F462831

General Info

Members Datasets Scaffolds Average Seq Length
553 208 1106 259

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100059763|Ga0070698_1000597633
Length 306
Sequence MGFELPIIQDEKRSRNQSWSYFVCSNPIIGKNQNDRSVTAGVNGDQLELELQGKVIVVTGGARGIGSAIARACQDEGAIPVVLDREIETEECRQLVSRKTKNDVGLITAELLIPKECSVAINTVIAKFGRIDGVVDNAGHNDKIGLENGSPDEYVASLNRNLVHYYSVAHYALPHLKLSGGAIVNIGSKVAVSGQGGTSGYASAKGGIMALTREWAAELLPYGIRVNTVVPAEVMTPLYKEWLSTFSEPEEKLKSILSRIPLAKRMTTAQEIASTVVFLLSAKAGHTTGQHLFVDGGYVHLDRILP

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.99
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100059763 3300005471 Bacteria 3849
2 LJNas_1001278 3300000546 Unclassified 3740
3 Ga0070683_100010989 3300005329 Bacteria 7801
4 Ga0070690_100122299 3300005330 Unclassified 1748
5 Ga0070690_100220737 3300005330 Bacteria 1328
6 Ga0070670_100391414 3300005331 Bacteria 1226
7 Ga0068869_100021047 3300005334 Bacteria 4483
8 Ga0068869_100151218 3300005334 Unclassified 1801
9 Ga0070666_10237455 3300005335 Bacteria 1288
10 Ga0070680_100040344 3300005336 Unclassified 3779
11 Ga0070680_100348442 3300005336 Bacteria 1259
12 Ga0070682_100529626 3300005337 Unclassified 918
13 Ga0068868_100019925 3300005338 Bacteria 5031
14 Ga0068868_100107345 3300005338 Bacteria 2266
15 Ga0068868_100160222 3300005338 Bacteria 1858
16 Ga0070689_100068584 3300005340 Bacteria 2766
17 Ga0070661_100006351 3300005344 Bacteria 8152
18 Ga0070661_100318497 3300005344 Bacteria 1214
19 Ga0070671_100107811 3300005355 Bacteria 2339
20 Ga0070673_100362221 3300005364 Bacteria 1289
21 Ga0070659_100065176 3300005366 Unclassified 2885
22 Ga0070659_100203428 3300005366 Bacteria 1630
23 Ga0070667_100320122 3300005367 Bacteria 1399
24 Ga0070709_10000332 3300005434 Bacteria 29688
25 Ga0070709_10004654 3300005434 Bacteria 7411
26 Ga0070709_10007355 3300005434 Bacteria 6033
27 Ga0070709_10014825 3300005434 Bacteria 4418
28 Ga0070709_10015262 3300005434 Bacteria 4366
29 Ga0070709_10032792 3300005434 Bacteria 3135
30 Ga0070709_10306775 3300005434 Unclassified 1161
31 Ga0070709_10315273 3300005434 Unclassified 1146
32 Ga0070714_100006570 3300005435 Bacteria 8995
33 Ga0070714_100009855 3300005435 Bacteria 7531
34 Ga0070714_100017597 3300005435 Bacteria 5792
35 Ga0070714_100027036 3300005435 Bacteria 4747
36 Ga0070714_100027997 3300005435 Bacteria 4672
37 Ga0070714_100080937 3300005435 Bacteria 2827
38 Ga0070714_100143714 3300005435 Bacteria 2144
39 Ga0070714_100249897 3300005435 Bacteria 1639
40 Ga0070714_100367258 3300005435 Bacteria 1354
41 Ga0070714_100726978 3300005435 Unclassified 959
42 Ga0070713_100000164 3300005436 Bacteria 44269
43 Ga0070713_100000413 3300005436 Bacteria 27428
44 Ga0070713_100003320 3300005436 Bacteria 10613
45 Ga0070713_100017452 3300005436 Bacteria 5429
46 Ga0070713_100019897 3300005436 Bacteria 5138
47 Ga0070713_100063485 3300005436 Bacteria 3097
48 Ga0070713_100071798 3300005436 Bacteria 2926
49 Ga0070713_100181009 3300005436 Bacteria 1894
50 Ga0070713_100226557 3300005436 Bacteria 1698
51 Ga0070713_100283896 3300005436 Bacteria 1519
52 Ga0070713_100288946 3300005436 Bacteria 1506
53 Ga0070713_100442101 3300005436 Bacteria 1220
54 Ga0070713_100490560 3300005436 Bacteria 1158
55 Ga0070713_100884972 3300005436 Bacteria 858
56 Ga0070710_10002115 3300005437 Bacteria 9410
57 Ga0070710_10145712 3300005437 Bacteria 1456
58 Ga0070711_100000108 3300005439 Bacteria 43211
59 Ga0070711_100011113 3300005439 Bacteria 5586
60 Ga0070711_100253674 3300005439 Unclassified 1381
61 Ga0070708_100006822 3300005445 Bacteria 9101
62 Ga0070708_100031726 3300005445 Bacteria 4575
63 Ga0070662_100010102 3300005457 Bacteria 6184
64 Ga0070662_100037842 3300005457 Unclassified 3423
65 Ga0070662_100161227 3300005457 Unclassified 1754
66 Ga0070681_10002165 3300005458 Bacteria 17876
67 Ga0070681_10133211 3300005458 Unclassified 2417
68 Ga0070681_10206159 3300005458 Bacteria 1883
69 Ga0070681_10273991 3300005458 Unclassified 1599
70 Ga0070681_10455565 3300005458 Bacteria 1191
71 Ga0068867_100010723 3300005459 Bacteria 6463
72 Ga0068867_100018010 3300005459 Bacteria 5019
73 Ga0070685_10154257 3300005466 Unclassified 1458
74 Ga0070706_100050428 3300005467 Bacteria 3841
75 Ga0070706_100073610 3300005467 Bacteria 3162
76 Ga0070706_100139175 3300005467 Bacteria 2266
77 Ga0070707_100004261 3300005468 Bacteria 13393
78 Ga0070707_100010484 3300005468 Bacteria 8632
79 Ga0070707_100086767 3300005468 Bacteria 3027
80 Ga0070698_100018646 3300005471 Bacteria 7305
81 Ga0070699_100001924 3300005518 Bacteria 18737
82 Ga0070699_100008591 3300005518 Bacteria 8851
83 Ga0070699_100055051 3300005518 Bacteria 3445
84 Ga0070679_100297855 3300005530 Unclassified 1564
85 Ga0070684_100331884 3300005535 Bacteria 1398
86 Ga0070697_100005294 3300005536 Bacteria 9909
87 Ga0070697_100010168 3300005536 Bacteria 7342
88 Ga0068853_100033336 3300005539 Bacteria 4369
89 Ga0068853_100169965 3300005539 Bacteria 1972
90 Ga0070672_100028098 3300005543 Bacteria 4204
91 Ga0070672_100298870 3300005543 Bacteria 1364
92 Ga0070686_100187127 3300005544 Bacteria 1475
93 Ga0070695_100079293 3300005545 Unclassified 2167
94 Ga0068855_100000512 3300005563 Bacteria 47776
95 Ga0068855_100103631 3300005563 Bacteria 3273
96 Ga0068855_100139610 3300005563 Unclassified 2764
