F462851

General Info

Members Datasets Scaffolds Average Seq Length
553 197 1072 483

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000937|Ga0111539_1000093711
Length 506
Sequence MARHPRQGWRYHWALSLGDDDMARGRTGIEHLLRRAGFGASPADLDSFDGMSVSDVLEYLLDFEKQDDDVDSKIGNPSYVSVLNRAGGFQPNTNIEDARQRWLFRMVHSRRPLQEKMALFWHNHFATAYSKLAGTFGAVIGTKLLANVSGQLPGPQGQLQTLREMSLGSFTELLIEMAKDPAMLVWLDGRVNTRQRPQENFGREIMELFTFGVGNYTEQDVYAAARVFTGWNLRFIGGRDDPNNYYEFLYVPANHDPTAKEFTFPIYSNGSHTIPARPAADGMQDGIDFMTALARHPNTARRLARKMWNFFVSEVVPPDDDTIAGAASVYLQNGTSIRSMVHYMLRSREFQNPGNWHSRYSWPVEYVVRAIKELGWTGFSIDTARASLIPMGQVLFEPPDVAGWELGQGWFSTGAMLSRMNFAGTLAFNQRFNLARDAAGARQSPDALLEYMLDRLSPARYDSEPMDYLRDFLQMGGAWSGTDAQLQSKGNGLARLIIGSSEYQFV

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 0.36
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 6.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000937 3300009094 Bacteria 38215
2 JGI25406J46586_10000210 3300003203 Bacteria 25956
3 JGI25406J46586_10004904 3300003203 Bacteria 6213
4 Ga0065704_10077681 3300005289 Bacteria 4656
5 Ga0065712_10000186 3300005290 Bacteria 25657
6 Ga0065712_10068263 3300005290 Bacteria 12351
7 Ga0065715_10000669 3300005293 Bacteria 11067
8 Ga0065715_10010806 3300005293 Bacteria 3827
9 Ga0065715_10097825 3300005293 Unclassified 3644
10 Ga0065715_10122541 3300005293 Bacteria 2202
11 Ga0065707_10003273 3300005295 Bacteria 3877
12 Ga0065707_10004318 3300005295 Bacteria 5012
13 Ga0065707_10007250 3300005295 Bacteria 4245
14 Ga0065707_10086375 3300005295 Bacteria 5504
15 Ga0070676_10028691 3300005328 Bacteria 3161
16 Ga0070676_10042253 3300005328 Unclassified 2646
17 Ga0070690_100067412 3300005330 Unclassified 2319
18 Ga0070670_100001086 3300005331 Bacteria 21570
19 Ga0070670_100006412 3300005331 Bacteria 9958
20 Ga0070670_100015593 3300005331 Bacteria 6526
21 Ga0070670_100213763 3300005331 Unclassified 1677
22 Ga0070677_10002554 3300005333 Bacteria 5824
23 Ga0070677_10002950 3300005333 Bacteria 5469
24 Ga0070677_10021717 3300005333 Bacteria 2359
25 Ga0068869_100000811 3300005334 Bacteria 17848
26 Ga0068869_100006483 3300005334 Bacteria 7426
27 Ga0068869_100101751 3300005334 Bacteria 2174
28 Ga0070666_10002006 3300005335 Bacteria 12390
29 Ga0070666_10020092 3300005335 Bacteria 4315
30 Ga0068868_100062929 3300005338 Bacteria 2943
31 Ga0070689_100014190 3300005340 Bacteria 5782
32 Ga0070689_100039758 3300005340 Unclassified 3603
33 Ga0070689_100090090 3300005340 Bacteria 2416
34 Ga0070691_10021284 3300005341 Bacteria 3000
35 Ga0070661_100058322 3300005344 Bacteria 2829
36 Ga0070692_10014626 3300005345 Bacteria 3691
37 Ga0070692_10047623 3300005345 Bacteria 2219
38 Ga0070668_100081119 3300005347 Bacteria 2543
39 Ga0070668_100107646 3300005347 Bacteria 2216
40 Ga0070669_100000758 3300005353 Bacteria 23487
41 Ga0070669_100014586 3300005353 Bacteria 5592
42 Ga0070669_100027857 3300005353 Bacteria 4067
43 Ga0070675_100001112 3300005354 Bacteria 19381
44 Ga0070675_100004144 3300005354 Bacteria 11013
45 Ga0070675_100006236 3300005354 Bacteria 9147
46 Ga0070675_100015887 3300005354 Bacteria 5962
47 Ga0070675_100035681 3300005354 Bacteria 4042
48 Ga0070675_100058950 3300005354 Bacteria 3166
49 Ga0070675_100135383 3300005354 Bacteria 2102
50 Ga0070675_100153126 3300005354 Bacteria 1978
51 Ga0070671_100011193 3300005355 Bacteria 7205
52 Ga0070671_100060607 3300005355 Unclassified 3150
53 Ga0070674_100032956 3300005356 Bacteria 3444
54 Ga0070673_100002666 3300005364 Bacteria 10920
55 Ga0070673_100007093 3300005364 Bacteria 7359
56 Ga0070673_100017461 3300005364 Bacteria 5104
57 Ga0070673_100050504 3300005364 Bacteria 3252
58 Ga0070673_100087978 3300005364 Bacteria 2533
59 Ga0070673_100129003 3300005364 Bacteria 2119
60 Ga0070688_100108760 3300005365 Bacteria 1840
61 Ga0070659_100017586 3300005366 Bacteria 5386
62 Ga0070667_100022051 3300005367 Bacteria 5284
63 Ga0070713_100062539 3300005436 Unclassified 3118
64 Ga0070701_10001732 3300005438 Bacteria 8208
65 Ga0070701_10003490 3300005438 Bacteria 6231
66 Ga0070705_100000746 3300005440 Bacteria 18450
67 Ga0070705_100069416 3300005440 Bacteria 2124
68 Ga0070700_100015147 3300005441 Bacteria 4366
69 Ga0070694_100000370 3300005444 Bacteria 24146
70 Ga0070694_100003293 3300005444 Bacteria 9658
71 Ga0070663_100069713 3300005455 Bacteria 2555
72 Ga0070678_100043771 3300005456 Bacteria 3192
73 Ga0070662_100073909 3300005457 Unclassified 2520
74 Ga0070681_10023027 3300005458 Bacteria 6263
75 Ga0070681_10041975 3300005458 Bacteria 4585
76 Ga0068867_100000762 3300005459 Bacteria 21694
77 Ga0068867_100022442 3300005459 Bacteria 4513
78 Ga0070685_10009919 3300005466 Bacteria 4939
79 Ga0070707_100079404 3300005468 Bacteria 3167
80 Ga0070707_100088899 3300005468 Bacteria 2988
81 Ga0070707_100164685 3300005468 Bacteria 2161
82 Ga0070698_100002906 3300005471 Bacteria 18858
83 Ga0070698_100096965 3300005471 Bacteria 2924
84 Ga0070699_100022256 3300005518 Bacteria 5462
85 Ga0070699_100034487 3300005518 Bacteria 4374
86 Ga0070699_100134501 3300005518 Bacteria 2180
87 Ga0070699_100191947 3300005518 Bacteria 1815
88 Ga0070697_100039810 3300005536 Bacteria 3801
89 Ga0070697_100048826 3300005536 Bacteria 3433
90 Ga0070672_100026973 3300005543 Bacteria 4282
