F462823

General Info

Members Datasets Scaffolds Average Seq Length
553 184 1106 303

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100013424|Ga0070680_1000134241
Length 326
Sequence MVPAPGQRRPVHGTRGDARGDVVKLSVEFPSVSYREGPAAVADLARAIERIGYDHIDIFDHVVMGVPIEGRARGPYNPQMPILEALMALSYMAAVTTRVTLGTEVLVLPQRQPALVAKQVSTLDTLSGGRVRLGVGVGWQESEYEALGEPFGTRGPRMDEAIRLMRAYWSDAEVTVPSPHYPTVSMAMEPKPPQGARLPIWIGGLSEAAFRRVGRLGDGWLASRVTDPVSARVAIDAIHRHAEAAGRDPQAIGLQSMVAPPPRDAAGKTFYADHAQVVARVAALKAMGFGWVALNATAIFQAGARSVAAMTEELHRLHDRIRAEVG

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
119 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.64
Stem 0
Stem Tuber 0
Unclassified 4.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100013424 3300005336 Bacteria 6378
2 Ga0070670_100024725 3300005331 Bacteria 5166
3 Ga0068869_100003653 3300005334 Bacteria 9450
4 Ga0068869_100034247 3300005334 Bacteria 3591
5 Ga0070680_100011598 3300005336 Bacteria 6827
6 Ga0070680_100252474 3300005336 Bacteria 1491
7 Ga0070682_100019715 3300005337 Bacteria 3960
8 Ga0070682_100030424 3300005337 Bacteria 3258
9 Ga0070660_100009100 3300005339 Bacteria 6971
10 Ga0070661_100052014 3300005344 Bacteria 2998
11 Ga0070692_10289490 3300005345 Bacteria 996
12 Ga0070669_100156010 3300005353 Bacteria 1770
13 Ga0070659_100014956 3300005366 Bacteria 5805
14 Ga0070659_100161654 3300005366 Bacteria 1831
15 Ga0070703_10011404 3300005406 Bacteria 2510
16 Ga0070703_10025538 3300005406 Unclassified 1753
17 Ga0070711_100048808 3300005439 Bacteria 2897
18 Ga0070705_100037444 3300005440 Bacteria 2736
19 Ga0070700_100044089 3300005441 Bacteria 2745
20 Ga0070694_100004079 3300005444 Bacteria 8761
21 Ga0070694_100020263 3300005444 Bacteria 4237
22 Ga0070694_100030518 3300005444 Bacteria 3527
23 Ga0070694_100045081 3300005444 Bacteria 2954
24 Ga0070694_100065375 3300005444 Unclassified 2491
25 Ga0070694_100167663 3300005444 Bacteria 1616
26 Ga0070708_100031437 3300005445 Bacteria 4594
27 Ga0070708_100089757 3300005445 Bacteria 2797
28 Ga0070708_100149318 3300005445 Unclassified 2173
29 Ga0070708_100175797 3300005445 Bacteria 2000
30 Ga0070708_100195528 3300005445 Bacteria 1892
31 Ga0070708_100204107 3300005445 Bacteria 1851
32 Ga0070708_100292534 3300005445 Bacteria 1533
33 Ga0070708_100366073 3300005445 Unclassified 1359
34 Ga0070708_100439850 3300005445 Bacteria 1230
35 Ga0070681_10026248 3300005458 Bacteria 5855
36 Ga0068867_100164166 3300005459 Bacteria 1754
37 Ga0068867_100216057 3300005459 Bacteria 1542
38 Ga0070706_100048755 3300005467 Bacteria 3908
39 Ga0070706_100103762 3300005467 Bacteria 2643
40 Ga0070706_100247266 3300005467 Bacteria 1665
41 Ga0070707_100001990 3300005468 Bacteria 19558
42 Ga0070707_100054367 3300005468 Bacteria 3838
43 Ga0070707_100072787 3300005468 Bacteria 3313
44 Ga0070707_100189042 3300005468 Bacteria 2008
45 Ga0070707_100453819 3300005468 Bacteria 1242
46 Ga0070698_100054964 3300005471 Bacteria 4040
47 Ga0070698_100075885 3300005471 Bacteria 3365
48 Ga0070698_100084162 3300005471 Bacteria 3169
49 Ga0070698_100264009 3300005471 Bacteria 1654
50 Ga0070699_100003494 3300005518 Bacteria 13891
51 Ga0070699_100023428 3300005518 Bacteria 5318
52 Ga0070699_100029767 3300005518 Bacteria 4709
53 Ga0070699_100106471 3300005518 Bacteria 2460
54 Ga0070699_100183751 3300005518 Bacteria 1856
55 Ga0070699_100198924 3300005518 Bacteria 1782
56 Ga0070699_100240847 3300005518 Unclassified 1615
57 Ga0070699_100337317 3300005518 Bacteria 1356
58 Ga0070679_100031804 3300005530 Bacteria 5218
59 Ga0070679_100060294 3300005530 Bacteria 3781
60 Ga0070697_100006412 3300005536 Bacteria 9108
61 Ga0070697_100010514 3300005536 Bacteria 7224
62 Ga0070697_100019755 3300005536 Bacteria 5322
63 Ga0070697_100120613 3300005536 Bacteria 2193
64 Ga0070697_100209417 3300005536 Bacteria 1659
65 Ga0070695_100000636 3300005545 Bacteria 18606
66 Ga0070695_100011092 3300005545 Bacteria 5386
67 Ga0070695_100053704 3300005545 Bacteria 2592
68 Ga0070695_100076004 3300005545 Bacteria 2211
69 Ga0070696_100022379 3300005546 Bacteria 4294
70 Ga0070696_100070736 3300005546 Bacteria 2455
71 Ga0070696_100076759 3300005546 Bacteria 2359
72 Ga0070696_100083494 3300005546 Bacteria 2266
73 Ga0070696_100279831 3300005546 Unclassified 1271
74 Ga0070704_100029617 3300005549 Bacteria 3658
75 Ga0070704_100030608 3300005549 Bacteria 3608
76 Ga0070704_100044096 3300005549 Bacteria 3097
77 Ga0070704_100084109 3300005549 Bacteria 2351
78 Ga0070704_100210645 3300005549 Bacteria 1574
79 Ga0068855_100025871 3300005563 Bacteria 7018
80 Ga0068855_100485209 3300005563 Bacteria 1345
81 Ga0070664_100016429 3300005564 Bacteria 6068
82 Ga0070664_100039054 3300005564 Bacteria 3998
83 Ga0068857_100014103 3300005577 Bacteria 6958
84 Ga0068857_100047709 3300005577 Bacteria 3803
85 Ga0068857_100222077 3300005577 Bacteria 1726
86 Ga0068854_100142977 3300005578 Bacteria 1838
87 Ga0068856_100024885 3300005614 Bacteria 5832
88 Ga0068856_100292599 3300005614 Bacteria 1645
89 Ga0068859_100023119 3300005617 Bacteria 6235
90 Ga0068859_100062161 3300005617 Bacteria 3764
91 Ga0068859_100095987 3300005617 Bacteria 3018
92 Ga0068859_100143983 3300005617 Bacteria 2457
93 Ga0068859_100474140 3300005617 Unclassified 1347
94 Ga0068864_100019061 3300005618 Bacteria 5734
95 Ga0068864_100157604 3300005618 Unclassified 2062
