252_697_2028 443
535 3300046690 Ga0495624_0018866 Ga0495624_0018866_378_1709 443
536 3300047317 Ga0495604_0000687 Ga0495604_0000687_11300_12637 443
537 3300047319 Ga0495674_0026681 Ga0495674_0026681_2596_3927 443
538 3300047322 Ga0495680_0011528 Ga0495680_0011528_3420_4757 443
539 3300047444 Ga0495675_0000419 Ga0495675_0000419_16038_17375 443
540 3300048088 Ga0495602_0001409 Ga0495602_0001409_12395_13732 443
541 3300048910 Ga0496107_0145618 Ga0496107_0145618_303_1634 443
542 3300048911 Ga0496108_0014268 Ga0496108_0014268_3044_4375 443
543 3300048915 Ga0496112_0096162 Ga0496112_0096162_1502_2833 443
544 3300048916 Ga0496113_0102117 Ga0496113_0102117_88_1419 443
545 3300049583 Ga0501067_0023056 Ga0501067_0023056_1791_3122 443
546 3300049585 Ga0501069_0081322 Ga0501069_0081322_222_1553 443
547 3300053077 Ga0495601_0000340 Ga0495601_0000340_10553_11890 443
548 3300053077 Ga0495601_0020585 Ga0495601_0020585_376_1707 443
549 3300053077 Ga0495601_0040461 Ga0495601_0040461_1109_2560 443
550 3300053078 Ga0495612_0051693 Ga0495612_0051693_203_1534 443
551 3300053084 Ga0495595_0057566 Ga0495595_0057566_248_1699 443
552 3300053085 Ga0495619_0001752 Ga0495619_0001752_12563_13900 443
553 3300061719 Ga0466962_0019961 Ga0466962_0019961_328_1713 443

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

24

169

0.95

PF01761

DHQ_synthase

3-dehydroquinate synthase

218

329

0.95

PF24621

330

452

0.94

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

172

323

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9148 132 442
6hqv-assembly1.cif.gz_A pentafunctional arom complex from chaetomium thermophilum 0.8987 131 431
1xai-assembly2.cif.gz_B crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, nad+ and carbaphosphonate 0.8973 132 441
6hqv-assembly1.cif.gz_B pentafunctional arom complex from chaetomium thermophilum 0.8864 131 431
1nvd-assembly1.cif.gz_A crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate 0.8858 131 438
ID Description Score Start End Superfamily
af_A0A0R0HLZ4_60_246_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9309 132 282 3.40.50.1970
5hvnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.916 132 282 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.912 132 282 3.40.50.1970
3qbdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9089 132 282 3.40.50.1970
af_P08566_1_177_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 132 282 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A1Y1MIS5-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9868 182 276 GO:0003856
GO:0009073
AF-A0A7S1KI02-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9791 190 300 GO:0003856
GO:0009073
GO:0016020
AF-A0A3N4IYI6-F1-model_v4 Dehydroquinate synthase-like protein 0.9714 184 302 GO:0003856
GO:0009073
AF-A0A2X1PI66-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9578 200 299 GO:0003856
GO:0009073
AF-A0A3B9DMR7-F1-model_v4 3-dehydroquinate synthase 0.956 132 299 GO:0003856
GO:0009073

Feature Viewer

pLDDT pTM Quality
91.76 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map