91 Ga0070672_100034734 3300005543 Bacteria 3828
92 Ga0070672_100038720 3300005543 Bacteria 3646
93 Ga0070672_100042190 3300005543 Bacteria 3512
94 Ga0070672_100050434 3300005543 Bacteria 3241
95 Ga0070672_100056703 3300005543 Bacteria 3073
96 Ga0070672_100103096 3300005543 Bacteria 2317
97 Ga0070672_100112645 3300005543 Unclassified 2220
98 Ga0070672_100124655 3300005543 Bacteria 2112
99 Ga0070686_100027463 3300005544 Bacteria 3445
100 Ga0070686_100092066 3300005544 Bacteria 2030
101 Ga0070686_100140266 3300005544 Bacteria 1682
102 Ga0070695_100000707 3300005545 Bacteria 17815
103 Ga0070695_100066234 3300005545 Bacteria 2354
104 Ga0070696_100015690 3300005546 Bacteria 5091
105 Ga0070665_100055271 3300005548 Bacteria 3982
106 Ga0070665_100170016 3300005548 Bacteria 2181
107 Ga0070704_100000238 3300005549 Bacteria 23487
108 Ga0070704_100023879 3300005549 Bacteria 4003
109 Ga0070704_100044529 3300005549 Bacteria 3084
110 Ga0070664_100001497 3300005564 Bacteria 18610
111 Ga0070664_100012437 3300005564 Bacteria 6917
112 Ga0068857_100025835 3300005577 Bacteria 5171
113 Ga0068857_100054321 3300005577 Bacteria 3554
114 Ga0068857_100066961 3300005577 Unclassified 3196
115 Ga0070702_100043784 3300005615 Bacteria 2524
116 Ga0068852_100090604 3300005616 Bacteria 2735
117 Ga0068859_100005950 3300005617 Bacteria 12381
118 Ga0068859_100010057 3300005617 Bacteria 9539
119 Ga0068859_100011529 3300005617 Bacteria 8887
120 Ga0068859_100014555 3300005617 Bacteria 7902
121 Ga0068859_100038112 3300005617 Bacteria 4823
122 Ga0068859_100056184 3300005617 Bacteria 3960
123 Ga0068859_100078545 3300005617 Unclassified 3341
124 Ga0068859_100089599 3300005617 Bacteria 3126
125 Ga0068859_100114500 3300005617 Unclassified 2761
126 Ga0068864_100011051 3300005618 Bacteria 7462
127 Ga0068864_100019242 3300005618 Bacteria 5708
128 Ga0068864_100020347 3300005618 Bacteria 5552
129 Ga0068864_100089865 3300005618 Bacteria 2707
130 Ga0068864_100121254 3300005618 Unclassified 2338
131 Ga0068864_100123799 3300005618 Bacteria 2315
132 Ga0068866_10006836 3300005718 Bacteria 4763
133 Ga0068866_10061865 3300005718 Bacteria 1946
134 Ga0068861_100003178 3300005719 Bacteria 10870
135 Ga0068861_100013921 3300005719 Bacteria 5639
136 Ga0068861_100016505 3300005719 Bacteria 5226
137 Ga0068861_100041123 3300005719 Bacteria 3461
138 Ga0068851_10002988 3300005834 Bacteria 7471
139 Ga0068851_10009267 3300005834 Unclassified 4569
140 Ga0068870_10000599 3300005840 Bacteria 13680
141 Ga0068870_10001658 3300005840 Bacteria 9102
142 Ga0068870_10019436 3300005840 Bacteria 3295
143 Ga0068863_100030127 3300005841 Bacteria 5183
144 Ga0068858_100003071 3300005842 Bacteria 16720
145 Ga0068858_100018402 3300005842 Bacteria 6540
146 Ga0068858_100020258 3300005842 Bacteria 6219
147 Ga0068858_100051737 3300005842 Bacteria 3801
148 Ga0068860_100014549 3300005843 Bacteria 7700
149 Ga0068862_100001226 3300005844 Bacteria 24198
150 Ga0068862_100008582 3300005844 Bacteria 8455
151 Ga0081455_10091837 3300005937 Bacteria 2458
152 Ga0081538_10061888 3300005981 Bacteria 2139
153 Ga0081539_10000093 3300005985 Bacteria 207314
154 Ga0081539_10000535 3300005985 Bacteria 78890
155 Ga0081539_10004156 3300005985 Bacteria 16440
156 Ga0081539_10009987 3300005985 Bacteria 7821
157 Ga0075364_10054442 3300006051 Bacteria 2617
158 Ga0097621_100007227 3300006237 Bacteria 7927
159 Ga0097621_100010069 3300006237 Bacteria 6895
160 Ga0097621_100214061 3300006237 Bacteria 1677
161 Ga0068871_100005322 3300006358 Bacteria 9018
162 Ga0068871_100195824 3300006358 Bacteria 1743
163 Ga0075428_100000007 3300006844 Bacteria 273226
164 Ga0075428_100000957 3300006844 Bacteria 30618
165 Ga0075428_100001298 3300006844 Bacteria 26510
166 Ga0075428_100011331 3300006844 Bacteria 9921
167 Ga0075428_100012250 3300006844 Bacteria 9535
168 Ga0075428_100019604 3300006844 Bacteria 7484
169 Ga0075428_100021839 3300006844 Bacteria 7087
170 Ga0075428_100022555 3300006844 Bacteria 6969
171 Ga0075428_100023976 3300006844 Bacteria 6752
172 Ga0075428_100103622 3300006844 Unclassified 3103
173 Ga0075428_100248972 3300006844 Unclassified 1915
174 Ga0075430_100000407 3300006846 Bacteria 31945
175 Ga0075430_100007196 3300006846 Bacteria 9387
176 Ga0075430_100010887 3300006846 Bacteria 7705
177 Ga0075430_100020797 3300006846 Bacteria 5579
178 Ga0075430_100038550 3300006846 Bacteria 4047
179 Ga0075430_100087305 3300006846 Bacteria 2610
180 Ga0075431_100000321 3300006847 Bacteria 37773
181 Ga0075431_100011422 3300006847 Bacteria 8949
182 Ga0075431_100029469 3300006847 Bacteria 5650
183 Ga0075431_100048648 3300006847 Bacteria 4373
184 Ga0075431_100053571 3300006847 Bacteria 4159
185 Ga0075433_10000146 3300006852 Bacteria 37411
186 Ga0075433_10000207 3300006852 Bacteria 33084
187 Ga0075433_10000308 3300006852 Bacteria 29595
188 Ga0075434_100000040 3300006871 Bacteria 59699
189 Ga0075434_100001945 3300006871 Bacteria 17918
190 Ga0075434_100004405 3300006871 Bacteria 12683
191 Ga0075434_100033804 3300006871 Bacteria 5048
192 Ga0075434_100136567 3300006871 Unclassified 2471
193 Ga0075429_100001231 3300006880 Bacteria 20763
194 Ga0075429_100006956 3300006880 Bacteria 9830
195 Ga0075429_100007708 3300006880 Bacteria 9345