96 Ga0068864_100390158 3300005618 Unclassified 1321
97 Ga0068870_10021489 3300005840 Bacteria 3157
98 Ga0068863_100160844 3300005841 Archaea 2151
99 Ga0068863_100265710 3300005841 Bacteria 1659
100 Ga0068863_100467082 3300005841 Bacteria 1240
101 Ga0068858_100286643 3300005842 Unclassified 1569
102 Ga0068858_100298019 3300005842 Bacteria 1538
103 Ga0068860_100024199 3300005843 Bacteria 5872
104 Ga0068860_100055490 3300005843 Bacteria 3767
105 Ga0068860_100122024 3300005843 Bacteria 2496
106 Ga0068860_100123001 3300005843 Bacteria 2486
107 Ga0068862_100002631 3300005844 Bacteria 15813
108 Ga0068862_100008551 3300005844 Bacteria 8468
109 Ga0068862_100029819 3300005844 Bacteria 4597
110 Ga0068862_100057528 3300005844 Bacteria 3335
111 Ga0068862_100324172 3300005844 Bacteria 1423
112 Ga0068862_100391654 3300005844 Bacteria 1298
113 Ga0081455_10000080 3300005937 Bacteria 104190
114 Ga0081538_10005061 3300005981 Bacteria 11981
115 Ga0081538_10064460 3300005981 Bacteria 2072
116 Ga0081539_10000044 3300005985 Bacteria 284021
117 Ga0070716_100002206 3300006173 Bacteria 8968
118 Ga0070712_100008675 3300006175 Bacteria 6402
119 Ga0075428_100000562 3300006844 Bacteria 38031
120 Ga0075428_100004007 3300006844 Bacteria 16168
121 Ga0075428_100011737 3300006844 Bacteria 9753
122 Ga0075428_100012600 3300006844 Bacteria 9401
123 Ga0075428_100044836 3300006844 Bacteria 4860
124 Ga0075428_100068421 3300006844 Bacteria 3884
125 Ga0075428_100072938 3300006844 Bacteria 3749
126 Ga0075428_100181394 3300006844 Bacteria 2279
127 Ga0075428_100201592 3300006844 Bacteria 2151
128 Ga0075428_100487002 3300006844 Bacteria 1320
129 Ga0075428_100539748 3300006844 Bacteria 1247
130 Ga0075430_100000267 3300006846 Bacteria 36870
131 Ga0075430_100002144 3300006846 Bacteria 16333
132 Ga0075430_100010288 3300006846 Bacteria 7918
133 Ga0075430_100083174 3300006846 Bacteria 2681
134 Ga0075430_100109351 3300006846 Bacteria 2306
135 Ga0075430_100435019 3300006846 Bacteria 1083
136 Ga0075431_100000728 3300006847 Bacteria 28423
137 Ga0075431_100001052 3300006847 Bacteria 24662
138 Ga0075431_100002359 3300006847 Bacteria 18137
139 Ga0075431_100003078 3300006847 Bacteria 16159
140 Ga0075431_100014211 3300006847 Bacteria 8051
141 Ga0075431_100070429 3300006847 Bacteria 3609
142 Ga0075431_100165307 3300006847 Bacteria 2275
143 Ga0075431_100357733 3300006847 Bacteria 1467
144 Ga0075431_100380714 3300006847 Bacteria 1415
145 Ga0075433_10003625 3300006852 Bacteria 11929
146 Ga0075433_10007211 3300006852 Bacteria 8801
147 Ga0075433_10034572 3300006852 Bacteria 4342
148 Ga0075433_10035954 3300006852 Bacteria 4263
149 Ga0075433_10061398 3300006852 Bacteria 3292
150 Ga0075433_10063908 3300006852 Bacteria 3226
151 Ga0075433_10065961 3300006852 Bacteria 3175
152 Ga0075433_10073771 3300006852 Bacteria 3002
153 Ga0075433_10086745 3300006852 Bacteria 2764
154 Ga0075433_10115585 3300006852 Bacteria 2380
155 Ga0075433_10147760 3300006852 Bacteria 2090
156 Ga0075433_10292151 3300006852 Bacteria 1443
157 Ga0075434_100007048 3300006871 Bacteria 10372
158 Ga0075434_100013053 3300006871 Bacteria 7889
159 Ga0075434_100030509 3300006871 Bacteria 5309
160 Ga0075434_100034906 3300006871 Bacteria 4970
161 Ga0075434_100041658 3300006871 Bacteria 4549
162 Ga0075434_100041736 3300006871 Bacteria 4545
163 Ga0075434_100054110 3300006871 Bacteria 3987
164 Ga0075434_100114435 3300006871 Bacteria 2710
165 Ga0075434_100116235 3300006871 Bacteria 2688
166 Ga0075434_100121068 3300006871 Bacteria 2632
167 Ga0075434_100194316 3300006871 Bacteria 2049
168 Ga0075434_100267304 3300006871 Bacteria 1729
169 Ga0075434_100396947 3300006871 Unclassified 1400
170 Ga0075429_100005303 3300006880 Bacteria 11094
171 Ga0075429_100006906 3300006880 Bacteria 9860
172 Ga0075429_100010600 3300006880 Bacteria 7975
173 Ga0075429_100016505 3300006880 Bacteria 6398
174 Ga0075429_100039035 3300006880 Bacteria 4133
175 Ga0075429_100078580 3300006880 Bacteria 2876
176 Ga0075429_100162031 3300006880 Bacteria 1959
177 Ga0075436_100005212 3300006914 Bacteria 8946
178 Ga0075436_100012484 3300006914 Bacteria 5821
179 Ga0075436_100013453 3300006914 Bacteria 5602
180 Ga0075436_100090946 3300006914 Bacteria 2121
181 Ga0075436_100175723 3300006914 Bacteria 1512
182 Ga0097620_100023116 3300006931 Bacteria 6235
183 Ga0097620_100062161 3300006931 Bacteria 3764
184 Ga0097620_100095984 3300006931 Bacteria 3018
185 Ga0097620_100143976 3300006931 Bacteria 2457
186 Ga0097620_100474206 3300006931 Unclassified 1347
187 Ga0075435_100012573 3300007076 Bacteria 6270
188 Ga0075435_100016175 3300007076 Bacteria 5621
189 Ga0075435_100064944 3300007076 Bacteria 2966
190 Ga0075435_100066336 3300007076 Bacteria 2936
191 Ga0075435_100075622 3300007076 Bacteria 2758
192 Ga0075435_100105158 3300007076 Bacteria 2343
193 Ga0075435_100111964 3300007076 Bacteria 2271
194 Ga0075435_100215452 3300007076 Bacteria 1630
195 Ga0075435_100298335 3300007076 Bacteria 1378
196 Ga0099794_10031454 3300007265 Bacteria 2484
197 Ga0099794_10114708 3300007265 Bacteria 1352
198 Ga0111539_10000103 3300009094 Bacteria 91165
199 Ga0111539_10000236 3300009094 Bacteria 65842
200 Ga0111539_10086857 3300009094 Bacteria 3675
201 Ga0114129_10001191 3300009147 Bacteria 34529
202 Ga0114129_10003563 3300009147 Bacteria 21914