97 Ga0068855_100238841 3300005563 Bacteria 2031
98 Ga0068855_100403361 3300005563 Unclassified 1498
99 Ga0070664_100000218 3300005564 Bacteria 40952
100 Ga0070664_100081369 3300005564 Bacteria 2791
101 Ga0070664_100113393 3300005564 Unclassified 2368
102 Ga0070664_100176637 3300005564 Bacteria 1896
103 Ga0070664_100191535 3300005564 Unclassified 1822
104 Ga0068857_100000999 3300005577 Bacteria 21728
105 Ga0068857_100007254 3300005577 Bacteria 9544
106 Ga0068857_100045756 3300005577 Unclassified 3883
107 Ga0068857_100283387 3300005577 Unclassified 1525
108 Ga0068854_100052071 3300005578 Bacteria 2934
109 Ga0068854_100114027 3300005578 Unclassified 2043
110 Ga0068856_100000956 3300005614 Bacteria 30876
111 Ga0068856_100001123 3300005614 Bacteria 28275
112 Ga0068856_100001284 3300005614 Bacteria 26414
113 Ga0068856_100003229 3300005614 Bacteria 16596
114 Ga0068856_100008597 3300005614 Bacteria 9929
115 Ga0068856_100288347 3300005614 Bacteria 1658
116 Ga0068856_100293490 3300005614 Bacteria 1643
117 Ga0068856_100607567 3300005614 Bacteria 1114
118 Ga0070702_100073979 3300005615 Bacteria 2020
119 Ga0068852_100072472 3300005616 Bacteria 3027
120 Ga0068852_100263494 3300005616 Bacteria 1656
121 Ga0068859_100002285 3300005617 Bacteria 19458
122 Ga0068859_100012362 3300005617 Bacteria 8586
123 Ga0068864_100001216 3300005618 Bacteria 21390
124 Ga0068866_10011989 3300005718 Unclassified 3769
125 Ga0068866_10160343 3300005718 Bacteria 1311
126 Ga0068861_100327574 3300005719 Unclassified 1336
127 Ga0068863_100028027 3300005841 Bacteria 5377
128 Ga0068863_100040259 3300005841 Unclassified 4444
129 Ga0068863_100050178 3300005841 Unclassified 3956
130 Ga0068863_100072345 3300005841 Bacteria 3262
131 Ga0068863_100109802 3300005841 Bacteria 2626
132 Ga0068858_100001221 3300005842 Bacteria 26605
133 Ga0068858_100003077 3300005842 Bacteria 16690
134 Ga0068858_100036606 3300005842 Bacteria 4550
135 Ga0068858_100045061 3300005842 Bacteria 4087
136 Ga0068858_100059278 3300005842 Bacteria 3538
137 Ga0068860_100019622 3300005843 Bacteria 6556
138 Ga0068860_100055743 3300005843 Bacteria 3758
139 Ga0068860_100161068 3300005843 Bacteria 2163
140 Ga0070717_10000363 3300006028 Bacteria 29200
141 Ga0070717_10005674 3300006028 Bacteria 9121
142 Ga0070717_10008419 3300006028 Bacteria 7703
143 Ga0070717_10022183 3300006028 Bacteria 5015
144 Ga0070717_10041925 3300006028 Unclassified 3733
145 Ga0070717_10052969 3300006028 Unclassified 3344
146 Ga0070717_10054745 3300006028 Unclassified 3291
147 Ga0070717_10084575 3300006028 Bacteria 2669
148 Ga0070717_10102696 3300006028 Bacteria 2429
149 Ga0070717_10155235 3300006028 Bacteria 1982
150 Ga0070717_10183476 3300006028 Bacteria 1825
151 Ga0070717_10209550 3300006028 Bacteria 1710
152 Ga0070717_10326095 3300006028 Bacteria 1369
153 Ga0070717_10618588 3300006028 Unclassified 983
154 Ga0070715_10000722 3300006163 Bacteria 8908
155 Ga0070715_10000844 3300006163 Bacteria 8423
156 Ga0070715_10048859 3300006163 Bacteria 1810
157 Ga0070716_100000127 3300006173 Bacteria 30225
158 Ga0070716_100000182 3300006173 Bacteria 24723
159 Ga0070716_100000477 3300006173 Bacteria 16574
160 Ga0070716_100011533 3300006173 Bacteria 4451
161 Ga0070716_100044030 3300006173 Bacteria 2499
162 Ga0070716_100103494 3300006173 Bacteria 1750
163 Ga0070716_100143978 3300006173 Bacteria 1524
164 Ga0070716_100205375 3300006173 Bacteria 1313
165 Ga0070716_100256869 3300006173 Bacteria 1193
166 Ga0070716_100402094 3300006173 Bacteria 985
167 Ga0070716_100499820 3300006173 Bacteria 897
168 Ga0070712_100000226 3300006175 Bacteria 31684
169 Ga0070712_100000228 3300006175 Bacteria 31570
170 Ga0070712_100001506 3300006175 Bacteria 14201
171 Ga0070712_100007335 3300006175 Bacteria 6882
172 Ga0070712_100041007 3300006175 Unclassified 3176
173 Ga0070712_100055064 3300006175 Bacteria 2783
174 Ga0070712_100075601 3300006175 Bacteria 2423
175 Ga0070712_100093996 3300006175 Bacteria 2202
176 Ga0070712_100244887 3300006175 Bacteria 1430
177 Ga0097621_100001543 3300006237 Bacteria 15760
178 Ga0097621_100002283 3300006237 Bacteria 13137
179 Ga0097621_100006241 3300006237 Bacteria 8458
180 Ga0097621_100011666 3300006237 Bacteria 6483
181 Ga0097621_100012436 3300006237 Bacteria 6309
182 Ga0097621_100029010 3300006237 Unclassified 4367
183 Ga0068871_100000186 3300006358 Bacteria 42100
184 Ga0068871_100010110 3300006358 Bacteria 6866
185 Ga0068871_100035280 3300006358 Bacteria 3972
186 Ga0068871_100084062 3300006358 Bacteria 2641
187 Ga0068871_100119622 3300006358 Bacteria 2224
188 Ga0075433_10061842 3300006852 Bacteria 3280
189 Ga0075433_10064045 3300006852 Bacteria 3222
190 Ga0075434_100002693 3300006871 Bacteria 15693
191 Ga0075434_100065739 3300006871 Bacteria 3612
192 Ga0075434_100082325 3300006871 Bacteria 3216
193 Ga0075429_100214616 3300006880 Unclassified 1686
194 Ga0068865_100015018 3300006881 Unclassified 4932
195 Ga0068865_100027126 3300006881 Bacteria 3780
196 Ga0068865_100123514 3300006881 Bacteria 1929
197 Ga0068865_100227433 3300006881 Bacteria 1462
198 Ga0075436_100006296 3300006914 Bacteria 8131
199 Ga0075436_100207465 3300006914 Bacteria 1389
200 Ga0075436_100229057 3300006914 Bacteria 1320
201 Ga0075436_100254713 3300006914 Bacteria 1251
202 Ga0097620_100002285 3300006931 Bacteria 19458
