F462786

General Info

Members Datasets Scaffolds Average Seq Length
552 277 1104 344

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0151633|Ga0501047_0151633_517_1548
Length 343
Sequence MVPTLIAQIGIVVVIWVALQLSAAVMVYAERKVAAYLQQRVGPTRVGPAGLLQPIADVIKLMFKEELRPAAADPLLFYVAPIISAVAAFAAFSVVPFGGSTTLLGLLAEPLNLEVADVNVAVLVVFAITSMGVYGIVLAGWSSNSKYSLLGGLRSSAQMISYELSYGMALAAVLVLANSMSLRDIVNAQSGSLFGIIPQFRWFVFFQPIGFLIFFIAGVAETNRAPFDFPEAEQELVAGYHTEYSSMSFGLFFLAEYINMVTVSAVATDLYLGGWWFPFVPESFGWLVFLAKISVLLFFYIWMRWSLPRYRYDQLMAFGWKVLLPVSVLNVIATAAGVLYFGL

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 0.91
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0151633 3300049581 Bacteria 2194
2 JGI24746J21847_1004217 3300001977 Bacteria 2270
3 JGI24750J21931_1001564 3300002070 Bacteria 2816
4 JGI24745J21846_1000914 3300002073 Bacteria 2748
5 Ga0065714_10072204 3300005288 Bacteria 3412
6 Ga0065712_10070470 3300005290 Bacteria 5982
7 Ga0065712_10075836 3300005290 Bacteria 3752
8 Ga0070658_10075296 3300005327 Bacteria 2769
9 Ga0070676_10009116 3300005328 Bacteria 5367
10 Ga0070683_100100664 3300005329 Bacteria 2720
11 Ga0070683_100103115 3300005329 Bacteria 2688
12 Ga0070690_100010549 3300005330 Bacteria 5382
13 Ga0070690_100204054 3300005330 Bacteria 1377
14 Ga0070670_100047811 3300005331 Bacteria 3682
15 Ga0070677_10000693 3300005333 Bacteria 11294
16 Ga0068869_100003252 3300005334 Bacteria 9928
17 Ga0070666_10012139 3300005335 Bacteria 5426
18 Ga0070666_10021991 3300005335 Bacteria 4138
19 Ga0070666_10109802 3300005335 Bacteria 1907
20 Ga0070680_100113330 3300005336 Bacteria 2258
21 Ga0070680_100142020 3300005336 Bacteria 2014
22 Ga0070680_100193764 3300005336 Bacteria 1713
23 Ga0070682_100318294 3300005337 Bacteria 1148
24 Ga0068868_100022053 3300005338 Bacteria 4802
25 Ga0068868_100049345 3300005338 Bacteria 3303
26 Ga0070660_100002101 3300005339 Bacteria 13741
27 Ga0070660_100200929 3300005339 Bacteria 1617
28 Ga0070689_100043463 3300005340 Bacteria 3454
29 Ga0070689_100235190 3300005340 Bacteria 1507
30 Ga0070689_100252048 3300005340 Bacteria 1457
31 Ga0070687_100003852 3300005343 Bacteria 5897
32 Ga0070668_100013130 3300005347 Bacteria 6174
33 Ga0070669_100005170 3300005353 Bacteria 9439
34 Ga0070669_100031818 3300005353 Bacteria 3810
35 Ga0070669_100127913 3300005353 Bacteria 1946
36 Ga0070669_100309650 3300005353 Bacteria 1272
37 Ga0070675_100000126 3300005354 Bacteria 45585
38 Ga0070675_100013014 3300005354 Bacteria 6533
39 Ga0070675_100264726 3300005354 Bacteria 1507
40 Ga0070671_100062947 3300005355 Bacteria 3089
41 Ga0070674_100096038 3300005356 Bacteria 2150
42 Ga0070673_100000690 3300005364 Bacteria 18661
43 Ga0070673_100035899 3300005364 Bacteria 3763
44 Ga0070673_100404905 3300005364 Bacteria 1221
45 Ga0070688_100016418 3300005365 Bacteria 4233
46 Ga0070688_100017879 3300005365 Bacteria 4077