196 Ga0075429_100018794 3300006880 Bacteria 5986
197 Ga0075429_100026208 3300006880 Bacteria 5060
198 Ga0075429_100082935 3300006880 Bacteria 2795
199 Ga0068865_100049600 3300006881 Bacteria 2895
200 Ga0068865_100091620 3300006881 Unclassified 2206
201 Ga0068865_100130551 3300006881 Bacteria 1882
202 Ga0097620_100005951 3300006931 Bacteria 12381
203 Ga0097620_100010056 3300006931 Bacteria 9539
204 Ga0097620_100011529 3300006931 Bacteria 8887
205 Ga0097620_100014555 3300006931 Bacteria 7902
206 Ga0097620_100038111 3300006931 Bacteria 4823
207 Ga0097620_100056182 3300006931 Bacteria 3960
208 Ga0097620_100078545 3300006931 Unclassified 3341
209 Ga0097620_100089597 3300006931 Bacteria 3126
210 Ga0097620_100114502 3300006931 Unclassified 2761
211 Ga0075435_100034185 3300007076 Bacteria 4025
212 Ga0075435_100088686 3300007076 Unclassified 2550
213 Ga0105240_10074747 3300009093 Bacteria 4181
214 Ga0111539_10000009 3300009094 Bacteria 375223
215 Ga0111539_10000161 3300009094 Bacteria 76584
216 Ga0111539_10000845 3300009094 Bacteria 39914
217 Ga0111539_10003037 3300009094 Bacteria 22251
218 Ga0111539_10003280 3300009094 Bacteria 21396
219 Ga0111539_10004328 3300009094 Bacteria 18581
220 Ga0111539_10022275 3300009094 Bacteria 7788
221 Ga0111539_10032955 3300009094 Bacteria 6291
222 Ga0111539_10035237 3300009094 Bacteria 6061
223 Ga0111539_10047415 3300009094 Bacteria 5134
224 Ga0111539_10137874 3300009094 Bacteria 2857
225 Ga0111539_10297144 3300009094 Bacteria 1879
226 Ga0111539_10405190 3300009094 Bacteria 1588
227 Ga0105245_10028108 3300009098 Unclassified 4957
228 Ga0105247_10012311 3300009101 Bacteria 5138
229 Ga0105247_10028373 3300009101 Bacteria 3386
230 Ga0114129_10000304 3300009147 Bacteria 57173
231 Ga0114129_10000428 3300009147 Bacteria 49983
232 Ga0114129_10000866 3300009147 Bacteria 39349
233 Ga0114129_10001813 3300009147 Bacteria 29131
234 Ga0114129_10002373 3300009147 Bacteria 26153
235 Ga0114129_10005573 3300009147 Bacteria 17803
236 Ga0114129_10007008 3300009147 Bacteria 16047
237 Ga0114129_10017707 3300009147 Bacteria 10145
238 Ga0114129_10035159 3300009147 Bacteria 7080
239 Ga0114129_10063692 3300009147 Bacteria 5147
240 Ga0114129_10129734 3300009147 Bacteria 3464
241 Ga0114129_10274628 3300009147 Bacteria 2254
242 Ga0105248_10009548 3300009177 Bacteria 10677
243 Ga0105248_10015459 3300009177 Bacteria 8412
244 Ga0105248_10027899 3300009177 Bacteria 6286
245 Ga0105248_10090271 3300009177 Bacteria 3450
246 Ga0105248_10095332 3300009177 Bacteria 3350
247 Ga0105248_10105903 3300009177 Bacteria 3171
248 Ga0105238_10008110 3300009551 Bacteria 10504
249 Ga0105238_10015392 3300009551 Bacteria 7742
250 Ga0105249_10001435 3300009553 Bacteria 20875
251 Ga0105249_10006162 3300009553 Bacteria 10405
252 Ga0105249_10059121 3300009553 Bacteria 3515
253 Ga0163162_10036526 3300013306 Bacteria 4898
254 Ga0163162_10041502 3300013306 Bacteria 4604
255 Ga0163162_10158050 3300013306 Unclassified 2388
256 Ga0157375_10003148 3300013308 Bacteria 14322
257 Ga0157375_10013088 3300013308 Bacteria 7375
258 Ga0157375_10035940 3300013308 Bacteria 4733
259 Ga0157375_10089221 3300013308 Bacteria 3139
260 Ga0157375_10278005 3300013308 Bacteria 1837
261 Ga0157380_10005161 3300014326 Bacteria 9129
262 Ga0157380_10012921 3300014326 Bacteria 6071
263 Ga0157380_10033631 3300014326 Bacteria 3949
264 Ga0157380_10045186 3300014326 Bacteria 3455
265 Ga0157380_10058197 3300014326 Bacteria 3081
266 Ga0157380_10096634 3300014326 Bacteria 2449
267 Ga0157380_10143124 3300014326 Bacteria 2057
268 Ga0157377_10005772 3300014745 Bacteria 5843
269 Ga0157377_10009001 3300014745 Bacteria 4887
270 Ga0157377_10039018 3300014745 Bacteria 2625
271 Ga0157377_10044621 3300014745 Bacteria 2472
272 Ga0157377_10049157 3300014745 Bacteria 2370
273 Ga0157379_10006675 3300014968 Bacteria 9965
274 Ga0157379_10008568 3300014968 Bacteria 8897
275 Ga0157379_10147255 3300014968 Bacteria 2123
276 Ga0157376_10034290 3300014969 Bacteria 4097
277 Ga0157376_10087841 3300014969 Bacteria 2684
278 Ga0157376_10133535 3300014969 Bacteria 2218
279 Ga0163161_10010796 3300017792 Bacteria 6329
280 Ga0213875_10000130 3300021388 Bacteria 83089
281 Ga0207697_10000242 3300025315 Bacteria 29834
282 Ga0207656_10000505 3300025321 Bacteria 12881
283 Ga0207682_10003009 3300025893 Bacteria 7393
284 Ga0207682_10004916 3300025893 Bacteria 5500
285 Ga0207710_10018841 3300025900 Bacteria 2938
286 Ga0207710_10035449 3300025900 Bacteria 2195
287 Ga0207688_10000057 3300025901 Bacteria 40457
288 Ga0207680_10017862 3300025903 Bacteria 3755
289 Ga0207645_10003875 3300025907 Bacteria 11193
290 Ga0207645_10004538 3300025907 Bacteria 10256
291 Ga0207643_10000936 3300025908 Bacteria 17496
292 Ga0207643_10003451 3300025908 Bacteria 8503
293 Ga0207643_10015468 3300025908 Bacteria 4153
294 Ga0207707_10031898 3300025912 Bacteria 4612
295 Ga0207707_10085603 3300025912 Bacteria 2754
296 Ga0207707_10099834 3300025912 Bacteria 2537
297 Ga0207662_10004530 3300025918 Bacteria 7321
298 Ga0207662_10086313 3300025918 Bacteria 1923
299 Ga0207646_10156975 3300025922 Bacteria 2052
300 Ga0207681_10000941 3300025923 Bacteria 18967
301 Ga0207681_10005625 3300025923 Bacteria 7690