203 Ga0097620_100012363 3300006931 Bacteria 8586
204 Ga0075435_100017295 3300007076 Bacteria 5455
205 Ga0075435_100029726 3300007076 Bacteria 4290
206 Ga0075435_100442427 3300007076 Bacteria 1120
207 Ga0099794_10022845 3300007265 Bacteria 2855
208 Ga0099794_10081958 3300007265 Bacteria 1592
209 Ga0099794_10094442 3300007265 Bacteria 1487
210 Ga0099794_10166203 3300007265 Bacteria 1124
211 Ga0099795_10000409 3300007788 Bacteria 7851
212 Ga0105240_10016211 3300009093 Bacteria 10097
213 Ga0105240_10106444 3300009093 Bacteria 3401
214 Ga0105240_10258943 3300009093 Bacteria 2008
215 Ga0105240_10481559 3300009093 Unclassified 1383
216 Ga0105245_10014579 3300009098 Bacteria 6844
217 Ga0105245_10116583 3300009098 Unclassified 2490
218 Ga0105247_10098645 3300009101 Bacteria 1865
219 Ga0105243_10020830 3300009148 Bacteria 4975
220 Ga0105243_10227071 3300009148 Bacteria 1654
221 Ga0105241_10004513 3300009174 Bacteria 10297
222 Ga0105241_10010449 3300009174 Bacteria 6812
223 Ga0105241_10048328 3300009174 Bacteria 3237
224 Ga0105241_10108831 3300009174 Bacteria 2216
225 Ga0105242_10010726 3300009176 Bacteria 7035
226 Ga0105242_10013187 3300009176 Bacteria 6380
227 Ga0105242_10080955 3300009176 Bacteria 2715
228 Ga0105242_10434875 3300009176 Bacteria 1233
229 Ga0105242_10460166 3300009176 Bacteria 1201
230 Ga0105248_10005743 3300009177 Bacteria 13629
231 Ga0105248_10057306 3300009177 Bacteria 4373
232 Ga0105248_10071946 3300009177 Bacteria 3886
233 Ga0105237_10014369 3300009545 Bacteria 8283
234 Ga0105237_10026287 3300009545 Bacteria 5949
235 Ga0105237_10032463 3300009545 Bacteria 5285
236 Ga0105237_10038870 3300009545 Bacteria 4805
237 Ga0105237_10040394 3300009545 Bacteria 4705
238 Ga0105237_10398881 3300009545 Bacteria 1380
239 Ga0105238_10000073 3300009551 Bacteria 112101
240 Ga0105238_10138846 3300009551 Bacteria 2408
241 Ga0105238_10659257 3300009551 Unclassified 1057
242 Ga0099796_10001130 3300010159 Bacteria 5146
243 Ga0105239_10006300 3300010375 Bacteria 13797
244 Ga0105239_10023968 3300010375 Bacteria 6721
245 Ga0105239_10040409 3300010375 Bacteria 5110
246 Ga0105239_10043247 3300010375 Unclassified 4937
247 Ga0105239_10305251 3300010375 Bacteria 1793
248 Ga0105239_10633659 3300010375 Bacteria 1220
249 Ga0105246_10008243 3300011119 Bacteria 6402
250 Ga0105246_10011808 3300011119 Bacteria 5429
251 Ga0157373_10013467 3300013100 Bacteria 6000
252 Ga0157373_10037104 3300013100 Bacteria 3496
253 Ga0157373_10071197 3300013100 Unclassified 2456
254 Ga0157373_10127792 3300013100 Bacteria 1787
255 Ga0157373_10166994 3300013100 Unclassified 1549
256 Ga0157371_10018045 3300013102 Bacteria 5226
257 Ga0157371_10327853 3300013102 Bacteria 1112
258 Ga0157370_10069618 3300013104 Bacteria 3322
259 Ga0157370_10077067 3300013104 Bacteria 3141
260 Ga0157370_10112983 3300013104 Bacteria 2538
261 Ga0157369_10000194 3300013105 Bacteria 84798
262 Ga0157369_10273278 3300013105 Bacteria 1761
263 Ga0157369_10300901 3300013105 Bacteria 1668
264 Ga0157369_10307101 3300013105 Bacteria 1650
265 Ga0157374_10000392 3300013296 Bacteria 39937
266 Ga0157374_10000586 3300013296 Bacteria 32231
267 Ga0157374_10000813 3300013296 Bacteria 27350
268 Ga0157374_10016974 3300013296 Bacteria 6409
269 Ga0157374_10054212 3300013296 Unclassified 3740
270 Ga0157374_10101481 3300013296 Bacteria 2759
271 Ga0157374_10314389 3300013296 Bacteria 1551
272 Ga0157378_10000086 3300013297 Bacteria 86864
273 Ga0157378_10000884 3300013297 Bacteria 27646
274 Ga0157378_10001456 3300013297 Bacteria 21333
275 Ga0157378_10006446 3300013297 Bacteria 10261
276 Ga0157378_10016621 3300013297 Bacteria 6446
277 Ga0163162_10007455 3300013306 Bacteria 10641
278 Ga0163162_10059230 3300013306 Bacteria 3861
279 Ga0163162_10209689 3300013306 Unclassified 2078
280 Ga0163162_10467403 3300013306 Unclassified 1393
281 Ga0157372_10000801 3300013307 Bacteria 34193
282 Ga0157372_10002303 3300013307 Bacteria 20713
283 Ga0157372_10003465 3300013307 Bacteria 17022
284 Ga0157372_10191783 3300013307 Bacteria 2367
285 Ga0157372_10328798 3300013307 Bacteria 1780
286 Ga0157375_10126302 3300013308 Unclassified 2673
287 Ga0157375_10254468 3300013308 Bacteria 1917
288 Ga0163163_10144512 3300014325 Bacteria 2422
289 Ga0163163_10246318 3300014325 Bacteria 1837
290 Ga0163163_10390937 3300014325 Unclassified 1449
291 Ga0182008_10022688 3300014497 Bacteria 3213
292 Ga0157377_10130127 3300014745 Unclassified 1536
293 Ga0157379_10045264 3300014968 Bacteria 3929
294 Ga0157376_10000023 3300014969 Bacteria 223978
295 Ga0157376_10017981 3300014969 Bacteria 5408
296 Ga0157376_10136971 3300014969 Bacteria 2192
297 Ga0157376_10723984 3300014969 Bacteria 1002
298 Ga0182007_10005756 3300015262 Bacteria 5394
299 Ga0228598_1000143 3300024227 Bacteria 12230
300 Ga0209437_105603 3300025233 Bacteria 2130
301 Ga0207692_10019082 3300025898 Unclassified 3092
302 Ga0207692_10111494 3300025898 Bacteria 1518
303 Ga0207642_10147094 3300025899 Bacteria 1249
304 Ga0207647_10017386 3300025904 Bacteria 4889
305 Ga0207647_10027626 3300025904 Unclassified 3697
306 Ga0207685_10026443 3300025905 Bacteria 2018
307 Ga0207685_10090203 3300025905 Unclassified 1289
308 Ga0207699_10001156 3300025906 Bacteria 12472
309 Ga0207699_10016279 3300025906 Bacteria 3885