47 Ga0070688_100020709 3300005365 Bacteria 3829
48 Ga0070688_100050003 3300005365 Bacteria 2603
49 Ga0070659_100027011 3300005366 Bacteria 4420
50 Ga0070659_100195266 3300005366 Bacteria 1665
51 Ga0070667_100009946 3300005367 Bacteria 7884
52 Ga0070709_10053015 3300005434 Bacteria 2552
53 Ga0070714_100050533 3300005435 Bacteria 3542
54 Ga0070713_100134339 3300005436 Bacteria 2185
55 Ga0070701_10027018 3300005438 Bacteria 2806
56 Ga0070705_100037348 3300005440 Bacteria 2739
57 Ga0070700_100015132 3300005441 Bacteria 4368
58 Ga0070700_100020842 3300005441 Bacteria 3804
59 Ga0070700_100023421 3300005441 Bacteria 3611
60 Ga0070700_100034040 3300005441 Bacteria 3073
61 Ga0070694_100014880 3300005444 Bacteria 4875
62 Ga0070694_100044907 3300005444 Bacteria 2959
63 Ga0070708_100031961 3300005445 Bacteria 4561
64 Ga0070663_100063329 3300005455 Bacteria 2670
65 Ga0070678_100004798 3300005456 Bacteria 7715
66 Ga0070678_100132984 3300005456 Bacteria 1979
67 Ga0070662_100014116 3300005457 Bacteria 5328
68 Ga0070662_100207998 3300005457 Bacteria 1556
69 Ga0070681_10221580 3300005458 Bacteria 1807
70 Ga0068867_100077239 3300005459 Bacteria 2502
71 Ga0068867_100136043 3300005459 Bacteria 1915
72 Ga0070685_10013655 3300005466 Bacteria 4288
73 Ga0070685_10180138 3300005466 Bacteria 1360
74 Ga0070707_100043580 3300005468 Bacteria 4294
75 Ga0070707_100189630 3300005468 Bacteria 2005
76 Ga0070698_100118139 3300005471 Bacteria 2613
77 Ga0070698_100241466 3300005471 Bacteria 1739
78 Ga0070698_100335289 3300005471 Bacteria 1444
79 Ga0070699_100009305 3300005518 Bacteria 8508
80 Ga0070679_100010924 3300005530 Bacteria 8628
81 Ga0070679_100017657 3300005530 Bacteria 6907
82 Ga0070679_100297894 3300005530 Bacteria 1564
83 Ga0070684_100014324 3300005535 Bacteria 6419
84 Ga0070697_100039640 3300005536 Bacteria 3810
85 Ga0070672_100005810 3300005543 Bacteria 8230
86 Ga0070686_100006981 3300005544 Bacteria 6294
87 Ga0070695_100044059 3300005545 Bacteria 2839
88 Ga0070696_100038755 3300005546 Bacteria 3290
89 Ga0070696_100149393 3300005546 Bacteria 1714
90 Ga0070693_100026270 3300005547 Bacteria 3142
91 Ga0070665_100026162 3300005548 Bacteria 5875
92 Ga0070665_100291043 3300005548 Bacteria 1636
93 Ga0070704_100245149 3300005549 Bacteria 1468
94 Ga0070704_100328976 3300005549 Bacteria 1283
95 Ga0068855_100040964 3300005563 Bacteria 5492
96 Ga0068855_100503511 3300005563 Bacteria 1316
97 Ga0070664_100005393 3300005564 Bacteria 10266
98 Ga0070664_100455719 3300005564 Bacteria 1175
99 Ga0068857_100118596 3300005577 Bacteria 2382
100 Ga0068854_100026170 3300005578 Bacteria 4007
101 Ga0068854_100026705 3300005578 Bacteria 3971
102 Ga0068856_100026269 3300005614 Bacteria 5678
103 Ga0070702_100005168 3300005615 Bacteria 6043
104 Ga0068852_100041501 3300005616 Bacteria 3889