203 Ga0114129_10012024 3300009147 Bacteria 12313
204 Ga0114129_10012777 3300009147 Bacteria 11952
205 Ga0114129_10013524 3300009147 Bacteria 11630
206 Ga0114129_10015402 3300009147 Bacteria 10878
207 Ga0114129_10039027 3300009147 Bacteria 6694
208 Ga0114129_10070504 3300009147 Bacteria 4874
209 Ga0114129_10091450 3300009147 Bacteria 4216
210 Ga0114129_10113515 3300009147 Bacteria 3736
211 Ga0114129_10152998 3300009147 Bacteria 3156
212 Ga0114129_10153558 3300009147 Bacteria 3150
213 Ga0114129_10168287 3300009147 Bacteria 2989
214 Ga0114129_10174611 3300009147 Bacteria 2927
215 Ga0114129_10215291 3300009147 Bacteria 2594
216 Ga0114129_10259604 3300009147 Bacteria 2329
217 Ga0105243_10116475 3300009148 Bacteria 2245
218 Ga0105243_10263540 3300009148 Bacteria 1544
219 Ga0105241_10004162 3300009174 Bacteria 10684
220 Ga0105241_10095831 3300009174 Archaea 2350
221 Ga0105242_10048202 3300009176 Bacteria 3462
222 Ga0105242_10279276 3300009176 Bacteria 1516
223 Ga0105249_10015674 3300009553 Bacteria 6711
224 Ga0105249_10037121 3300009553 Bacteria 4422
225 Ga0105249_10086046 3300009553 Bacteria 2931
226 Ga0157373_10021336 3300013100 Bacteria 4705
227 Ga0157371_10212884 3300013102 Bacteria 1387
228 Ga0157378_10099157 3300013297 Bacteria 2657
229 Ga0157378_10227333 3300013297 Bacteria 1776
230 Ga0157378_10285529 3300013297 Unclassified 1592
231 Ga0163162_10088389 3300013306 Bacteria 3178
232 Ga0157372_10343816 3300013307 Bacteria 1738
233 Ga0157375_10230662 3300013308 Bacteria 2010
234 Ga0157380_10141590 3300014326 Bacteria 2067
235 Ga0163161_10417696 3300017792 Bacteria 1078
236 Ga0207653_10008602 3300025885 Bacteria 3180
237 Ga0207645_10000290 3300025907 Bacteria 42058
238 Ga0207645_10128973 3300025907 Bacteria 1645
239 Ga0207645_10277857 3300025907 Bacteria 1112
240 Ga0207643_10000270 3300025908 Bacteria 36152
241 Ga0207684_10008541 3300025910 Bacteria 9110
242 Ga0207684_10016743 3300025910 Bacteria 6295
243 Ga0207684_10019140 3300025910 Bacteria 5856
244 Ga0207684_10069236 3300025910 Bacteria 2999
245 Ga0207684_10093009 3300025910 Bacteria 2570
246 Ga0207684_10105986 3300025910 Bacteria 2404
247 Ga0207684_10115074 3300025910 Bacteria 2303
248 Ga0207684_10211893 3300025910 Bacteria 1671
249 Ga0207707_10000907 3300025912 Bacteria 28884
250 Ga0207707_10019980 3300025912 Bacteria 5845
251 Ga0207693_10002512 3300025915 Bacteria 15955
252 Ga0207663_10235446 3300025916 Bacteria 1340
253 Ga0207660_10008040 3300025917 Bacteria 6821
254 Ga0207660_10008425 3300025917 Bacteria 6668
255 Ga0207649_10010973 3300025920 Bacteria 4984
256 Ga0207652_10001521 3300025921 Bacteria 20469
257 Ga0207652_10019267 3300025921 Bacteria 5609
258 Ga0207646_10001050 3300025922 Bacteria 35163
259 Ga0207646_10004413 3300025922 Bacteria 15300
260 Ga0207646_10025215 3300025922 Bacteria 5441
261 Ga0207646_10049851 3300025922 Bacteria 3749
262 Ga0207646_10068688 3300025922 Bacteria 3165
263 Ga0207646_10080200 3300025922 Bacteria 2918
264 Ga0207646_10414391 3300025922 Bacteria 1216
265 Ga0207650_10048652 3300025925 Bacteria 3128
266 Ga0207650_10106602 3300025925 Bacteria 2164
267 Ga0207690_10002965 3300025932 Bacteria 10221
268 Ga0207706_10012410 3300025933 Bacteria 7764
269 Ga0207665_10000681 3300025939 Bacteria 22932
270 Ga0207691_10045103 3300025940 Bacteria 4055
271 Ga0207689_10000425 3300025942 Bacteria 39512
272 Ga0207689_10000947 3300025942 Bacteria 27911
273 Ga0207689_10039487 3300025942 Bacteria 3907
274 Ga0207679_10002962 3300025945 Bacteria 10527
275 Ga0207679_10419778 3300025945 Bacteria 1180
276 Ga0207667_10003229 3300025949 Bacteria 20130
277 Ga0207667_10427606 3300025949 Bacteria 1347
278 Ga0207712_10006985 3300025961 Bacteria 7120
279 Ga0207712_10067658 3300025961 Bacteria 2557
280 Ga0207712_10074296 3300025961 Bacteria 2454
281 Ga0207712_10529786 3300025961 Bacteria 1011
282 Ga0207703_10058248 3300026035 Bacteria 3152
283 Ga0207678_10086839 3300026067 Bacteria 2673
284 Ga0207708_10015970 3300026075 Bacteria 5638
285 Ga0207702_10001301 3300026078 Bacteria 24995
286 Ga0207702_10348206 3300026078 Bacteria 1417
287 Ga0207641_10045984 3300026088 Bacteria 3678
288 Ga0207641_10239238 3300026088 Bacteria 1691
289 Ga0207648_10224109 3300026089 Bacteria 1672
290 Ga0207676_10059757 3300026095 Bacteria 3012
291 Ga0207676_10165982 3300026095 Bacteria 1918
292 Ga0207676_10196747 3300026095 Bacteria 1778
293 Ga0207676_10364310 3300026095 Unclassified 1340
294 Ga0207674_10024455 3300026116 Bacteria 6454
295 Ga0207674_10029349 3300026116 Bacteria 5790
296 Ga0207675_100082451 3300026118 Bacteria 3016
297 Ga0207675_100234132 3300026118 Bacteria 1773
298 Ga0207675_100367879 3300026118 Bacteria 1412
299 Ga0209981_1027158 3300027378 Unclassified 833
300 Ga0209995_1000288 3300027471 Bacteria 7950
301 Ga0209968_1000394 3300027526 Bacteria 7110
302 Ga0209999_1002723 3300027543 Bacteria 3127
303 Ga0209970_1002976 3300027614 Bacteria 2860
304 Ga0209983_1000056 3300027665 Bacteria 16976
305 Ga0209588_1004005 3300027671 Bacteria 4123
306 Ga0209971_1000005 3300027682 Bacteria 108671
307 Ga0209966_1000010 3300027695 Bacteria 86172
308 Ga0209998_10000023 3300027717 Bacteria 65076
309 Ga0209974_10001388 3300027876 Bacteria 8739
310 Ga0207428_10000280 3300027907 Bacteria 68712
311 Ga0207428_10000725 3300027907 Bacteria 38077