310 Ga0207699_10016826 3300025906 Bacteria 3835
311 Ga0207699_10031277 3300025906 Unclassified 2987
312 Ga0207699_10042782 3300025906 Bacteria 2627
313 Ga0207699_10052783 3300025906 Bacteria 2408
314 Ga0207699_10091305 3300025906 Bacteria 1912
315 Ga0207699_10138257 3300025906 Bacteria 1598
316 Ga0207705_10042419 3300025909 Bacteria 3266
317 Ga0207684_10000404 3300025910 Bacteria 57743
318 Ga0207684_10023846 3300025910 Bacteria 5221
319 Ga0207684_10127165 3300025910 Bacteria 2187
320 Ga0207684_10156843 3300025910 Bacteria 1959
321 Ga0207654_10019758 3300025911 Bacteria 3561
322 Ga0207654_10088838 3300025911 Bacteria 1879
323 Ga0207654_10179618 3300025911 Bacteria 1380
324 Ga0207707_10002031 3300025912 Bacteria 18355
325 Ga0207707_10002300 3300025912 Bacteria 17227
326 Ga0207707_10030665 3300025912 Unclassified 4704
327 Ga0207695_10009628 3300025913 Bacteria 11922
328 Ga0207695_10014133 3300025913 Bacteria 9475
329 Ga0207671_10013417 3300025914 Bacteria 6524
330 Ga0207671_10043569 3300025914 Bacteria 3318
331 Ga0207671_10117901 3300025914 Bacteria 2027
332 Ga0207671_10261343 3300025914 Bacteria 1362
333 Ga0207693_10000077 3300025915 Bacteria 87615
334 Ga0207693_10000108 3300025915 Bacteria 75296
335 Ga0207693_10001436 3300025915 Bacteria 21134
336 Ga0207693_10009317 3300025915 Bacteria 8008
337 Ga0207693_10025474 3300025915 Bacteria 4690
338 Ga0207693_10038484 3300025915 Bacteria 3767
339 Ga0207693_10047211 3300025915 Unclassified 3384
340 Ga0207693_10054955 3300025915 Bacteria 3124
341 Ga0207693_10136405 3300025915 Bacteria 1929
342 Ga0207693_10202447 3300025915 Bacteria 1561
343 Ga0207693_10224467 3300025915 Unclassified 1476
344 Ga0207663_10000092 3300025916 Bacteria 42886
345 Ga0207663_10007426 3300025916 Bacteria 5682
346 Ga0207663_10050111 3300025916 Bacteria 2594
347 Ga0207663_10058829 3300025916 Bacteria 2428
348 Ga0207663_10334473 3300025916 Bacteria 1142
349 Ga0207660_10264578 3300025917 Bacteria 1361
350 Ga0207657_10000627 3300025919 Bacteria 37515
351 Ga0207657_10004882 3300025919 Bacteria 14111
352 Ga0207649_10100859 3300025920 Bacteria 1910
353 Ga0207652_10038988 3300025921 Bacteria 4030
354 Ga0207652_10114839 3300025921 Bacteria 2391
355 Ga0207652_10287752 3300025921 Bacteria 1483
356 Ga0207646_10003451 3300025922 Bacteria 17850
357 Ga0207646_10549456 3300025922 Bacteria 1038
358 Ga0207694_10097360 3300025924 Bacteria 2328
359 Ga0207694_10376285 3300025924 Bacteria 1178
360 Ga0207650_10031830 3300025925 Unclassified 3812
361 Ga0207687_10118588 3300025927 Bacteria 1975
362 Ga0207700_10000142 3300025928 Bacteria 42825
363 Ga0207700_10002849 3300025928 Bacteria 9948
364 Ga0207700_10012468 3300025928 Bacteria 5484
365 Ga0207700_10013852 3300025928 Bacteria 5265
366 Ga0207700_10031191 3300025928 Bacteria 3783
367 Ga0207700_10034061 3300025928 Bacteria 3652
368 Ga0207700_10065178 3300025928 Bacteria 2778
369 Ga0207700_10165743 3300025928 Unclassified 1839
370 Ga0207700_10226190 3300025928 Bacteria 1588
371 Ga0207664_10000684 3300025929 Bacteria 23233
372 Ga0207664_10002905 3300025929 Bacteria 11394
373 Ga0207664_10014923 3300025929 Bacteria 5624
374 Ga0207664_10079662 3300025929 Bacteria 2660
375 Ga0207664_10126058 3300025929 Unclassified 2150
376 Ga0207664_10178128 3300025929 Bacteria 1824
377 Ga0207664_10202372 3300025929 Bacteria 1715
378 Ga0207664_10203485 3300025929 Bacteria 1710
379 Ga0207664_10482274 3300025929 Bacteria 1109
380 Ga0207690_10063068 3300025932 Unclassified 2526
381 Ga0207706_10022374 3300025933 Bacteria 5673
382 Ga0207706_10035960 3300025933 Unclassified 4400
383 Ga0207686_10008372 3300025934 Bacteria 5582
384 Ga0207686_10109019 3300025934 Bacteria 1864
385 Ga0207686_10123443 3300025934 Unclassified 1766
386 Ga0207686_10134300 3300025934 Bacteria 1701
387 Ga0207709_10124075 3300025935 Bacteria 1749
388 Ga0207704_10042849 3300025938 Bacteria 2668
389 Ga0207704_10350286 3300025938 Bacteria 1149
390 Ga0207665_10000008 3300025939 Bacteria 173434
391 Ga0207665_10000041 3300025939 Bacteria 83482
392 Ga0207665_10011058 3300025939 Bacteria 5923
393 Ga0207665_10016584 3300025939 Bacteria 4841
394 Ga0207665_10018142 3300025939 Unclassified 4624
395 Ga0207665_10028890 3300025939 Bacteria 3666
396 Ga0207665_10057695 3300025939 Bacteria 2623
397 Ga0207665_10069321 3300025939 Bacteria 2404
398 Ga0207665_10154179 3300025939 Bacteria 1648
399 Ga0207665_10202480 3300025939 Unclassified 1447
400 Ga0207665_10292509 3300025939 Bacteria 1215
401 Ga0207691_10046744 3300025940 Bacteria 3975
402 Ga0207711_10043469 3300025941 Bacteria 3833
403 Ga0207711_10103076 3300025941 Bacteria 2526
404 Ga0207711_10198049 3300025941 Unclassified 1832
405 Ga0207689_10000382 3300025942 Bacteria 41581
406 Ga0207689_10047255 3300025942 Bacteria 3555
407 Ga0207661_10151807 3300025944 Bacteria 2003
408 Ga0207679_10064309 3300025945 Bacteria 2741
409 Ga0207679_10106625 3300025945 Unclassified 2203
410 Ga0207667_10007967 3300025949 Bacteria 12633
411 Ga0207667_10012289 3300025949 Bacteria 9878
412 Ga0207667_10084151 3300025949 Unclassified 3293
413 Ga0207667_10091501 3300025949 Bacteria 3142
414 Ga0207667_10148623 3300025949 Bacteria 2412
415 Ga0207651_10263890 3300025960 Bacteria 1415
416 Ga0207640_10015596 3300025981 Bacteria 4403
417 Ga0207658_10205438 3300025986 Bacteria 1647