302 Ga0207650_10014535 3300025925 Bacteria 5469
303 Ga0207650_10018213 3300025925 Bacteria 4926
304 Ga0207650_10021561 3300025925 Bacteria 4552
305 Ga0207650_10196354 3300025925 Bacteria 1614
306 Ga0207659_10000815 3300025926 Bacteria 18445
307 Ga0207659_10005819 3300025926 Bacteria 7513
308 Ga0207659_10017242 3300025926 Bacteria 4714
309 Ga0207659_10018691 3300025926 Bacteria 4547
310 Ga0207659_10023104 3300025926 Bacteria 4147
311 Ga0207659_10025813 3300025926 Bacteria 3955
312 Ga0207644_10019859 3300025931 Bacteria 4562
313 Ga0207644_10021611 3300025931 Bacteria 4387
314 Ga0207644_10045482 3300025931 Bacteria 3123
315 Ga0207644_10151118 3300025931 Bacteria 1797
316 Ga0207690_10094497 3300025932 Bacteria 2121
317 Ga0207706_10009887 3300025933 Bacteria 8748
318 Ga0207706_10050429 3300025933 Bacteria 3677
319 Ga0207670_10002105 3300025936 Bacteria 10403
320 Ga0207669_10001240 3300025937 Bacteria 10861
321 Ga0207669_10023188 3300025937 Bacteria 3311
322 Ga0207669_10119118 3300025937 Bacteria 1788
323 Ga0207704_10126489 3300025938 Bacteria 1761
324 Ga0207691_10014037 3300025940 Bacteria 7643
325 Ga0207691_10028066 3300025940 Bacteria 5272
326 Ga0207691_10060513 3300025940 Unclassified 3441
327 Ga0207711_10212834 3300025941 Bacteria 1766
328 Ga0207689_10001876 3300025942 Bacteria 19884
329 Ga0207689_10004628 3300025942 Bacteria 12450
330 Ga0207689_10052717 3300025942 Bacteria 3352
331 Ga0207689_10066517 3300025942 Bacteria 2963
332 Ga0207689_10105169 3300025942 Bacteria 2319
333 Ga0207689_10140033 3300025942 Bacteria 1993
334 Ga0207679_10033396 3300025945 Bacteria 3620
335 Ga0207679_10149883 3300025945 Bacteria 1897
336 Ga0207651_10002829 3300025960 Bacteria 8354
337 Ga0207651_10040517 3300025960 Bacteria 3082
338 Ga0207651_10040733 3300025960 Bacteria 3077
339 Ga0207651_10042789 3300025960 Bacteria 3017
340 Ga0207651_10046878 3300025960 Bacteria 2910
341 Ga0207651_10048016 3300025960 Bacteria 2882
342 Ga0207651_10057104 3300025960 Unclassified 2690
343 Ga0207651_10057829 3300025960 Bacteria 2677
344 Ga0207651_10150941 3300025960 Bacteria 1808
345 Ga0207712_10017327 3300025961 Unclassified 4677
346 Ga0207668_10029695 3300025972 Bacteria 3586
347 Ga0207640_10190515 3300025981 Bacteria 1546
348 Ga0207703_10008660 3300026035 Bacteria 8028
349 Ga0207703_10043182 3300026035 Bacteria 3617
350 Ga0207703_10044910 3300026035 Unclassified 3552
351 Ga0207703_10180288 3300026035 Bacteria 1864
352 Ga0207678_10011245 3300026067 Bacteria 7858
353 Ga0207678_10052509 3300026067 Bacteria 3516
354 Ga0207678_10143937 3300026067 Bacteria 2035
355 Ga0207708_10013205 3300026075 Bacteria 6166
356 Ga0207708_10072710 3300026075 Unclassified 2635
357 Ga0207641_10035637 3300026088 Bacteria 4147
358 Ga0207641_10073489 3300026088 Bacteria 2947
359 Ga0207648_10000163 3300026089 Bacteria 68352
360 Ga0207648_10001300 3300026089 Bacteria 27821
361 Ga0207648_10003862 3300026089 Bacteria 15645
362 Ga0207648_10176748 3300026089 Bacteria 1888
363 Ga0207676_10012948 3300026095 Bacteria 5991
364 Ga0207676_10026635 3300026095 Bacteria 4300
365 Ga0207674_10007078 3300026116 Bacteria 13107
366 Ga0207674_10131721 3300026116 Bacteria 2463
367 Ga0207675_100004330 3300026118 Bacteria 13716
368 Ga0207675_100018026 3300026118 Bacteria 6584
369 Ga0207675_100022573 3300026118 Bacteria 5859
370 Ga0207683_10027675 3300026121 Bacteria 4898
371 Ga0207683_10096313 3300026121 Bacteria 2639
372 Ga0207683_10238482 3300026121 Bacteria 1659
373 Ga0207698_10118874 3300026142 Bacteria 2233
374 Ga0209974_10009930 3300027876 Unclassified 3219
375 Ga0207428_10000022 3300027907 Bacteria 273333
376 Ga0207428_10000713 3300027907 Bacteria 38412
377 Ga0207428_10001776 3300027907 Bacteria 22083
378 Ga0207428_10002840 3300027907 Bacteria 17184
379 Ga0207428_10003028 3300027907 Bacteria 16548
380 Ga0207428_10004545 3300027907 Bacteria 13154
381 Ga0207428_10006388 3300027907 Bacteria 10892
382 Ga0207428_10014861 3300027907 Bacteria 6743
383 Ga0207428_10033003 3300027907 Unclassified 4255
384 Ga0207428_10036243 3300027907 Bacteria 4025
385 Ga0268266_10034699 3300028379 Bacteria 4291
386 Ga0268265_10000263 3300028380 Bacteria 59820
387 Ga0268264_10002446 3300028381 Bacteria 16318
388 Ga0268264_10008880 3300028381 Bacteria 8333
389 Ga0268264_10010430 3300028381 Bacteria 7680
390 Ga0268264_10023800 3300028381 Bacteria 4996
391 Ga0307413_10050619 3300031824 Bacteria 2497
392 Ga0307413_10079305 3300031824 Bacteria 2098
393 Ga0307410_10020005 3300031852 Bacteria 4085
394 Ga0307410_10106282 3300031852 Bacteria 2022
395 Ga0307406_10048671 3300031901 Bacteria 2679
396 Ga0307407_10045917 3300031903 Bacteria 2471
397 Ga0307409_100026746 3300031995 Bacteria 4075
398 Ga0307416_100033840 3300032002 Bacteria 3880
399 Ga0307416_100059844 3300032002 Unclassified 3098
400 Ga0307416_100081685 3300032002 Unclassified 2734
401 Ga0307416_100107712 3300032002 Bacteria 2446
402 Ga0307416_100142034 3300032002 Bacteria 2184
403 Ga0307416_100161659 3300032002 Bacteria 2071
404 Ga0307411_10023307 3300032005 Bacteria 3664
405 Ga0307411_10070458 3300032005 Bacteria 2366
406 Ga0373955_0040165 3300035172 Bacteria 2501
407 Ga0373937_0005906 3300036401 Bacteria 10530