105 Ga0068852_100493468 3300005616 Bacteria 1218
106 Ga0068859_100015581 3300005617 Bacteria 7640
107 Ga0068859_100224042 3300005617 Bacteria 1968
108 Ga0068864_100015549 3300005618 Bacteria 6328
109 Ga0068864_100043717 3300005618 Bacteria 3836
110 Ga0068866_10141662 3300005718 Bacteria 1381
111 Ga0068861_100004634 3300005719 Bacteria 9230
112 Ga0068870_10001414 3300005840 Bacteria 9693
113 Ga0068863_100010193 3300005841 Bacteria 9138
114 Ga0068863_100489042 3300005841 Bacteria 1211
115 Ga0068858_100011089 3300005842 Bacteria 8522
116 Ga0068858_100015917 3300005842 Bacteria 7066
117 Ga0068858_100110035 3300005842 Bacteria 2572
118 Ga0068858_100169950 3300005842 Bacteria 2055
119 Ga0068858_100188719 3300005842 Bacteria 1947
120 Ga0068860_100031570 3300005843 Bacteria 5092
121 Ga0068860_100052754 3300005843 Bacteria 3867
122 Ga0068860_100263379 3300005843 Bacteria 1681
123 Ga0068862_100007387 3300005844 Bacteria 9113
124 Ga0068862_100118946 3300005844 Bacteria 2327
125 Ga0068862_100120459 3300005844 Bacteria 2312
126 Ga0075364_10017344 3300006051 Bacteria 4497
127 Ga0075362_10000746 3300006177 Bacteria 9684
128 Ga0075367_10076777 3300006178 Bacteria 2016
129 Ga0097621_100000646 3300006237 Bacteria 24618
130 Ga0075370_10017428 3300006353 Bacteria 3881
131 Ga0068871_100000958 3300006358 Bacteria 19291
132 Ga0075428_100000295 3300006844 Bacteria 48665
133 Ga0075428_100001517 3300006844 Bacteria 24818
134 Ga0075428_100004388 3300006844 Bacteria 15572
135 Ga0075428_100062788 3300006844 Bacteria 4066
136 Ga0075428_100073237 3300006844 Bacteria 3741
137 Ga0075428_100324405 3300006844 Bacteria 1654
138 Ga0075430_100000640 3300006846 Bacteria 26659
139 Ga0075430_100003248 3300006846 Bacteria 13620
140 Ga0075430_100033466 3300006846 Bacteria 4362
141 Ga0075430_100041554 3300006846 Bacteria 3890
142 Ga0075430_100079109 3300006846 Bacteria 2756
143 Ga0075431_100004098 3300006847 Bacteria 14230
144 Ga0075431_100007716 3300006847 Bacteria 10715
145 Ga0075431_100014004 3300006847 Bacteria 8101
146 Ga0075431_100019376 3300006847 Bacteria 6934
147 Ga0075431_100074821 3300006847 Bacteria 3495
148 Ga0075431_100124505 3300006847 Bacteria 2660
149 Ga0075433_10013133 3300006852 Bacteria 6721
150 Ga0075433_10032578 3300006852 Bacteria 4464
151 Ga0075433_10102506 3300006852 Bacteria 2535
152 Ga0075433_10133307 3300006852 Bacteria 2208
153 Ga0075434_100008007 3300006871 Bacteria 9795
154 Ga0075434_100010265 3300006871 Bacteria 8775
155 Ga0075434_100016691 3300006871 Bacteria 7062
156 Ga0075434_100029900 3300006871 Bacteria 5362
157 Ga0075434_100032980 3300006871 Bacteria 5109
158 Ga0075434_100344070 3300006871 Bacteria 1512
159 Ga0075429_100000690 3300006880 Bacteria 26282
160 Ga0075429_100023000 3300006880 Bacteria 5403
161 Ga0075429_100043580 3300006880 Bacteria 3905
162 Ga0068865_100057791 3300006881 Bacteria 2707