312 Ga0207428_10083718 3300027907 Bacteria 2487
313 Ga0207428_10154592 3300027907 Bacteria 1745
314 Ga0268265_10006203 3300028380 Bacteria 8099
315 Ga0268265_10019170 3300028380 Bacteria 4750
316 Ga0268265_10037278 3300028380 Bacteria 3567
317 Ga0268265_10069569 3300028380 Unclassified 2734
318 Ga0268265_10140251 3300028380 Bacteria 2023
319 Ga0268265_10280080 3300028380 Bacteria 1492
320 Ga0268264_10125665 3300028381 Bacteria 2266
321 Ga0268264_10165416 3300028381 Bacteria 1996
322 Ga0268264_10210445 3300028381 Bacteria 1785
323 Ga0265327_10010574 3300031251 Bacteria 6466
324 Ga0265327_10086616 3300031251 Unclassified 1536
325 Ga0307408_100032023 3300031548 Bacteria 3665
326 Ga0307408_100191662 3300031548 Bacteria 1647
327 Ga0307407_10092825 3300031903 Bacteria 1855
328 Ga0307409_100345142 3300031995 Unclassified 1403
329 Ga0307416_100014036 3300032002 Bacteria 5468
330 Ga0307411_10024806 3300032005 Bacteria 3581
331 Ga0307411_10064190 3300032005 Bacteria 2458
332 Ga0373948_0029174 3300034817 Unclassified 1102
333 Ga0373950_0023762 3300034818 Bacteria 1098
334 Ga0373938_0036054 3300034957 Bacteria 1081
335 Ga0373940_0006187 3300035088 Bacteria 2640
336 Ga0373940_0011391 3300035088 Bacteria 2111
337 Ga0373951_0043792 3300035091 Bacteria 1086
338 Ga0373952_0002108 3300035092 Bacteria 3580
339 Ga0373932_0038068 3300035112 Bacteria 1374
340 Ga0373941_0070851 3300035115 Bacteria 1157
341 Ga0373941_0104670 3300035115 Bacteria 990
342 Ga0373931_0076930 3300035691 Bacteria 1834
343 Ga0395900_0001078 3300037418 Bacteria 34710
344 Ga0395898_0006969 3300037466 Bacteria 12016
345 Ga0395901_0001907 3300038443 Bacteria 21506
346 Ga0395901_0167259 3300038443 Bacteria 2308
347 Ga0400483_031057 3300039062 Bacteria 31352
348 Ga0400483_166005 3300039062 Bacteria 3935
349 Ga0439448_0001043 3300042005 Bacteria 6934
350 Ga0439455_0004131 3300042012 Bacteria 2851
351 Ga0439435_0028524 3300042436 Unclassified 1501
352 Ga0439459_0002650 3300042438 Bacteria 2775
353 Ga0439464_0001368 3300042439 Bacteria 5712
354 Ga0439460_0000199 3300042461 Bacteria 11811
355 Ga0450893_0027414 3300042532 Bacteria 1004
356 Ga0451577_0000807 3300042876 Bacteria 47174
357 Ga0451577_0011048 3300042876 Bacteria 8575
358 Ga0453683_0008631 3300044673 Bacteria 6833
359 Ga0453683_0019190 3300044673 Bacteria 4380
360 Ga0453684_0005495 3300044712 Bacteria 25049
361 Ga0453684_0284442 3300044712 Bacteria 1885
362 Ga0451576_0009781 3300045051 Bacteria 11082
363 Ga0451576_0018498 3300045051 Bacteria 7637
364 Ga0451576_0057985 3300045051 Bacteria 4047
365 Ga0451576_0142755 3300045051 Bacteria 2497
366 Ga0451576_0210770 3300045051 Bacteria 2029
367 Ga0451576_0308688 3300045051 Bacteria 1655
368 Ga0495603_0294043 3300046455 Bacteria 933
369 Ga0495580_0001249 3300046472 Bacteria 22435
370 Ga0495630_0141432 3300046517 Unclassified 1830
371 Ga0495659_0022497 3300046664 Bacteria 2134
372 Ga0495669_0026569 3300046684 Bacteria 2530
373 Ga0495600_0271472 3300046809 Unclassified 1076
374 Ga0501031_0031161 3300049568 Bacteria 3479
375 Ga0501031_0192237 3300049568 Bacteria 1333
376 Ga0501036_0014283 3300049572 Bacteria 6608
377 Ga0501036_0069138 3300049572 Bacteria 2988
378 Ga0501037_0114749 3300049573 Bacteria 1939
379 Ga0501037_0309748 3300049573 Bacteria 1095
380 Ga0501038_0056972 3300049574 Bacteria 3356
381 Ga0501038_0066557 3300049574 Bacteria 3068
382 Ga0501039_0033240 3300049575 Bacteria 3978
383 Ga0501039_0141728 3300049575 Bacteria 1888
384 Ga0501039_0146399 3300049575 Bacteria 1856
385 Ga0501039_0163315 3300049575 Bacteria 1751
386 Ga0501040_0005279 3300049576 Bacteria 8354
387 Ga0501040_0015782 3300049576 Bacteria 4993
388 Ga0501040_0067694 3300049576 Bacteria 2461
389 Ga0501040_0092205 3300049576 Bacteria 2106
390 Ga0501040_0132359 3300049576 Bacteria 1754
391 Ga0501040_0181056 3300049576 Bacteria 1494
392 Ga0501041_0008767 3300049577 Bacteria 5950
393 Ga0501041_0028703 3300049577 Bacteria 3356
394 Ga0501041_0092620 3300049577 Bacteria 1866
395 Ga0501041_0099989 3300049577 Bacteria 1795
396 Ga0501042_0038734 3300049578 Bacteria 3385
397 Ga0501042_0046159 3300049578 Bacteria 3105
398 Ga0501042_0085573 3300049578 Bacteria 2261
399 Ga0501042_0282382 3300049578 Bacteria 1199
400 Ga0501043_0036157 3300049579 Bacteria 3885
401 Ga0501046_0002963 3300049580 Bacteria 15704
402 Ga0501046_0066450 3300049580 Bacteria 2810
403 Ga0501046_0162657 3300049580 Bacteria 1678
404 Ga0501046_0224695 3300049580 Bacteria 1389
405 Ga0501047_0081044 3300049581 Bacteria 3120
406 Ga0501048_0004241 3300049582 Bacteria 10925
407 Ga0501048_0050410 3300049582 Bacteria 2965
408 Ga0501067_0039802 3300049583 Bacteria 2610
409 Ga0501068_0016646 3300049584 Bacteria 4240
410 Ga0501068_0081304 3300049584 Bacteria 1989
411 Ga0501068_0139997 3300049584 Bacteria 1517
412 Ga0501071_0030197 3300049587 Bacteria 3832
413 Ga0501072_0011672 3300049588 Bacteria 6712
414 Ga0501072_0024925 3300049588 Bacteria 4657
415 Ga0501072_0038519 3300049588 Bacteria 3752
416 Ga0501072_0058808 3300049588 Bacteria 3030
417 Ga0501072_0137420 3300049588 Bacteria 1949
418 Ga0501072_0142170 3300049588 Bacteria 1913
419 Ga0501072_0388441 3300049588 Bacteria 1107
420 Ga0501073_0133178 3300049589 Bacteria 1723
421 Ga0501074_0001659 3300049590 Bacteria 15119
422 Ga0501074_0023855 3300049590 Bacteria 4446