418 Ga0207677_10011739 3300026023 Bacteria 5005
419 Ga0207703_10002756 3300026035 Bacteria 15051
420 Ga0207703_10003794 3300026035 Bacteria 12562
421 Ga0207703_10036549 3300026035 Bacteria 3911
422 Ga0207703_10037166 3300026035 Bacteria 3879
423 Ga0207703_10052823 3300026035 Unclassified 3302
424 Ga0207639_10163522 3300026041 Unclassified 1878
425 Ga0207639_10206928 3300026041 Bacteria 1687
426 Ga0207708_10522300 3300026075 Unclassified 998
427 Ga0207702_10000157 3300026078 Bacteria 80322
428 Ga0207702_10002196 3300026078 Bacteria 18698
429 Ga0207702_10007807 3300026078 Bacteria 9080
430 Ga0207702_10009335 3300026078 Bacteria 8241
431 Ga0207702_10011310 3300026078 Bacteria 7442
432 Ga0207702_10031428 3300026078 Bacteria 4425
433 Ga0207702_10091997 3300026078 Bacteria 2657
434 Ga0207641_10003094 3300026088 Bacteria 14981
435 Ga0207641_10023296 3300026088 Bacteria 5103
436 Ga0207641_10123031 3300026088 Unclassified 2318
437 Ga0207641_10136312 3300026088 Bacteria 2210
438 Ga0207641_10232950 3300026088 Bacteria 1712
439 Ga0207648_10010359 3300026089 Bacteria 8842
440 Ga0207648_10022928 3300026089 Bacteria 5599
441 Ga0207676_10027914 3300026095 Bacteria 4210
442 Ga0207676_10036071 3300026095 Unclassified 3759
443 Ga0207674_10004138 3300026116 Bacteria 17551
444 Ga0207674_10073445 3300026116 Unclassified 3434
445 Ga0207674_10436562 3300026116 Bacteria 1265
446 Ga0207675_100179977 3300026118 Unclassified 2024
447 Ga0207698_10058034 3300026142 Bacteria 2997
448 Ga0207698_10230161 3300026142 Bacteria 1682
449 Ga0209588_1001364 3300027671 Bacteria 6361
450 Ga0209588_1003984 3300027671 Unclassified 4132
451 Ga0265354_1008860 3300028016 Bacteria 967
452 Ga0268264_10067539 3300028381 Unclassified 3018
453 Ga0268264_10101401 3300028381 Bacteria 2502
454 Ga0268264_10123433 3300028381 Unclassified 2286
455 Ga0268264_10139917 3300028381 Bacteria 2157
456 Ga0265322_10058016 3300028654 Bacteria 1098
457 Ga0265338_10000716 3300028800 Bacteria 56718
458 Ga0265338_10044521 3300028800 Unclassified 4097
459 Ga0265338_10099121 3300028800 Unclassified 2381
460 Ga0265338_10121647 3300028800 Unclassified 2079
461 Ga0265760_10110491 3300031090 Bacteria 875
462 Ga0265325_10040686 3300031241 Unclassified 2440
463 Ga0265339_10024299 3300031249 Unclassified 3494
464 Ga0265339_10029320 3300031249 Bacteria 3122
465 Ga0373934_0002869 3300035086 Bacteria 6309
466 Ga0373934_0023105 3300035086 Bacteria 2402
467 Ga0373936_0005888 3300035113 Bacteria 4615
468 Ga0373945_0030399 3300035116 Bacteria 1904
469 Ga0373953_0000999 3300035117 Bacteria 7967
470 Ga0373953_0143457 3300035117 Bacteria 1022
471 Ga0373954_0000283 3300035118 Bacteria 18420
472 Ga0373954_0006500 3300035118 Bacteria 5096
473 Ga0373957_0004952 3300035120 Bacteria 4100
474 Ga0373957_0022441 3300035120 Bacteria 2249
475 Ga0373943_0000493 3300035170 Bacteria 16847
476 Ga0373943_0119855 3300035170 Bacteria 1397
477 Ga0373946_0004414 3300035171 Bacteria 5035
478 Ga0373955_0098386 3300035172 Unclassified 1676
479 Ga0373924_0013541 3300035410 Bacteria 3066
480 Ga0373931_0030002 3300035691 Bacteria 2797
481 Ga0373935_0010863 3300035692 Bacteria 5470
482 Ga0373935_0012544 3300035692 Bacteria 5098
483 Ga0373927_0001171 3300035695 Bacteria 19856
484 Ga0373927_0111971 3300035695 Unclassified 1779
485 Ga0373933_0023079 3300035724 Bacteria 3550
486 Ga0373933_0041473 3300035724 Bacteria 2717
487 Ga0373933_0144536 3300035724 Bacteria 1503
488 Ga0373947_0054033 3300035725 Bacteria 2423
489 Ga0373937_0013216 3300036401 Bacteria 7270
490 Ga0373937_0403779 3300036401 Bacteria 1296
491 Ga0373925_0001178 3300037068 Bacteria 23117
492 Ga0373925_0001655 3300037068 Bacteria 18786
493 Ga0373925_0222653 3300037068 Unclassified 1506
494 Ga0436364_0373893 3300037853 Unclassified 1968
495 Ga0451577_0081525 3300042876 Bacteria 2886
496 Ga0451577_0255264 3300042876 Bacteria 1587
497 Ga0453683_0002491 3300044673 Bacteria 14229
498 Ga0466965_0191389 3300044683 Bacteria 1082
499 Ga0466963_0007096 3300044694 Bacteria 6673
500 Ga0453684_0027987 3300044712 Bacteria 8061
501 Ga0466957_0066204 3300044842 Bacteria 2227
502 Ga0466959_0331394 3300045049 Bacteria 1039
503 Ga0451576_0000661 3300045051 Bacteria 71055
504 Ga0451576_0227768 3300045051 Bacteria 1946
505 Ga0495629_0017465 3300046459 Bacteria 5141
506 Ga0495653_0286881 3300046463 Bacteria 1078
507 Ga0495580_0000469 3300046472 Bacteria 33524
508 Ga0495580_0002264 3300046472 Bacteria 16815
509 Ga0495582_0000277 3300046473 Bacteria 28667
510 Ga0495582_0002349 3300046473 Bacteria 10587
511 Ga0495664_0010575 3300046477 Bacteria 5179
512 Ga0495664_0089626 3300046477 Unclassified 1849
513 Ga0495584_0024105 3300046491 Bacteria 3085
514 Ga0495608_0022278 3300046511 Bacteria 4343
515 Ga0495630_0487416 3300046517 Bacteria 945
516 Ga0495652_0170913 3300046529 Bacteria 1678
517 Ga0495665_0044556 3300046531 Unclassified 2357
518 Ga0495587_0004519 3300046536 Bacteria 9142
519 Ga0495658_0011276 3300046683 Bacteria 4492
520 Ga0495658_0017745 3300046683 Unclassified 3684
521 Ga0495600_0377654 3300046809 Bacteria 885
522 Ga0495674_0014607 3300047319 Bacteria 7349
523 Ga0495674_0024859 3300047319 Bacteria 5499
524 Ga0495674_0084579 3300047319 Bacteria 2719
525 Ga0495684_0016622 3300047471 Bacteria 5668