163 Ga0075436_100003619 3300006914 Bacteria 10603
164 Ga0075436_100009419 3300006914 Bacteria 6676
165 Ga0075436_100095642 3300006914 Bacteria 2066
166 Ga0097620_100015581 3300006931 Bacteria 7640
167 Ga0097620_100224048 3300006931 Bacteria 1968
168 Ga0075435_100000177 3300007076 Bacteria 37596
169 Ga0075435_100000511 3300007076 Bacteria 23696
170 Ga0075435_100000948 3300007076 Bacteria 18280
171 Ga0075435_100010538 3300007076 Bacteria 6764
172 Ga0075435_100055969 3300007076 Bacteria 3187
173 Ga0075435_100102306 3300007076 Bacteria 2374
174 Ga0075435_100353576 3300007076 Bacteria 1259
175 Ga0105240_10026350 3300009093 Bacteria 7627
176 Ga0105240_10103506 3300009093 Bacteria 3459
177 Ga0111539_10000037 3300009094 Bacteria 143023
178 Ga0111539_10001120 3300009094 Bacteria 35438
179 Ga0111539_10001221 3300009094 Bacteria 34220
180 Ga0111539_10008348 3300009094 Bacteria 13180
181 Ga0111539_10013636 3300009094 Bacteria 10152
182 Ga0111539_10220065 3300009094 Bacteria 2211
183 Ga0111539_10594337 3300009094 Bacteria 1289
184 Ga0105247_10030071 3300009101 Bacteria 3293
185 Ga0114129_10003573 3300009147 Bacteria 21875
186 Ga0114129_10004316 3300009147 Bacteria 20102
187 Ga0114129_10008636 3300009147 Bacteria 14525
188 Ga0114129_10009195 3300009147 Bacteria 14088
189 Ga0114129_10014093 3300009147 Bacteria 11388
190 Ga0114129_10015583 3300009147 Bacteria 10808
191 Ga0114129_10055131 3300009147 Bacteria 5572
192 Ga0114129_10058845 3300009147 Bacteria 5375
193 Ga0105243_10009313 3300009148 Bacteria 7490
194 Ga0105243_10035459 3300009148 Bacteria 3868
195 Ga0105243_10272003 3300009148 Bacteria 1522
196 Ga0105241_10036009 3300009174 Bacteria 3724
197 Ga0105248_10014047 3300009177 Bacteria 8813
198 Ga0105248_10020126 3300009177 Bacteria 7394
199 Ga0105248_10062898 3300009177 Bacteria 4166
200 Ga0105248_10073860 3300009177 Bacteria 3833
201 Ga0105248_10090779 3300009177 Bacteria 3440
202 Ga0105248_10257393 3300009177 Bacteria 1965
203 Ga0105248_10345633 3300009177 Bacteria 1675
204 Ga0105238_10450627 3300009551 Bacteria 1284
205 Ga0105249_10125775 3300009553 Bacteria 2441
206 Ga0105249_10269239 3300009553 Bacteria 1696
207 Ga0105249_10345163 3300009553 Bacteria 1507
208 Ga0105246_10013824 3300011119 Bacteria 5066
209 Ga0163162_10042918 3300013306 Bacteria 4528
210 Ga0157372_10191479 3300013307 Bacteria 2369
211 Ga0157372_10347068 3300013307 Bacteria 1729
212 Ga0157375_10052540 3300013308 Bacteria 4006
213 Ga0163163_10113267 3300014325 Bacteria 2743
214 Ga0157380_10018212 3300014326 Bacteria 5212
215 Ga0157380_10079243 3300014326 Bacteria 2682
216 Ga0157380_10133292 3300014326 Bacteria 2123
217 Ga0157377_10001648 3300014745 Bacteria 9745
218 Ga0157377_10010613 3300014745 Bacteria 4563
219 Ga0157377_10158042 3300014745 Bacteria 1407
220 Ga0157379_10004249 3300014968 Bacteria 12230