423 Ga0501074_0165317 3300049590 Bacteria 1580
424 Ga0501075_0016219 3300049591 Bacteria 5363
425 Ga0501075_0030420 3300049591 Bacteria 4000
426 Ga0501075_0032298 3300049591 Bacteria 3889
427 Ga0501075_0125574 3300049591 Bacteria 1953
428 Ga0501075_0139866 3300049591 Unclassified 1844
429 Ga0501075_0142933 3300049591 Bacteria 1824
430 Ga0501075_0220354 3300049591 Bacteria 1447
431 Ga0501075_0281403 3300049591 Bacteria 1267
432 Ga0501076_0000883 3300049592 Bacteria 19485
433 Ga0501076_0010534 3300049592 Bacteria 6862
434 Ga0501076_0044856 3300049592 Bacteria 3488
435 Ga0501076_0081379 3300049592 Bacteria 2600
436 Ga0501076_0342621 3300049592 Bacteria 1227
437 Ga0501077_0004868 3300049593 Bacteria 8153
438 Ga0501077_0007665 3300049593 Bacteria 6660
439 Ga0501077_0013927 3300049593 Bacteria 5042
440 Ga0501077_0032889 3300049593 Bacteria 3303
441 Ga0501079_0004214 3300049741 Bacteria 10669
442 Ga0501079_0028488 3300049741 Bacteria 4287
443 Ga0501079_0031147 3300049741 Bacteria 4099
444 Ga0501079_0042275 3300049741 Bacteria 3520
445 Ga0501079_0129878 3300049741 Unclassified 1960
446 Ga0501080_0040917 3300049742 Bacteria 4321
447 Ga0501080_0476447 3300049742 Bacteria 1117
448 Ga0501081_0000503 3300049743 Bacteria 21920
449 Ga0501081_0008663 3300049743 Bacteria 6609
450 Ga0501081_0014261 3300049743 Bacteria 5241
451 Ga0501081_0019615 3300049743 Bacteria 4504
452 Ga0501081_0097564 3300049743 Bacteria 2074
453 Ga0501081_0179916 3300049743 Bacteria 1529
454 Ga0501083_0049666 3300049744 Bacteria 2827
455 Ga0501045_0000520 3300049824 Bacteria 23954
456 Ga0501045_0007909 3300049824 Bacteria 7402
457 Ga0501045_0040938 3300049824 Bacteria 3370
458 Ga0501045_0090578 3300049824 Bacteria 2260
459 Ga0501045_0095933 3300049824 Bacteria 2194
460 Ga0501045_0138324 3300049824 Bacteria 1811
461 Ga0501045_0199180 3300049824 Bacteria 1492
462 Ga0501045_0389073 3300049824 Bacteria 1038
463 nmdc:mga05p37_101116_c1 3300050507 Bacteria 3551
464 nmdc:mga05p37_111793_c1 3300050507 Bacteria 3359
465 nmdc:mga05p37_112051_c1 3300050507 Bacteria 3355
466 nmdc:mga05p37_118721_c1 3300050507 Bacteria 3250
467 nmdc:mga05p37_1188_c1 3300050507 Bacteria 30065
468 nmdc:mga05p37_138889_c1 3300050507 Bacteria 2978
469 nmdc:mga05p37_139561_c1 3300050507 Bacteria 2970
470 nmdc:mga05p37_1608_c1 3300050507 Bacteria 15781
471 nmdc:mga05p37_207162_c1 3300050507 Bacteria 2372
472 nmdc:mga05p37_212_c1 3300050507 Bacteria 58811
473 nmdc:mga05p37_27566_c1 3300050507 Bacteria 6916
474 nmdc:mga05p37_290931_c1 3300050507 Bacteria 1945
475 nmdc:mga05p37_350906_c1 3300050507 Bacteria 1737
476 nmdc:mga05p37_41471_c1 3300050507 Bacteria 5651
477 nmdc:mga05p37_442581_c1 3300050507 Bacteria 1507
478 nmdc:mga05p37_47497_c1 3300050507 Bacteria 5279
479 nmdc:mga05p37_7876_c1 3300050507 Bacteria 12576
480 nmdc:mga09592_15526_c1 3300050508 Bacteria 6225
481 nmdc:mga09592_16549_c1 3300050508 Bacteria 6034
482 nmdc:mga09592_187175_c1 3300050508 Bacteria 1792
483 nmdc:mga09592_32798_c1 3300050508 Bacteria 4330
484 nmdc:mga09592_33176_c1 3300050508 Bacteria 4308
485 nmdc:mga09592_458_c1 3300050508 Bacteria 30397
486 nmdc:mga09592_74748_c1 3300050508 Bacteria 2879
487 nmdc:mga09592_992_c1 3300050508 Bacteria 22474
488 nmdc:mga0qj67_11447_c1 3300050509 Bacteria 6646
489 nmdc:mga0qj67_1306_c1 3300050509 Bacteria 17485
490 nmdc:mga0qj67_212562_c1 3300050509 Bacteria 1571
491 nmdc:mga0qj67_258494_c1 3300050509 Bacteria 1413
492 nmdc:mga0qj67_389959_c1 3300050509 Bacteria 1124
493 nmdc:mga0qj67_94944_c1 3300050509 Bacteria 2400
494 nmdc:mga06r32_102019_c1 3300050510 Bacteria 2816
495 nmdc:mga06r32_199777_c1 3300050510 Bacteria 1987
496 nmdc:mga06r32_2420_c1 3300050510 Bacteria 16703
497 nmdc:mga06r32_263000_c1 3300050510 Unclassified 1713
498 nmdc:mga06r32_28582_c1 3300050510 Bacteria 5221
499 nmdc:mga06r32_295600_c1 3300050510 Bacteria 1606
500 nmdc:mga06r32_304236_c1 3300050510 Bacteria 1580
501 nmdc:mga06r32_437566_c1 3300050510 Bacteria 1288
502 nmdc:mga06r32_6114_c1 3300050510 Bacteria 10811
503 nmdc:mga06r32_81571_c1 3300050510 Bacteria 3150
504 nmdc:mga06r32_886_c1 3300050510 Bacteria 26660
505 nmdc:mga08y16_35481_c1 3300050511 Bacteria 5237
506 nmdc:mga08y16_3612_c1 3300050511 Bacteria 16067
507 nmdc:mga08y16_361_c1 3300050511 Bacteria 40932
508 nmdc:mga08y16_49480_c1 3300050511 Bacteria 4399
509 nmdc:mga0n895_131702_c1 3300050512 Bacteria 2526
510 nmdc:mga0n895_136553_c1 3300050512 Bacteria 2479
511 nmdc:mga0n895_142149_c1 3300050512 Bacteria 2429
512 nmdc:mga0n895_3081_c1 3300050512 Bacteria 13264
513 nmdc:mga0n895_4606_c1 3300050512 Bacteria 11363
514 nmdc:mga0n895_96727_c1 3300050512 Bacteria 2957
515 nmdc:mga0rr50_185407_c1 3300050513 Bacteria 1703
516 nmdc:mga0rr50_191952_c1 3300050513 Bacteria 1674
517 nmdc:mga0rr50_2266_c1 3300050513 Bacteria 10791
518 nmdc:mga0rr50_329207_c1 3300050513 Bacteria 1282
519 nmdc:mga0rr50_46084_c1 3300050513 Bacteria 3209
520 nmdc:mga0rr50_57442_c1 3300050513 Bacteria 2911
521 nmdc:mga0rr50_69199_c1 3300050513 Bacteria 2686
522 nmdc:mga0rr50_90536_c1 3300050513 Bacteria 2381
523 nmdc:mga08x19_29985_c1 3300050514 Bacteria 3415
524 nmdc:mga08x19_36253_c1 3300050514 Bacteria 3123
525 nmdc:mga08x19_41223_c1 3300050514 Bacteria 2940
526 nmdc:mga08x19_79434_c1 3300050514 Bacteria 2151
527 nmdc:mga0a205_13076_c1 3300050515 Bacteria 7709