526 Ga0495602_0160006 3300048088 Bacteria 1759
527 Ga0496101_0215886 3300048904 Bacteria 1487
528 Ga0496102_0427781 3300048905 Bacteria 1243
529 Ga0496104_0486610 3300048907 Unclassified 1145
530 Ga0496104_0569433 3300048907 Bacteria 1043
531 Ga0496107_0096106 3300048910 Bacteria 2168
532 Ga0496112_0034144 3300048915 Unclassified 4949
533 Ga0496113_0018763 3300048916 Unclassified 4824
534 Ga0496114_0015259 3300048917 Bacteria 6176
535 Ga0496114_0492302 3300048917 Bacteria 1085
536 Ga0496115_0095667 3300048918 Bacteria 2431
537 Ga0496115_0101965 3300048918 Bacteria 2354
538 Ga0496126_0000095 3300048929 Bacteria 207654
539 nmdc:mga0n895_13543_c1 3300050512 Bacteria 7365
540 nmdc:mga0n895_187_c1 3300050512 Bacteria 38298
541 nmdc:mga0n895_65654_c1 3300050512 Bacteria 3592
542 nmdc:mga0rr50_14227_c1 3300050513 Bacteria 5211
543 nmdc:mga0rr50_234757_c1 3300050513 Unclassified 1518
544 nmdc:mga0rr50_23975_c1 3300050513 Bacteria 4219
545 nmdc:mga0rr50_76968_c1 3300050513 Bacteria 2562
546 nmdc:mga08x19_201797_c1 3300050514 Bacteria 1363
547 nmdc:mga08x19_35240_c1 3300050514 Unclassified 3165
548 nmdc:mga08x19_44339_c1 3300050514 Bacteria 2839
549 nmdc:mga08x19_61403_c1 3300050514 Bacteria 2435
550 Ga0495601_0026568 3300053077 Unclassified 3575
551 Ga0495601_0061141 3300053077 Bacteria 2391
552 Ga0466962_0012484 3300061719 Bacteria 4084
553 2919682053 2919679072 Bacteria 4629602
554 Ga0070698_100059763
555 LJNas_1001278
556 Ga0070683_100010989
557 Ga0070690_100122299
558 Ga0070690_100220737
559 Ga0070670_100391414
560 Ga0068869_100021047
561 Ga0068869_100151218
562 Ga0070666_10237455
563 Ga0070680_100040344
564 Ga0070680_100348442
565 Ga0070682_100529626
566 Ga0068868_100019925
567 Ga0068868_100107345
568 Ga0068868_100160222
569 Ga0070689_100068584
570 Ga0070661_100006351
571 Ga0070661_100318497
572 Ga0070671_100107811
573 Ga0070673_100362221
574 Ga0070659_100065176
575 Ga0070659_100203428
576 Ga0070667_100320122
577 Ga0070709_10000332
578 Ga0070709_10004654
579 Ga0070709_10007355
580 Ga0070709_10014825
581 Ga0070709_10015262
582 Ga0070709_10032792
583 Ga0070709_10306775
584 Ga0070709_10315273
585 Ga0070714_100006570
586 Ga0070714_100009855
587 Ga0070714_100017597
588 Ga0070714_100027036
589 Ga0070714_100027997
590 Ga0070714_100080937
591 Ga0070714_100143714
592 Ga0070714_100249897
593 Ga0070714_100367258
594 Ga0070714_100726978
595 Ga0070713_100000164
596 Ga0070713_100000413
597 Ga0070713_100003320
598 Ga0070713_100017452
599 Ga0070713_100019897
600 Ga0070713_100063485
601 Ga0070713_100071798
602 Ga0070713_100181009
603 Ga0070713_100226557
604 Ga0070713_100283896
605 Ga0070713_100288946
606 Ga0070713_100442101
607 Ga0070713_100490560
608 Ga0070713_100884972
609 Ga0070710_10002115
610 Ga0070710_10145712
611 Ga0070711_100000108
612 Ga0070711_100011113
613 Ga0070711_100253674
614 Ga0070708_100006822
615 Ga0070708_100031726
616 Ga0070662_100010102
617 Ga0070662_100037842
618 Ga0070662_100161227
619 Ga0070681_10002165
620 Ga0070681_10133211
621 Ga0070681_10206159
622 Ga0070681_10273991
623 Ga0070681_10455565
624 Ga0068867_100010723
625 Ga0068867_100018010
626 Ga0070685_10154257
627 Ga0070706_100050428
628 Ga0070706_100073610
629 Ga0070706_100139175
630 Ga0070707_100004261
631 Ga0070707_100010484
632 Ga0070707_100086767
633 Ga0070698_100018646
634 Ga0070699_100001924
635 Ga0070699_100008591
636 Ga0070699_100055051
637 Ga0070679_100297855
638 Ga0070684_100331884
639 Ga0070697_100005294
640 Ga0070697_100010168
641 Ga0068853_100033336
642 Ga0068853_100169965
643 Ga0070672_100028098
644 Ga0070672_100298870
645 Ga0070686_100187127
646 Ga0070695_100079293
647 Ga0068855_100000512
648 Ga0068855_100103631
649 Ga0068855_100139610
650 Ga0068855_100238841
651 Ga0068855_100403361
652 Ga0070664_100000218
653 Ga0070664_100081369
654 Ga0070664_100113393
655 Ga0070664_100176637
656 Ga0070664_100191535
657 Ga0068857_100000999
658 Ga0068857_100007254
659 Ga0068857_100045756
660 Ga0068857_100283387
661 Ga0068854_100052071
662 Ga0068854_100114027
663 Ga0068856_100000956
664 Ga0068856_100001123
665 Ga0068856_100001284
666 Ga0068856_100003229
667 Ga0068856_100008597
668 Ga0068856_100288347
669 Ga0068856_100293490
670 Ga0068856_100607567
671 Ga0070702_100073979
672 Ga0068852_100072472
673 Ga0068852_100263494
674 Ga0068859_100002285
675 Ga0068859_100012362
676 Ga0068864_100001216
677 Ga0068866_10011989
678 Ga0068866_10160343
679 Ga0068861_100327574
680 Ga0068863_100028027
681 Ga0068863_100040259
682 Ga0068863_100050178
683 Ga0068863_100072345
684 Ga0068863_100109802
685 Ga0068858_100001221
686 Ga0068858_100003077
687 Ga0068858_100036606
688 Ga0068858_100045061
689 Ga0068858_100059278
690 Ga0068860_100019622
691 Ga0068860_100055743
692 Ga0068860_100161068
693 Ga0070717_10000363
694 Ga0070717_10005674
695 Ga0070717_10008419
696 Ga0070717_10022183
697 Ga0070717_10041925
698 Ga0070717_10052969
699 Ga0070717_10054745
700 Ga0070717_10084575
701 Ga0070717_10102696
702 Ga0070717_10155235
703 Ga0070717_10183476
704 Ga0070717_10209550
705 Ga0070717_10326095
706 Ga0070717_10618588
707 Ga0070715_10000722
708 Ga0070715_10000844
709 Ga0070715_10048859
710 Ga0070716_100000127
711 Ga0070716_100000182
712 Ga0070716_100000477
713 Ga0070716_100011533
714 Ga0070716_100044030
715 Ga0070716_100103494
716 Ga0070716_100143978