408 Ga0373937_0026709 3300036401 Bacteria 5216
409 Ga0395905_0028573 3300037471 Bacteria 5257
410 Ga0436364_0316723 3300037853 Bacteria 79497
411 Ga0439435_0006529 3300042436 Bacteria 2624
412 Ga0451576_0057283 3300045051 Unclassified 4073
413 Ga0451576_0088758 3300045051 Bacteria 3216
414 Ga0451576_0141981 3300045051 Bacteria 2504
415 Ga0495592_0032340 3300046454 Bacteria 3948
416 Ga0495580_0016654 3300046472 Bacteria 5516
417 Ga0495584_0027878 3300046491 Bacteria 2861
418 Ga0495584_0028453 3300046491 Bacteria 2832
419 Ga0495608_0005795 3300046511 Bacteria 8803
420 Ga0495642_0005430 3300046528 Bacteria 4897
421 Ga0495642_0024043 3300046528 Bacteria 2409
422 Ga0495652_0081346 3300046529 Bacteria 2672
423 Ga0495621_0001135 3300046539 Bacteria 6882
424 Ga0495645_0001717 3300046543 Bacteria 14876
425 Ga0495645_0107458 3300046543 Bacteria 1977
426 Ga0495667_0013753 3300046559 Bacteria 5467
427 Ga0495588_0005315 3300046674 Bacteria 5728
428 Ga0495658_0012298 3300046683 Bacteria 4329
429 Ga0495613_0004097 3300046689 Bacteria 10894
430 Ga0495604_0051815 3300047317 Unclassified 3180
431 Ga0495636_0013991 3300047318 Bacteria 3188
432 Ga0495674_0054063 3300047319 Bacteria 3528
433 Ga0495684_0001402 3300047471 Bacteria 19304
434 Ga0496109_0064619 3300048912 Bacteria 3349
435 Ga0496114_0066190 3300048917 Bacteria 3029
436 Ga0501036_0117224 3300049572 Bacteria 2249
437 Ga0501038_0163386 3300049574 Bacteria 1808
438 Ga0501039_0011752 3300049575 Bacteria 6668
439 Ga0501039_0274916 3300049575 Bacteria 1324
440 Ga0501040_0029096 3300049576 Bacteria 3728
441 Ga0501042_0041594 3300049578 Bacteria 3269
442 Ga0501071_0055324 3300049587 Unclassified 2864
443 Ga0501072_0033099 3300049588 Bacteria 4050
444 Ga0501072_0039508 3300049588 Bacteria 3705
445 Ga0501075_0012148 3300049591 Bacteria 6114
446 Ga0501075_0036709 3300049591 Bacteria 3659
447 Ga0501075_0039221 3300049591 Bacteria 3545
448 Ga0501075_0040020 3300049591 Bacteria 3509
449 Ga0501076_0025386 3300049592 Bacteria 4585
450 Ga0501076_0052895 3300049592 Bacteria 3218
451 Ga0501076_0055239 3300049592 Bacteria 3149
452 Ga0501077_0069150 3300049593 Bacteria 2238
453 Ga0501079_0016594 3300049741 Bacteria 5624
454 Ga0501079_0060212 3300049741 Bacteria 2929
455 Ga0501081_0026136 3300049743 Bacteria 3933
456 Ga0501081_0040249 3300049743 Bacteria 3200
457 Ga0501081_0065368 3300049743 Bacteria 2528
458 Ga0501045_0041543 3300049824 Bacteria 3346
459 Ga0501045_0139476 3300049824 Bacteria 1803
460 nmdc:mga06z11_28856_c1 3300050494 Bacteria 2666
461 nmdc:mga05p37_14156_c1 3300050507 Bacteria 9574
462 nmdc:mga05p37_149202_c1 3300050507 Bacteria 2090
463 nmdc:mga05p37_17885_c1 3300050507 Bacteria 8556
464 nmdc:mga05p37_19580_c1 3300050507 Bacteria 8186
465 nmdc:mga05p37_226481_c1 3300050507 Bacteria 2254
466 nmdc:mga05p37_24191_c1 3300050507 Bacteria 7380
467 nmdc:mga05p37_2419_c1 3300050507 Bacteria 21703
468 nmdc:mga05p37_266_c1 3300050507 Bacteria 54109
469 nmdc:mga05p37_32183_c1 3300050507 Bacteria 6412
470 nmdc:mga05p37_32576_c1 3300050507 Bacteria 6374
471 nmdc:mga05p37_52831_c1 3300050507 Bacteria 4997
472 nmdc:mga05p37_57962_c1 3300050507 Bacteria 4770
473 nmdc:mga05p37_73485_c1 3300050507 Bacteria 4208
474 nmdc:mga05p37_82604_c1 3300050507 Bacteria 3959
475 nmdc:mga05p37_9704_c1 3300050507 Bacteria 11411
476 nmdc:mga09592_12494_c1 3300050508 Bacteria 6919
477 nmdc:mga09592_22860_c1 3300050508 Bacteria 5159
478 nmdc:mga09592_43605_c1 3300050508 Bacteria 3774
479 nmdc:mga09592_50013_c1 3300050508 Bacteria 3525
480 nmdc:mga09592_5444_c1 3300050508 Bacteria 10352
481 nmdc:mga09592_68806_c1 3300050508 Bacteria 3003
482 nmdc:mga09592_729_c1 3300050508 Bacteria 25319
483 nmdc:mga0qj67_116208_c1 3300050509 Bacteria 2162
484 nmdc:mga0qj67_3065_c1 3300050509 Bacteria 12010
485 nmdc:mga0qj67_48247_c1 3300050509 Bacteria 3364
486 nmdc:mga06r32_101423_c1 3300050510 Bacteria 2825
487 nmdc:mga06r32_208051_c1 3300050510 Bacteria 1945
488 nmdc:mga06r32_3869_c1 3300050510 Bacteria 13401
489 nmdc:mga06r32_44093_c1 3300050510 Bacteria 4246
490 nmdc:mga06r32_44705_c1 3300050510 Bacteria 4218
491 nmdc:mga06r32_45879_c1 3300050510 Bacteria 4168
492 nmdc:mga06r32_73145_c1 3300050510 Bacteria 3320
493 nmdc:mga08y16_1170_c1 3300050511 Bacteria 25854
494 nmdc:mga08y16_1808_c1 3300050511 Bacteria 21713
495 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
496 nmdc:mga08y16_229271_c1 3300050511 Bacteria 1921
497 nmdc:mga08y16_257086_c1 3300050511 Bacteria 1804
498 nmdc:mga08y16_281856_c1 3300050511 Bacteria 1714
499 nmdc:mga08y16_28412_c1 3300050511 Bacteria 5896
500 nmdc:mga08y16_3129_c1 3300050511 Bacteria 17136
501 nmdc:mga08y16_42079_c1 3300050511 Bacteria 4785
502 nmdc:mga08y16_42117_c1 3300050511 Bacteria 4782
503 nmdc:mga08y16_45591_c1 3300050511 Bacteria 4594
504 nmdc:mga08y16_743_c1 3300050511 Bacteria 31040
505 nmdc:mga08y16_77471_c1 3300050511 Bacteria 3466
506 nmdc:mga08y16_98257_c1 3300050511 Bacteria 3049
507 nmdc:mga0n895_17725_c1 3300050512 Bacteria 6571
508 nmdc:mga0n895_18038_c1 3300050512 Bacteria 6524
509 nmdc:mga0n895_275_c1 3300050512 Bacteria 33765
510 nmdc:mga0n895_42486_c1 3300050512 Bacteria 4422
511 nmdc:mga0rr50_38555_c1 3300050513 Unclassified 3459