528 nmdc:mga0a205_148779_c1 3300050515 Bacteria 2242
529 nmdc:mga0a205_167232_c1 3300050515 Bacteria 2095
530 nmdc:mga0a205_187905_c1 3300050515 Bacteria 1958
531 nmdc:mga0a205_19486_c1 3300050515 Bacteria 6397
532 nmdc:mga0a205_263029_c1 3300050515 Bacteria 1603
533 nmdc:mga0a205_631_c2 3300050515 Bacteria 7828
534 nmdc:mga0a205_64330_c2 3300050515 Bacteria 3238
535 nmdc:mga0a205_65135_c1 3300050515 Bacteria 3520
536 nmdc:mga0a205_69079_c1 3300050515 Bacteria 3412
537 nmdc:mga0a205_7065_c1 3300050515 Bacteria 8414
538 nmdc:mga0a205_83164_c1 3300050515 Bacteria 3092
539 nmdc:mga0a205_8887_c1 3300050515 Bacteria 9155
540 nmdc:mga0a205_96068_c1 3300050515 Bacteria 2862
541 Ga0501084_0004565 3300054114 Bacteria 11318
542 Ga0501084_0034968 3300054114 Bacteria 4201
543 Ga0501084_0053379 3300054114 Bacteria 3381
544 Ga0501082_0000574 3300060353 Bacteria 32647
545 Ga0501082_0050893 3300060353 Bacteria 3571
546 Ga0501082_0067303 3300060353 Bacteria 3084
547 Ga0501082_0190855 3300060353 Bacteria 1782
548 Ga0501082_0357637 3300060353 Bacteria 1273
549 Ga0530510_0009265 3300061734 Bacteria 6907
550 Ga0530510_0032500 3300061734 Bacteria 3755
551 Ga0530510_0094994 3300061734 Bacteria 2177
552 Ga0530510_0126882 3300061734 Unclassified 1876
553 Ga0530510_0156048 3300061734 Bacteria 1687
554 Ga0070680_100013424
555 Ga0070670_100024725
556 Ga0068869_100003653
557 Ga0068869_100034247
558 Ga0070680_100011598
559 Ga0070680_100252474
560 Ga0070682_100019715
561 Ga0070682_100030424
562 Ga0070660_100009100
563 Ga0070661_100052014
564 Ga0070692_10289490
565 Ga0070669_100156010
566 Ga0070659_100014956
567 Ga0070659_100161654
568 Ga0070703_10011404
569 Ga0070703_10025538
570 Ga0070711_100048808
571 Ga0070705_100037444
572 Ga0070700_100044089
573 Ga0070694_100004079
574 Ga0070694_100020263
575 Ga0070694_100030518
576 Ga0070694_100045081
577 Ga0070694_100065375
578 Ga0070694_100167663
579 Ga0070708_100031437
580 Ga0070708_100089757
581 Ga0070708_100149318
582 Ga0070708_100175797
583 Ga0070708_100195528
584 Ga0070708_100204107
585 Ga0070708_100292534
586 Ga0070708_100366073
587 Ga0070708_100439850
588 Ga0070681_10026248
589 Ga0068867_100164166
590 Ga0068867_100216057
591 Ga0070706_100048755
592 Ga0070706_100103762
593 Ga0070706_100247266
594 Ga0070707_100001990
595 Ga0070707_100054367
596 Ga0070707_100072787
597 Ga0070707_100189042
598 Ga0070707_100453819
599 Ga0070698_100054964
600 Ga0070698_100075885
601 Ga0070698_100084162
602 Ga0070698_100264009
603 Ga0070699_100003494
604 Ga0070699_100023428
605 Ga0070699_100029767
606 Ga0070699_100106471
607 Ga0070699_100183751
608 Ga0070699_100198924
609 Ga0070699_100240847
610 Ga0070699_100337317
611 Ga0070679_100031804
612 Ga0070679_100060294
613 Ga0070697_100006412
614 Ga0070697_100010514
615 Ga0070697_100019755
616 Ga0070697_100120613
617 Ga0070697_100209417
618 Ga0070695_100000636
619 Ga0070695_100011092
620 Ga0070695_100053704
621 Ga0070695_100076004
622 Ga0070696_100022379
623 Ga0070696_100070736
624 Ga0070696_100076759
625 Ga0070696_100083494
626 Ga0070696_100279831
627 Ga0070704_100029617
628 Ga0070704_100030608
629 Ga0070704_100044096
630 Ga0070704_100084109
631 Ga0070704_100210645
632 Ga0068855_100025871
633 Ga0068855_100485209
634 Ga0070664_100016429
635 Ga0070664_100039054
636 Ga0068857_100014103
637 Ga0068857_100047709
638 Ga0068857_100222077
639 Ga0068854_100142977
640 Ga0068856_100024885
641 Ga0068856_100292599
642 Ga0068859_100023119
643 Ga0068859_100062161
644 Ga0068859_100095987
645 Ga0068859_100143983
646 Ga0068859_100474140
647 Ga0068864_100019061
648 Ga0068864_100157604
649 Ga0068864_100390158
650 Ga0068870_10021489
651 Ga0068863_100160844
652 Ga0068863_100265710
653 Ga0068863_100467082
654 Ga0068858_100286643
655 Ga0068858_100298019
656 Ga0068860_100024199
657 Ga0068860_100055490
658 Ga0068860_100122024
659 Ga0068860_100123001
660 Ga0068862_100002631
661 Ga0068862_100008551
662 Ga0068862_100029819
663 Ga0068862_100057528
664 Ga0068862_100324172
665 Ga0068862_100391654
666 Ga0081455_10000080
667 Ga0081538_10005061
668 Ga0081538_10064460
669 Ga0081539_10000044
670 Ga0070716_100002206
671 Ga0070712_100008675
672 Ga0075428_100000562
673 Ga0075428_100004007
674 Ga0075428_100011737
675 Ga0075428_100012600
676 Ga0075428_100044836
677 Ga0075428_100068421
678 Ga0075428_100072938
679 Ga0075428_100181394
680 Ga0075428_100201592
681 Ga0075428_100487002
682 Ga0075428_100539748
683 Ga0075430_100000267
684 Ga0075430_100002144
685 Ga0075430_100010288
686 Ga0075430_100083174
687 Ga0075430_100109351
688 Ga0075430_100435019
689 Ga0075431_100000728
690 Ga0075431_100001052
691 Ga0075431_100002359
692 Ga0075431_100003078
693 Ga0075431_100014211
694 Ga0075431_100070429
695 Ga0075431_100165307
696 Ga0075431_100357733
697 Ga0075431_100380714
698 Ga0075433_10003625
699 Ga0075433_10007211
700 Ga0075433_10034572
701 Ga0075433_10035954
702 Ga0075433_10061398
703 Ga0075433_10063908
704 Ga0075433_10065961
705 Ga0075433_10073771
706 Ga0075433_10086745
707 Ga0075433_10115585
708 Ga0075433_10147760
709 Ga0075433_10292151
710 Ga0075434_100007048
711 Ga0075434_100013053
712 Ga0075434_100030509
713 Ga0075434_100034906
714 Ga0075434_100041658
715 Ga0075434_100041736
716 Ga0075434_100054110
717 Ga0075434_100114435
718 Ga0075434_100116235
719 Ga0075434_100121068
720 Ga0075434_100194316