717 Ga0070716_100205375
718 Ga0070716_100256869
719 Ga0070716_100402094
720 Ga0070716_100499820
721 Ga0070712_100000226
722 Ga0070712_100000228
723 Ga0070712_100001506
724 Ga0070712_100007335
725 Ga0070712_100041007
726 Ga0070712_100055064
727 Ga0070712_100075601
728 Ga0070712_100093996
729 Ga0070712_100244887
730 Ga0097621_100001543
731 Ga0097621_100002283
732 Ga0097621_100006241
733 Ga0097621_100011666
734 Ga0097621_100012436
735 Ga0097621_100029010
736 Ga0068871_100000186
737 Ga0068871_100010110
738 Ga0068871_100035280
739 Ga0068871_100084062
740 Ga0068871_100119622
741 Ga0075433_10061842
742 Ga0075433_10064045
743 Ga0075434_100002693
744 Ga0075434_100065739
745 Ga0075434_100082325
746 Ga0075429_100214616
747 Ga0068865_100015018
748 Ga0068865_100027126
749 Ga0068865_100123514
750 Ga0068865_100227433
751 Ga0075436_100006296
752 Ga0075436_100207465
753 Ga0075436_100229057
754 Ga0075436_100254713
755 Ga0097620_100002285
756 Ga0097620_100012363
757 Ga0075435_100017295
758 Ga0075435_100029726
759 Ga0075435_100442427
760 Ga0099794_10022845
761 Ga0099794_10081958
762 Ga0099794_10094442
763 Ga0099794_10166203
764 Ga0099795_10000409
765 Ga0105240_10016211
766 Ga0105240_10106444
767 Ga0105240_10258943
768 Ga0105240_10481559
769 Ga0105245_10014579
770 Ga0105245_10116583
771 Ga0105247_10098645
772 Ga0105243_10020830
773 Ga0105243_10227071
774 Ga0105241_10004513
775 Ga0105241_10010449
776 Ga0105241_10048328
777 Ga0105241_10108831
778 Ga0105242_10010726
779 Ga0105242_10013187
780 Ga0105242_10080955
781 Ga0105242_10434875
782 Ga0105242_10460166
783 Ga0105248_10005743
784 Ga0105248_10057306
785 Ga0105248_10071946
786 Ga0105237_10014369
787 Ga0105237_10026287
788 Ga0105237_10032463
789 Ga0105237_10038870
790 Ga0105237_10040394
791 Ga0105237_10398881
792 Ga0105238_10000073
793 Ga0105238_10138846
794 Ga0105238_10659257
795 Ga0099796_10001130
796 Ga0105239_10006300
797 Ga0105239_10023968
798 Ga0105239_10040409
799 Ga0105239_10043247
800 Ga0105239_10305251
801 Ga0105239_10633659
802 Ga0105246_10008243
803 Ga0105246_10011808
804 Ga0157373_10013467
805 Ga0157373_10037104
806 Ga0157373_10071197
807 Ga0157373_10127792
808 Ga0157373_10166994
809 Ga0157371_10018045
810 Ga0157371_10327853
811 Ga0157370_10069618
812 Ga0157370_10077067
813 Ga0157370_10112983
814 Ga0157369_10000194
815 Ga0157369_10273278
816 Ga0157369_10300901
817 Ga0157369_10307101
818 Ga0157374_10000392
819 Ga0157374_10000586
820 Ga0157374_10000813
821 Ga0157374_10016974
822 Ga0157374_10054212
823 Ga0157374_10101481
824 Ga0157374_10314389
825 Ga0157378_10000086
826 Ga0157378_10000884
827 Ga0157378_10001456
828 Ga0157378_10006446
829 Ga0157378_10016621
830 Ga0163162_10007455
831 Ga0163162_10059230
832 Ga0163162_10209689
833 Ga0163162_10467403
834 Ga0157372_10000801
835 Ga0157372_10002303
836 Ga0157372_10003465
837 Ga0157372_10191783
838 Ga0157372_10328798
839 Ga0157375_10126302
840 Ga0157375_10254468
841 Ga0163163_10144512
842 Ga0163163_10246318
843 Ga0163163_10390937
844 Ga0182008_10022688
845 Ga0157377_10130127
846 Ga0157379_10045264
847 Ga0157376_10000023
848 Ga0157376_10017981
849 Ga0157376_10136971
850 Ga0157376_10723984
851 Ga0182007_10005756
852 Ga0228598_1000143
853 Ga0209437_105603
854 Ga0207692_10019082
855 Ga0207692_10111494
856 Ga0207642_10147094
857 Ga0207647_10017386
858 Ga0207647_10027626
859 Ga0207685_10026443
860 Ga0207685_10090203
861 Ga0207699_10001156
862 Ga0207699_10016279
863 Ga0207699_10016826
864 Ga0207699_10031277
865 Ga0207699_10042782
866 Ga0207699_10052783
867 Ga0207699_10091305
868 Ga0207699_10138257
869 Ga0207705_10042419
870 Ga0207684_10000404
871 Ga0207684_10023846
872 Ga0207684_10127165
873 Ga0207684_10156843
874 Ga0207654_10019758
875 Ga0207654_10088838
876 Ga0207654_10179618
877 Ga0207707_10002031
878 Ga0207707_10002300
879 Ga0207707_10030665
880 Ga0207695_10009628
881 Ga0207695_10014133
882 Ga0207671_10013417
883 Ga0207671_10043569
884 Ga0207671_10117901
885 Ga0207671_10261343
886 Ga0207693_10000077
887 Ga0207693_10000108
888 Ga0207693_10001436
889 Ga0207693_10009317
890 Ga0207693_10025474
891 Ga0207693_10038484
892 Ga0207693_10047211
893 Ga0207693_10054955
894 Ga0207693_10136405
895 Ga0207693_10202447
896 Ga0207693_10224467
897 Ga0207663_10000092
898 Ga0207663_10007426
899 Ga0207663_10050111
900 Ga0207663_10058829
901 Ga0207663_10334473
902 Ga0207660_10264578
903 Ga0207657_10000627
904 Ga0207657_10004882
905 Ga0207649_10100859
906 Ga0207652_10038988
907 Ga0207652_10114839
908 Ga0207652_10287752
909 Ga0207646_10003451
910 Ga0207646_10549456
911 Ga0207694_10097360
912 Ga0207694_10376285
913 Ga0207650_10031830
914 Ga0207687_10118588
915 Ga0207700_10000142
916 Ga0207700_10002849
917 Ga0207700_10012468
918 Ga0207700_10013852
919 Ga0207700_10031191
920 Ga0207700_10034061
921 Ga0207700_10065178
922 Ga0207700_10165743
923 Ga0207700_10226190
924 Ga0207664_10000684
925 Ga0207664_10002905
926 Ga0207664_10014923
927 Ga0207664_10079662
928 Ga0207664_10126058
929 Ga0207664_10178128
930 Ga0207664_10202372
931 Ga0207664_10203485
932 Ga0207664_10482274
933 Ga0207690_10063068
934 Ga0207706_10022374
935 Ga0207706_10035960
936 Ga0207686_10008372
937 Ga0207686_10109019
938 Ga0207686_10123443
939 Ga0207686_10134300
940 Ga0207709_10124075
941 Ga0207704_10042849
942 Ga0207704_10350286
943 Ga0207665_10000008