512 nmdc:mga0rr50_39282_c1 3300050513 Bacteria 3431
513 nmdc:mga0rr50_40003_c1 3300050513 Bacteria 3405
514 nmdc:mga0a205_182665_c1 3300050515 Bacteria 1991
515 nmdc:mga0a205_569_c1 3300050515 Bacteria 29271
516 nmdc:mga0a205_675_c1 3300050515 Bacteria 27237
517 nmdc:mga0a205_9378_c1 3300050515 Bacteria 8944
518 Ga0495601_0112378 3300053077 Unclassified 1765
519 Ga0495619_0004341 3300053085 Bacteria 9042
520 Ga0495619_0069448 3300053085 Unclassified 2355
521 Ga0500568_0010172 3300053139 Bacteria 4421
522 Ga0501084_0086032 3300054114 Bacteria 2639
523 Ga0590071_000190 3300059421 Bacteria 17901
524 Ga0590071_000303 3300059421 Bacteria 14415
525 Ga0590074_006101 3300059423 Bacteria 2000
526 Ga0590075_001308 3300059424 Bacteria 6249
527 Ga0590075_002100 3300059424 Bacteria 4800
528 Ga0590077_000540 3300059426 Bacteria 10459
529 Ga0590077_001622 3300059426 Bacteria 5160
530 Ga0501082_0011801 3300060353 Bacteria 7511
531 Ga0501082_0139609 3300060353 Bacteria 2103
532 Ga0501082_0143818 3300060353 Bacteria 2070
533 Ga0501082_0235916 3300060353 Bacteria 1592
534 Ga0530510_0002698 3300061734 Bacteria 12207
535 Ga0530510_0002975 3300061734 Bacteria 11621
536 Ga0530510_0005455 3300061734 Bacteria 8803
537 Ga0111539_10000937
538 JGI25406J46586_10000210
539 JGI25406J46586_10004904
540 Ga0065704_10077681
541 Ga0065712_10000186
542 Ga0065712_10068263
543 Ga0065715_10000669
544 Ga0065715_10010806
545 Ga0065715_10097825
546 Ga0065715_10122541
547 Ga0065707_10003273
548 Ga0065707_10004318
549 Ga0065707_10007250
550 Ga0065707_10086375
551 Ga0070676_10028691
552 Ga0070676_10042253
553 Ga0070690_100067412
554 Ga0070670_100001086
555 Ga0070670_100006412
556 Ga0070670_100015593
557 Ga0070670_100213763
558 Ga0070677_10002554
559 Ga0070677_10002950
560 Ga0070677_10021717
561 Ga0068869_100000811
562 Ga0068869_100006483
563 Ga0068869_100101751
564 Ga0070666_10002006
565 Ga0070666_10020092
566 Ga0068868_100062929
567 Ga0070689_100014190
568 Ga0070689_100039758
569 Ga0070689_100090090
570 Ga0070691_10021284
571 Ga0070661_100058322
572 Ga0070692_10014626
573 Ga0070692_10047623
574 Ga0070668_100081119
575 Ga0070668_100107646
576 Ga0070669_100000758
577 Ga0070669_100014586
578 Ga0070669_100027857
579 Ga0070675_100001112
580 Ga0070675_100004144
581 Ga0070675_100006236
582 Ga0070675_100015887
583 Ga0070675_100035681
584 Ga0070675_100058950
585 Ga0070675_100135383
586 Ga0070675_100153126
587 Ga0070671_100011193
588 Ga0070671_100060607
589 Ga0070674_100032956
590 Ga0070673_100002666
591 Ga0070673_100007093
592 Ga0070673_100017461
593 Ga0070673_100050504
594 Ga0070673_100087978
595 Ga0070673_100129003
596 Ga0070688_100108760
597 Ga0070659_100017586
598 Ga0070667_100022051
599 Ga0070713_100062539
600 Ga0070701_10001732
601 Ga0070701_10003490
602 Ga0070705_100000746
603 Ga0070705_100069416
604 Ga0070700_100015147
605 Ga0070694_100000370
606 Ga0070694_100003293
607 Ga0070663_100069713
608 Ga0070678_100043771
609 Ga0070662_100073909
610 Ga0070681_10023027
611 Ga0070681_10041975
612 Ga0068867_100000762
613 Ga0068867_100022442
614 Ga0070685_10009919
615 Ga0070707_100079404
616 Ga0070707_100088899
617 Ga0070707_100164685
618 Ga0070698_100002906
619 Ga0070698_100096965
620 Ga0070699_100022256
621 Ga0070699_100034487
622 Ga0070699_100134501
623 Ga0070699_100191947
624 Ga0070697_100039810
625 Ga0070697_100048826
626 Ga0070672_100026973
627 Ga0070672_100034734
628 Ga0070672_100038720
629 Ga0070672_100042190
630 Ga0070672_100050434
631 Ga0070672_100056703
632 Ga0070672_100103096
633 Ga0070672_100112645
634 Ga0070672_100124655
635 Ga0070686_100027463
636 Ga0070686_100092066
637 Ga0070686_100140266
638 Ga0070695_100000707
639 Ga0070695_100066234
640 Ga0070696_100015690
641 Ga0070665_100055271
642 Ga0070665_100170016
643 Ga0070704_100000238
644 Ga0070704_100023879
645 Ga0070704_100044529
646 Ga0070664_100001497
647 Ga0070664_100012437
648 Ga0068857_100025835
649 Ga0068857_100054321
650 Ga0068857_100066961
651 Ga0070702_100043784
652 Ga0068852_100090604
653 Ga0068859_100005950
654 Ga0068859_100010057
655 Ga0068859_100011529
656 Ga0068859_100014555
657 Ga0068859_100038112
658 Ga0068859_100056184
659 Ga0068859_100078545
660 Ga0068859_100089599
661 Ga0068859_100114500
662 Ga0068864_100011051
663 Ga0068864_100019242
664 Ga0068864_100020347
665 Ga0068864_100089865
666 Ga0068864_100121254
667 Ga0068864_100123799
668 Ga0068866_10006836
669 Ga0068866_10061865
670 Ga0068861_100003178
671 Ga0068861_100013921
672 Ga0068861_100016505
673 Ga0068861_100041123
674 Ga0068851_10002988
675 Ga0068851_10009267
676 Ga0068870_10000599
677 Ga0068870_10001658
678 Ga0068870_10019436
679 Ga0068863_100030127
680 Ga0068858_100003071
681 Ga0068858_100018402
682 Ga0068858_100020258
683 Ga0068858_100051737
684 Ga0068860_100014549
685 Ga0068862_100001226
686 Ga0068862_100008582
687 Ga0081455_10091837
688 Ga0081538_10061888
689 Ga0081539_10000093
690 Ga0081539_10000535
691 Ga0081539_10004156
692 Ga0081539_10009987
693 Ga0075364_10054442
694 Ga0097621_100007227
695 Ga0097621_100010069
696 Ga0097621_100214061
697 Ga0068871_100005322
698 Ga0068871_100195824
699 Ga0075428_100000007
700 Ga0075428_100000957
701 Ga0075428_100001298
702 Ga0075428_100011331
703 Ga0075428_100012250