721 Ga0075434_100267304
722 Ga0075434_100396947
723 Ga0075429_100005303
724 Ga0075429_100006906
725 Ga0075429_100010600
726 Ga0075429_100016505
727 Ga0075429_100039035
728 Ga0075429_100078580
729 Ga0075429_100162031
730 Ga0075436_100005212
731 Ga0075436_100012484
732 Ga0075436_100013453
733 Ga0075436_100090946
734 Ga0075436_100175723
735 Ga0097620_100023116
736 Ga0097620_100062161
737 Ga0097620_100095984
738 Ga0097620_100143976
739 Ga0097620_100474206
740 Ga0075435_100012573
741 Ga0075435_100016175
742 Ga0075435_100064944
743 Ga0075435_100066336
744 Ga0075435_100075622
745 Ga0075435_100105158
746 Ga0075435_100111964
747 Ga0075435_100215452
748 Ga0075435_100298335
749 Ga0099794_10031454
750 Ga0099794_10114708
751 Ga0111539_10000103
752 Ga0111539_10000236
753 Ga0111539_10086857
754 Ga0114129_10001191
755 Ga0114129_10003563
756 Ga0114129_10012024
757 Ga0114129_10012777
758 Ga0114129_10013524
759 Ga0114129_10015402
760 Ga0114129_10039027
761 Ga0114129_10070504
762 Ga0114129_10091450
763 Ga0114129_10113515
764 Ga0114129_10152998
765 Ga0114129_10153558
766 Ga0114129_10168287
767 Ga0114129_10174611
768 Ga0114129_10215291
769 Ga0114129_10259604
770 Ga0105243_10116475
771 Ga0105243_10263540
772 Ga0105241_10004162
773 Ga0105241_10095831
774 Ga0105242_10048202
775 Ga0105242_10279276
776 Ga0105249_10015674
777 Ga0105249_10037121
778 Ga0105249_10086046
779 Ga0157373_10021336
780 Ga0157371_10212884
781 Ga0157378_10099157
782 Ga0157378_10227333
783 Ga0157378_10285529
784 Ga0163162_10088389
785 Ga0157372_10343816
786 Ga0157375_10230662
787 Ga0157380_10141590
788 Ga0163161_10417696
789 Ga0207653_10008602
790 Ga0207645_10000290
791 Ga0207645_10128973
792 Ga0207645_10277857
793 Ga0207643_10000270
794 Ga0207684_10008541
795 Ga0207684_10016743
796 Ga0207684_10019140
797 Ga0207684_10069236
798 Ga0207684_10093009
799 Ga0207684_10105986
800 Ga0207684_10115074
801 Ga0207684_10211893
802 Ga0207707_10000907
803 Ga0207707_10019980
804 Ga0207693_10002512
805 Ga0207663_10235446
806 Ga0207660_10008040
807 Ga0207660_10008425
808 Ga0207649_10010973
809 Ga0207652_10001521
810 Ga0207652_10019267
811 Ga0207646_10001050
812 Ga0207646_10004413
813 Ga0207646_10025215
814 Ga0207646_10049851
815 Ga0207646_10068688
816 Ga0207646_10080200
817 Ga0207646_10414391
818 Ga0207650_10048652
819 Ga0207650_10106602
820 Ga0207690_10002965
821 Ga0207706_10012410
822 Ga0207665_10000681
823 Ga0207691_10045103
824 Ga0207689_10000425
825 Ga0207689_10000947
826 Ga0207689_10039487
827 Ga0207679_10002962
828 Ga0207679_10419778
829 Ga0207667_10003229
830 Ga0207667_10427606
831 Ga0207712_10006985
832 Ga0207712_10067658
833 Ga0207712_10074296
834 Ga0207712_10529786
835 Ga0207703_10058248
836 Ga0207678_10086839
837 Ga0207708_10015970
838 Ga0207702_10001301
839 Ga0207702_10348206
840 Ga0207641_10045984
841 Ga0207641_10239238
842 Ga0207648_10224109
843 Ga0207676_10059757
844 Ga0207676_10165982
845 Ga0207676_10196747
846 Ga0207676_10364310
847 Ga0207674_10024455
848 Ga0207674_10029349
849 Ga0207675_100082451
850 Ga0207675_100234132
851 Ga0207675_100367879
852 Ga0209981_1027158
853 Ga0209995_1000288
854 Ga0209968_1000394
855 Ga0209999_1002723
856 Ga0209970_1002976
857 Ga0209983_1000056
858 Ga0209588_1004005
859 Ga0209971_1000005
860 Ga0209966_1000010
861 Ga0209998_10000023
862 Ga0209974_10001388
863 Ga0207428_10000280
864 Ga0207428_10000725
865 Ga0207428_10083718
866 Ga0207428_10154592
867 Ga0268265_10006203
868 Ga0268265_10019170
869 Ga0268265_10037278
870 Ga0268265_10069569
871 Ga0268265_10140251
872 Ga0268265_10280080
873 Ga0268264_10125665
874 Ga0268264_10165416
875 Ga0268264_10210445
876 Ga0265327_10010574
877 Ga0265327_10086616
878 Ga0307408_100032023
879 Ga0307408_100191662
880 Ga0307407_10092825
881 Ga0307409_100345142
882 Ga0307416_100014036
883 Ga0307411_10024806
884 Ga0307411_10064190
885 Ga0373948_0029174
886 Ga0373950_0023762
887 Ga0373938_0036054
888 Ga0373940_0006187
889 Ga0373940_0011391
890 Ga0373951_0043792
891 Ga0373952_0002108
892 Ga0373932_0038068
893 Ga0373941_0070851
894 Ga0373941_0104670
895 Ga0373931_0076930
896 Ga0395900_0001078
897 Ga0395898_0006969
898 Ga0395901_0001907
899 Ga0395901_0167259
900 Ga0400483_031057
901 Ga0400483_166005
902 Ga0439448_0001043
903 Ga0439455_0004131
904 Ga0439435_0028524
905 Ga0439459_0002650
906 Ga0439464_0001368
907 Ga0439460_0000199
908 Ga0450893_0027414
909 Ga0451577_0000807
910 Ga0451577_0011048
911 Ga0453683_0008631
912 Ga0453683_0019190
913 Ga0453684_0005495
914 Ga0453684_0284442
915 Ga0451576_0009781
916 Ga0451576_0018498
917 Ga0451576_0057985
918 Ga0451576_0142755
919 Ga0451576_0210770
920 Ga0451576_0308688
921 Ga0495603_0294043
922 Ga0495580_0001249
923 Ga0495630_0141432
924 Ga0495659_0022497
925 Ga0495669_0026569
926 Ga0495600_0271472
927 Ga0501031_0031161
928 Ga0501031_0192237
929 Ga0501036_0014283
930 Ga0501036_0069138
931 Ga0501037_0114749
932 Ga0501037_0309748
933 Ga0501038_0056972
934 Ga0501038_0066557
935 Ga0501039_0033240
936 Ga0501039_0141728
937 Ga0501039_0146399
938 Ga0501039_0163315
939 Ga0501040_0005279
940 Ga0501040_0015782
941 Ga0501040_0067694
942 Ga0501040_0092205
943 Ga0501040_0132359
944 Ga0501040_0181056
945 Ga0501041_0008767
946 Ga0501041_0028703
947 Ga0501041_0092620
948 Ga0501041_0099989
949 Ga0501042_0038734
950 Ga0501042_0046159
951 Ga0501042_0085573