944 Ga0207665_10000041
945 Ga0207665_10011058
946 Ga0207665_10016584
947 Ga0207665_10018142
948 Ga0207665_10028890
949 Ga0207665_10057695
950 Ga0207665_10069321
951 Ga0207665_10154179
952 Ga0207665_10202480
953 Ga0207665_10292509
954 Ga0207691_10046744
955 Ga0207711_10043469
956 Ga0207711_10103076
957 Ga0207711_10198049
958 Ga0207689_10000382
959 Ga0207689_10047255
960 Ga0207661_10151807
961 Ga0207679_10064309
962 Ga0207679_10106625
963 Ga0207667_10007967
964 Ga0207667_10012289
965 Ga0207667_10084151
966 Ga0207667_10091501
967 Ga0207667_10148623
968 Ga0207651_10263890
969 Ga0207640_10015596
970 Ga0207658_10205438
971 Ga0207677_10011739
972 Ga0207703_10002756
973 Ga0207703_10003794
974 Ga0207703_10036549
975 Ga0207703_10037166
976 Ga0207703_10052823
977 Ga0207639_10163522
978 Ga0207639_10206928
979 Ga0207708_10522300
980 Ga0207702_10000157
981 Ga0207702_10002196
982 Ga0207702_10007807
983 Ga0207702_10009335
984 Ga0207702_10011310
985 Ga0207702_10031428
986 Ga0207702_10091997
987 Ga0207641_10003094
988 Ga0207641_10023296
989 Ga0207641_10123031
990 Ga0207641_10136312
991 Ga0207641_10232950
992 Ga0207648_10010359
993 Ga0207648_10022928
994 Ga0207676_10027914
995 Ga0207676_10036071
996 Ga0207674_10004138
997 Ga0207674_10073445
998 Ga0207674_10436562
999 Ga0207675_100179977
1000 Ga0207698_10058034
1001 Ga0207698_10230161
1002 Ga0209588_1001364
1003 Ga0209588_1003984
1004 Ga0265354_1008860
1005 Ga0268264_10067539
1006 Ga0268264_10101401
1007 Ga0268264_10123433
1008 Ga0268264_10139917
1009 Ga0265322_10058016
1010 Ga0265338_10000716
1011 Ga0265338_10044521
1012 Ga0265338_10099121
1013 Ga0265338_10121647
1014 Ga0265760_10110491
1015 Ga0265325_10040686
1016 Ga0265339_10024299
1017 Ga0265339_10029320
1018 Ga0373934_0002869
1019 Ga0373934_0023105
1020 Ga0373936_0005888
1021 Ga0373945_0030399
1022 Ga0373953_0000999
1023 Ga0373953_0143457
1024 Ga0373954_0000283
1025 Ga0373954_0006500
1026 Ga0373957_0004952
1027 Ga0373957_0022441
1028 Ga0373943_0000493
1029 Ga0373943_0119855
1030 Ga0373946_0004414
1031 Ga0373955_0098386
1032 Ga0373924_0013541
1033 Ga0373931_0030002
1034 Ga0373935_0010863
1035 Ga0373935_0012544
1036 Ga0373927_0001171
1037 Ga0373927_0111971
1038 Ga0373933_0023079
1039 Ga0373933_0041473
1040 Ga0373933_0144536
1041 Ga0373947_0054033
1042 Ga0373937_0013216
1043 Ga0373937_0403779
1044 Ga0373925_0001178
1045 Ga0373925_0001655
1046 Ga0373925_0222653
1047 Ga0436364_0373893
1048 Ga0451577_0081525
1049 Ga0451577_0255264
1050 Ga0453683_0002491
1051 Ga0466965_0191389
1052 Ga0466963_0007096
1053 Ga0453684_0027987
1054 Ga0466957_0066204
1055 Ga0466959_0331394
1056 Ga0451576_0000661
1057 Ga0451576_0227768
1058 Ga0495629_0017465
1059 Ga0495653_0286881
1060 Ga0495580_0000469
1061 Ga0495580_0002264
1062 Ga0495582_0000277
1063 Ga0495582_0002349
1064 Ga0495664_0010575
1065 Ga0495664_0089626
1066 Ga0495584_0024105
1067 Ga0495608_0022278
1068 Ga0495630_0487416
1069 Ga0495652_0170913
1070 Ga0495665_0044556
1071 Ga0495587_0004519
1072 Ga0495658_0011276
1073 Ga0495658_0017745
1074 Ga0495600_0377654
1075 Ga0495674_0014607
1076 Ga0495674_0024859
1077 Ga0495674_0084579
1078 Ga0495684_0016622
1079 Ga0495602_0160006
1080 Ga0496101_0215886
1081 Ga0496102_0427781
1082 Ga0496104_0486610
1083 Ga0496104_0569433
1084 Ga0496107_0096106
1085 Ga0496112_0034144
1086 Ga0496113_0018763
1087 Ga0496114_0015259
1088 Ga0496114_0492302
1089 Ga0496115_0095667
1090 Ga0496115_0101965
1091 Ga0496126_0000095
1092 nmdc:mga0n895_13543_c1
1093 nmdc:mga0n895_187_c1
1094 nmdc:mga0n895_65654_c1
1095 nmdc:mga0rr50_14227_c1
1096 nmdc:mga0rr50_234757_c1
1097 nmdc:mga0rr50_23975_c1
1098 nmdc:mga0rr50_76968_c1
1099 nmdc:mga08x19_201797_c1
1100 nmdc:mga08x19_35240_c1
1101 nmdc:mga08x19_44339_c1
1102 nmdc:mga08x19_61403_c1
1103 Ga0495601_0026568
1104 Ga0495601_0061141
1105 Ga0466962_0012484
1106 2919682053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

54

246

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

299

0.91

PF08659

KR

KR domain

54

229

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t5q-assembly1.cif.gz_B crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis 0.937 1 251
4m8s-assembly1.cif.gz_D crystal structure of 3-ketoacyl -(acyl carrier protein) reductase (fabg) from neisseria meningitidis 0.9358 3 251
4ijk-assembly1.cif.gz_A crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9345 4 251
5t5q-assembly1.cif.gz_A crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis 0.9343 1 251
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9341 2 250
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 5 61 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 4 184 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 4 250 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9375 5 196 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 5 162 3.40.50.720
ID Description Score Start End GO Terms
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.9671 4 92
AF-A0A3D1G9F4-F1-model_v4 3-oxoacyl-ACP reductase 0.9636 6 94 GO:0016491
AF-A0A559M6V2-F1-model_v4 Putative oxidoreductase 0.952 1 94 GO:0016491
AF-A0A382JBS9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9514 3 88 GO:0016491
AF-A0A845DH81-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9468 5 80

Map