704 Ga0075428_100019604
705 Ga0075428_100021839
706 Ga0075428_100022555
707 Ga0075428_100023976
708 Ga0075428_100103622
709 Ga0075428_100248972
710 Ga0075430_100000407
711 Ga0075430_100007196
712 Ga0075430_100010887
713 Ga0075430_100020797
714 Ga0075430_100038550
715 Ga0075430_100087305
716 Ga0075431_100000321
717 Ga0075431_100011422
718 Ga0075431_100029469
719 Ga0075431_100048648
720 Ga0075431_100053571
721 Ga0075433_10000146
722 Ga0075433_10000207
723 Ga0075433_10000308
724 Ga0075434_100000040
725 Ga0075434_100001945
726 Ga0075434_100004405
727 Ga0075434_100033804
728 Ga0075434_100136567
729 Ga0075429_100001231
730 Ga0075429_100006956
731 Ga0075429_100007708
732 Ga0075429_100018794
733 Ga0075429_100026208
734 Ga0075429_100082935
735 Ga0068865_100049600
736 Ga0068865_100091620
737 Ga0068865_100130551
738 Ga0097620_100005951
739 Ga0097620_100010056
740 Ga0097620_100011529
741 Ga0097620_100014555
742 Ga0097620_100038111
743 Ga0097620_100056182
744 Ga0097620_100078545
745 Ga0097620_100089597
746 Ga0097620_100114502
747 Ga0075435_100034185
748 Ga0075435_100088686
749 Ga0105240_10074747
750 Ga0111539_10000009
751 Ga0111539_10000161
752 Ga0111539_10000845
753 Ga0111539_10003037
754 Ga0111539_10003280
755 Ga0111539_10004328
756 Ga0111539_10022275
757 Ga0111539_10032955
758 Ga0111539_10035237
759 Ga0111539_10047415
760 Ga0111539_10137874
761 Ga0111539_10297144
762 Ga0111539_10405190
763 Ga0105245_10028108
764 Ga0105247_10012311
765 Ga0105247_10028373
766 Ga0114129_10000304
767 Ga0114129_10000428
768 Ga0114129_10000866
769 Ga0114129_10001813
770 Ga0114129_10002373
771 Ga0114129_10005573
772 Ga0114129_10007008
773 Ga0114129_10017707
774 Ga0114129_10035159
775 Ga0114129_10063692
776 Ga0114129_10129734
777 Ga0114129_10274628
778 Ga0105248_10009548
779 Ga0105248_10015459
780 Ga0105248_10027899
781 Ga0105248_10090271
782 Ga0105248_10095332
783 Ga0105248_10105903
784 Ga0105238_10008110
785 Ga0105238_10015392
786 Ga0105249_10001435
787 Ga0105249_10006162
788 Ga0105249_10059121
789 Ga0163162_10036526
790 Ga0163162_10041502
791 Ga0163162_10158050
792 Ga0157375_10003148
793 Ga0157375_10013088
794 Ga0157375_10035940
795 Ga0157375_10089221
796 Ga0157375_10278005
797 Ga0157380_10005161
798 Ga0157380_10012921
799 Ga0157380_10033631
800 Ga0157380_10045186
801 Ga0157380_10058197
802 Ga0157380_10096634
803 Ga0157380_10143124
804 Ga0157377_10005772
805 Ga0157377_10009001
806 Ga0157377_10039018
807 Ga0157377_10044621
808 Ga0157377_10049157
809 Ga0157379_10006675
810 Ga0157379_10008568
811 Ga0157379_10147255
812 Ga0157376_10034290
813 Ga0157376_10087841
814 Ga0157376_10133535
815 Ga0163161_10010796
816 Ga0213875_10000130
817 Ga0207697_10000242
818 Ga0207656_10000505
819 Ga0207682_10003009
820 Ga0207682_10004916
821 Ga0207710_10018841
822 Ga0207710_10035449
823 Ga0207688_10000057
824 Ga0207680_10017862
825 Ga0207645_10003875
826 Ga0207645_10004538
827 Ga0207643_10000936
828 Ga0207643_10003451
829 Ga0207643_10015468
830 Ga0207707_10031898
831 Ga0207707_10085603
832 Ga0207707_10099834
833 Ga0207662_10004530
834 Ga0207662_10086313
835 Ga0207646_10156975
836 Ga0207681_10000941
837 Ga0207681_10005625
838 Ga0207650_10014535
839 Ga0207650_10018213
840 Ga0207650_10021561
841 Ga0207650_10196354
842 Ga0207659_10000815
843 Ga0207659_10005819
844 Ga0207659_10017242
845 Ga0207659_10018691
846 Ga0207659_10023104
847 Ga0207659_10025813
848 Ga0207644_10019859
849 Ga0207644_10021611
850 Ga0207644_10045482
851 Ga0207644_10151118
852 Ga0207690_10094497
853 Ga0207706_10009887
854 Ga0207706_10050429
855 Ga0207670_10002105
856 Ga0207669_10001240
857 Ga0207669_10023188
858 Ga0207669_10119118
859 Ga0207704_10126489
860 Ga0207691_10014037
861 Ga0207691_10028066
862 Ga0207691_10060513
863 Ga0207711_10212834
864 Ga0207689_10001876
865 Ga0207689_10004628
866 Ga0207689_10052717
867 Ga0207689_10066517
868 Ga0207689_10105169
869 Ga0207689_10140033
870 Ga0207679_10033396
871 Ga0207679_10149883
872 Ga0207651_10002829
873 Ga0207651_10040517
874 Ga0207651_10040733
875 Ga0207651_10042789
876 Ga0207651_10046878
877 Ga0207651_10048016
878 Ga0207651_10057104
879 Ga0207651_10057829
880 Ga0207651_10150941
881 Ga0207712_10017327
882 Ga0207668_10029695
883 Ga0207640_10190515
884 Ga0207703_10008660
885 Ga0207703_10043182
886 Ga0207703_10044910
887 Ga0207703_10180288
888 Ga0207678_10011245
889 Ga0207678_10052509
890 Ga0207678_10143937
891 Ga0207708_10013205
892 Ga0207708_10072710
893 Ga0207641_10035637
894 Ga0207641_10073489
895 Ga0207648_10000163
896 Ga0207648_10001300
897 Ga0207648_10003862
898 Ga0207648_10176748
899 Ga0207676_10012948
900 Ga0207676_10026635
901 Ga0207674_10007078
902 Ga0207674_10131721
903 Ga0207675_100004330
904 Ga0207675_100018026
905 Ga0207675_100022573
906 Ga0207683_10027675
907 Ga0207683_10096313
908 Ga0207683_10238482
909 Ga0207698_10118874
910 Ga0209974_10009930
911 Ga0207428_10000022
912 Ga0207428_10000713
913 Ga0207428_10001776
914 Ga0207428_10002840
915 Ga0207428_10003028
916 Ga0207428_10004545
917 Ga0207428_10006388
918 Ga0207428_10014861
919 Ga0207428_10033003
920 Ga0207428_10036243
921 Ga0268266_10034699
922 Ga0268265_10000263
923 Ga0268264_10002446
924 Ga0268264_10008880
925 Ga0268264_10010430
926 Ga0268264_10023800