952 Ga0501042_0282382
953 Ga0501043_0036157
954 Ga0501046_0002963
955 Ga0501046_0066450
956 Ga0501046_0162657
957 Ga0501046_0224695
958 Ga0501047_0081044
959 Ga0501048_0004241
960 Ga0501048_0050410
961 Ga0501067_0039802
962 Ga0501068_0016646
963 Ga0501068_0081304
964 Ga0501068_0139997
965 Ga0501071_0030197
966 Ga0501072_0011672
967 Ga0501072_0024925
968 Ga0501072_0038519
969 Ga0501072_0058808
970 Ga0501072_0137420
971 Ga0501072_0142170
972 Ga0501072_0388441
973 Ga0501073_0133178
974 Ga0501074_0001659
975 Ga0501074_0023855
976 Ga0501074_0165317
977 Ga0501075_0016219
978 Ga0501075_0030420
979 Ga0501075_0032298
980 Ga0501075_0125574
981 Ga0501075_0139866
982 Ga0501075_0142933
983 Ga0501075_0220354
984 Ga0501075_0281403
985 Ga0501076_0000883
986 Ga0501076_0010534
987 Ga0501076_0044856
988 Ga0501076_0081379
989 Ga0501076_0342621
990 Ga0501077_0004868
991 Ga0501077_0007665
992 Ga0501077_0013927
993 Ga0501077_0032889
994 Ga0501079_0004214
995 Ga0501079_0028488
996 Ga0501079_0031147
997 Ga0501079_0042275
998 Ga0501079_0129878
999 Ga0501080_0040917
1000 Ga0501080_0476447
1001 Ga0501081_0000503
1002 Ga0501081_0008663
1003 Ga0501081_0014261
1004 Ga0501081_0019615
1005 Ga0501081_0097564
1006 Ga0501081_0179916
1007 Ga0501083_0049666
1008 Ga0501045_0000520
1009 Ga0501045_0007909
1010 Ga0501045_0040938
1011 Ga0501045_0090578
1012 Ga0501045_0095933
1013 Ga0501045_0138324
1014 Ga0501045_0199180
1015 Ga0501045_0389073
1016 nmdc:mga05p37_101116_c1
1017 nmdc:mga05p37_111793_c1
1018 nmdc:mga05p37_112051_c1
1019 nmdc:mga05p37_118721_c1
1020 nmdc:mga05p37_1188_c1
1021 nmdc:mga05p37_138889_c1
1022 nmdc:mga05p37_139561_c1
1023 nmdc:mga05p37_1608_c1
1024 nmdc:mga05p37_207162_c1
1025 nmdc:mga05p37_212_c1
1026 nmdc:mga05p37_27566_c1
1027 nmdc:mga05p37_290931_c1
1028 nmdc:mga05p37_350906_c1
1029 nmdc:mga05p37_41471_c1
1030 nmdc:mga05p37_442581_c1
1031 nmdc:mga05p37_47497_c1
1032 nmdc:mga05p37_7876_c1
1033 nmdc:mga09592_15526_c1
1034 nmdc:mga09592_16549_c1
1035 nmdc:mga09592_187175_c1
1036 nmdc:mga09592_32798_c1
1037 nmdc:mga09592_33176_c1
1038 nmdc:mga09592_458_c1
1039 nmdc:mga09592_74748_c1
1040 nmdc:mga09592_992_c1
1041 nmdc:mga0qj67_11447_c1
1042 nmdc:mga0qj67_1306_c1
1043 nmdc:mga0qj67_212562_c1
1044 nmdc:mga0qj67_258494_c1
1045 nmdc:mga0qj67_389959_c1
1046 nmdc:mga0qj67_94944_c1
1047 nmdc:mga06r32_102019_c1
1048 nmdc:mga06r32_199777_c1
1049 nmdc:mga06r32_2420_c1
1050 nmdc:mga06r32_263000_c1
1051 nmdc:mga06r32_28582_c1
1052 nmdc:mga06r32_295600_c1
1053 nmdc:mga06r32_304236_c1
1054 nmdc:mga06r32_437566_c1
1055 nmdc:mga06r32_6114_c1
1056 nmdc:mga06r32_81571_c1
1057 nmdc:mga06r32_886_c1
1058 nmdc:mga08y16_35481_c1
1059 nmdc:mga08y16_3612_c1
1060 nmdc:mga08y16_361_c1
1061 nmdc:mga08y16_49480_c1
1062 nmdc:mga0n895_131702_c1
1063 nmdc:mga0n895_136553_c1
1064 nmdc:mga0n895_142149_c1
1065 nmdc:mga0n895_3081_c1
1066 nmdc:mga0n895_4606_c1
1067 nmdc:mga0n895_96727_c1
1068 nmdc:mga0rr50_185407_c1
1069 nmdc:mga0rr50_191952_c1
1070 nmdc:mga0rr50_2266_c1
1071 nmdc:mga0rr50_329207_c1
1072 nmdc:mga0rr50_46084_c1
1073 nmdc:mga0rr50_57442_c1
1074 nmdc:mga0rr50_69199_c1
1075 nmdc:mga0rr50_90536_c1
1076 nmdc:mga08x19_29985_c1
1077 nmdc:mga08x19_36253_c1
1078 nmdc:mga08x19_41223_c1
1079 nmdc:mga08x19_79434_c1
1080 nmdc:mga0a205_13076_c1
1081 nmdc:mga0a205_148779_c1
1082 nmdc:mga0a205_167232_c1
1083 nmdc:mga0a205_187905_c1
1084 nmdc:mga0a205_19486_c1
1085 nmdc:mga0a205_263029_c1
1086 nmdc:mga0a205_631_c2
1087 nmdc:mga0a205_64330_c2
1088 nmdc:mga0a205_65135_c1
1089 nmdc:mga0a205_69079_c1
1090 nmdc:mga0a205_7065_c1
1091 nmdc:mga0a205_83164_c1
1092 nmdc:mga0a205_8887_c1
1093 nmdc:mga0a205_96068_c1
1094 Ga0501084_0004565
1095 Ga0501084_0034968
1096 Ga0501084_0053379
1097 Ga0501082_0000574
1098 Ga0501082_0050893
1099 Ga0501082_0067303
1100 Ga0501082_0190855
1101 Ga0501082_0357637
1102 Ga0530510_0009265
1103 Ga0530510_0032500
1104 Ga0530510_0094994
1105 Ga0530510_0126882
1106 Ga0530510_0156048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

19

323

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c8n-assembly1.cif.gz_B crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8077 1 300
1luc-assembly1.cif.gz_A bacterial luciferase 0.8053 1 304
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8032 1 304
1luc-assembly1.cif.gz_A bacterial luciferase 0.8029 1 304
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8007 1 304
ID Description Score Start End Superfamily
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8852 20 272 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.855 1 273 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8448 2 303 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8416 2 303 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8339 2 303 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A348UQF0-F1-model_v4 Luciferase-like domain-containing protein 0.9785 2 304 GO:0008726
GO:0046306
AF-A0A348UQF0-F1-model_v4 Luciferase-like domain-containing protein 0.9721 2 304 GO:0008726
GO:0046306
AF-A0A2G8BDB0-F1-model_v4 Luciferase-like domain-containing protein 0.9371 1 304 GO:0008726
GO:0046306
AF-A0A653ESX8-F1-model_v4 Pyrimidine monooxygenase RutA 0.9349 1 297 GO:0008726
GO:0046306
AF-A0A2G8BDB0-F1-model_v4 Luciferase-like domain-containing protein 0.934 1 304 GO:0008726
GO:0046306

Map