927 Ga0307413_10050619
928 Ga0307413_10079305
929 Ga0307410_10020005
930 Ga0307410_10106282
931 Ga0307406_10048671
932 Ga0307407_10045917
933 Ga0307409_100026746
934 Ga0307416_100033840
935 Ga0307416_100059844
936 Ga0307416_100081685
937 Ga0307416_100107712
938 Ga0307416_100142034
939 Ga0307416_100161659
940 Ga0307411_10023307
941 Ga0307411_10070458
942 Ga0373955_0040165
943 Ga0373937_0005906
944 Ga0373937_0026709
945 Ga0395905_0028573
946 Ga0436364_0316723
947 Ga0439435_0006529
948 Ga0451576_0057283
949 Ga0451576_0088758
950 Ga0451576_0141981
951 Ga0495592_0032340
952 Ga0495580_0016654
953 Ga0495584_0027878
954 Ga0495584_0028453
955 Ga0495608_0005795
956 Ga0495642_0005430
957 Ga0495642_0024043
958 Ga0495652_0081346
959 Ga0495621_0001135
960 Ga0495645_0001717
961 Ga0495645_0107458
962 Ga0495667_0013753
963 Ga0495588_0005315
964 Ga0495658_0012298
965 Ga0495613_0004097
966 Ga0495604_0051815
967 Ga0495636_0013991
968 Ga0495674_0054063
969 Ga0495684_0001402
970 Ga0496109_0064619
971 Ga0496114_0066190
972 Ga0501036_0117224
973 Ga0501038_0163386
974 Ga0501039_0011752
975 Ga0501039_0274916
976 Ga0501040_0029096
977 Ga0501042_0041594
978 Ga0501071_0055324
979 Ga0501072_0033099
980 Ga0501072_0039508
981 Ga0501075_0012148
982 Ga0501075_0036709
983 Ga0501075_0039221
984 Ga0501075_0040020
985 Ga0501076_0025386
986 Ga0501076_0052895
987 Ga0501076_0055239
988 Ga0501077_0069150
989 Ga0501079_0016594
990 Ga0501079_0060212
991 Ga0501081_0026136
992 Ga0501081_0040249
993 Ga0501081_0065368
994 Ga0501045_0041543
995 Ga0501045_0139476
996 nmdc:mga06z11_28856_c1
997 nmdc:mga05p37_14156_c1
998 nmdc:mga05p37_149202_c1
999 nmdc:mga05p37_17885_c1
1000 nmdc:mga05p37_19580_c1
1001 nmdc:mga05p37_226481_c1
1002 nmdc:mga05p37_24191_c1
1003 nmdc:mga05p37_2419_c1
1004 nmdc:mga05p37_266_c1
1005 nmdc:mga05p37_32183_c1
1006 nmdc:mga05p37_32576_c1
1007 nmdc:mga05p37_52831_c1
1008 nmdc:mga05p37_57962_c1
1009 nmdc:mga05p37_73485_c1
1010 nmdc:mga05p37_82604_c1
1011 nmdc:mga05p37_9704_c1
1012 nmdc:mga09592_12494_c1
1013 nmdc:mga09592_22860_c1
1014 nmdc:mga09592_43605_c1
1015 nmdc:mga09592_50013_c1
1016 nmdc:mga09592_5444_c1
1017 nmdc:mga09592_68806_c1
1018 nmdc:mga09592_729_c1
1019 nmdc:mga0qj67_116208_c1
1020 nmdc:mga0qj67_3065_c1
1021 nmdc:mga0qj67_48247_c1
1022 nmdc:mga06r32_101423_c1
1023 nmdc:mga06r32_208051_c1
1024 nmdc:mga06r32_3869_c1
1025 nmdc:mga06r32_44093_c1
1026 nmdc:mga06r32_44705_c1
1027 nmdc:mga06r32_45879_c1
1028 nmdc:mga06r32_73145_c1
1029 nmdc:mga08y16_1170_c1
1030 nmdc:mga08y16_1808_c1
1031 nmdc:mga08y16_21_c1
1032 nmdc:mga08y16_229271_c1
1033 nmdc:mga08y16_257086_c1
1034 nmdc:mga08y16_281856_c1
1035 nmdc:mga08y16_28412_c1
1036 nmdc:mga08y16_3129_c1
1037 nmdc:mga08y16_42079_c1
1038 nmdc:mga08y16_42117_c1
1039 nmdc:mga08y16_45591_c1
1040 nmdc:mga08y16_743_c1
1041 nmdc:mga08y16_77471_c1
1042 nmdc:mga08y16_98257_c1
1043 nmdc:mga0n895_17725_c1
1044 nmdc:mga0n895_18038_c1
1045 nmdc:mga0n895_275_c1
1046 nmdc:mga0n895_42486_c1
1047 nmdc:mga0rr50_38555_c1
1048 nmdc:mga0rr50_39282_c1
1049 nmdc:mga0rr50_40003_c1
1050 nmdc:mga0a205_182665_c1
1051 nmdc:mga0a205_569_c1
1052 nmdc:mga0a205_675_c1
1053 nmdc:mga0a205_9378_c1
1054 Ga0495601_0112378
1055 Ga0495619_0004341
1056 Ga0495619_0069448
1057 Ga0500568_0010172
1058 Ga0501084_0086032
1059 Ga0590071_000190
1060 Ga0590071_000303
1061 Ga0590074_006101
1062 Ga0590075_001308
1063 Ga0590075_002100
1064 Ga0590077_000540
1065 Ga0590077_001622
1066 Ga0501082_0011801
1067 Ga0501082_0139609
1068 Ga0501082_0143818
1069 Ga0501082_0235916
1070 Ga0530510_0002698
1071 Ga0530510_0002975
1072 Ga0530510_0005455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08811

DUF1800

Protein of unknown function (DUF1800)

31

505

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h75-assembly1.cif.gz_D crystal structure of the mrsd-protein a fusion protein 0.3828 234 323
6b9e-assembly1.cif.gz_A human atl1 mutant - r77a / f151s bound to gdp 0.2784 312 474
5h7a-assembly2.cif.gz_A crystal structure of a repeat protein with four protein a repeat module 0.2735 261 475
3zhy-assembly1.cif.gz_A structure of mycobacterium tuberculosis dxr in complex with a di- substituted fosmidomycin analogue 0.268 378 481
7z6h-assembly1.cif.gz_D structure of dna-bound human rad17-rfc clamp loader and 9-1-1 checkpoint clamp 0.265 277 478
ID Description Score Start End Superfamily
5ks1B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.2976 398 479 1.10.1740.10
5kryA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.2931 397 479 1.10.1740.10
af_A4ICH4_855_1005_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.2898 344 482 3.40.50.300
af_Q2FY50_278_554_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.2737 178 313 3.40.50.300
5ks1B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.2719 398 479 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A2V8HCQ2-F1-model_v4 DUF1800 domain-containing protein 0.9831 6 487
AF-A0A7W1TVK5-F1-model_v4 DUF1800 domain-containing protein 0.9776 87 487
AF-A0A7W1TVK5-F1-model_v4 DUF1800 domain-containing protein 0.9728 87 487
AF-A0A2V8HCQ2-F1-model_v4 DUF1800 domain-containing protein 0.9711 6 487
AF-A0A2V8GLN9-F1-model_v4 DUF1800 domain-containing protein 0.9584 1 196

Map