221 Ga0157376_10046640 3300014969 Bacteria 3575
222 Ga0157376_10216955 3300014969 Bacteria 1769
223 Ga0163161_10047653 3300017792 Bacteria 3094
224 Ga0207673_1000992 3300025290 Bacteria 3047
225 Ga0207697_10000717 3300025315 Bacteria 18881
226 Ga0207697_10000732 3300025315 Bacteria 18618
227 Ga0207697_10111593 3300025315 Bacteria 1171
228 Ga0207682_10008497 3300025893 Bacteria 4059
229 Ga0207710_10039114 3300025900 Bacteria 2098
230 Ga0207688_10001322 3300025901 Bacteria 12879
231 Ga0207688_10009961 3300025901 Bacteria 5171
232 Ga0207680_10102798 3300025903 Bacteria 1839
233 Ga0207699_10093343 3300025906 Bacteria 1894
234 Ga0207645_10001706 3300025907 Bacteria 17831
235 Ga0207645_10010770 3300025907 Bacteria 6269
236 Ga0207643_10001193 3300025908 Bacteria 15345
237 Ga0207643_10017409 3300025908 Bacteria 3929
238 Ga0207705_10114453 3300025909 Bacteria 1996
239 Ga0207707_10230368 3300025912 Bacteria 1612
240 Ga0207695_10257574 3300025913 Bacteria 1643
241 Ga0207660_10055482 3300025917 Bacteria 2832
242 Ga0207660_10239181 3300025917 Bacteria 1430
243 Ga0207662_10002832 3300025918 Bacteria 8767
244 Ga0207662_10016049 3300025918 Bacteria 4222
245 Ga0207657_10027231 3300025919 Bacteria 5237
246 Ga0207657_10040558 3300025919 Bacteria 4124
247 Ga0207657_10149148 3300025919 Bacteria 1906
248 Ga0207657_10282770 3300025919 Bacteria 1317
249 Ga0207652_10026423 3300025921 Bacteria 4835
250 Ga0207646_10040980 3300025922 Bacteria 4164
251 Ga0207646_10064873 3300025922 Bacteria 3260
252 Ga0207681_10003863 3300025923 Bacteria 9307
253 Ga0207681_10009766 3300025923 Bacteria 5869
254 Ga0207681_10012372 3300025923 Bacteria 5265
255 Ga0207681_10207476 3300025923 Bacteria 1508
256 Ga0207681_10266953 3300025923 Bacteria 1342
257 Ga0207650_10030902 3300025925 Bacteria 3863
258 Ga0207650_10139048 3300025925 Bacteria 1908
259 Ga0207659_10000586 3300025926 Bacteria 21812
260 Ga0207659_10005817 3300025926 Bacteria 7516
261 Ga0207659_10013442 3300025926 Bacteria 5243
262 Ga0207659_10085346 3300025926 Bacteria 2345
263 Ga0207659_10095935 3300025926 Bacteria 2225
264 Ga0207659_10127835 3300025926 Bacteria 1957
265 Ga0207687_10128353 3300025927 Bacteria 1907
266 Ga0207700_10030091 3300025928 Bacteria 3841
267 Ga0207664_10127107 3300025929 Bacteria 2141
268 Ga0207644_10045900 3300025931 Bacteria 3110
269 Ga0207644_10052792 3300025931 Bacteria 2923
270 Ga0207690_10077857 3300025932 Bacteria 2306
271 Ga0207706_10002692 3300025933 Bacteria 17322
272 Ga0207709_10015349 3300025935 Bacteria 4246
273 Ga0207709_10046393 3300025935 Bacteria 2637
274 Ga0207670_10007636 3300025936 Bacteria 6052
275 Ga0207670_10016026 3300025936 Bacteria 4495
276 Ga0207665_10076235 3300025939 Bacteria 2299
277 Ga0207691_10000676 3300025940 Bacteria 33706
278 Ga0207691_10047190 3300025940 Bacteria 3954
279 Ga0207691_10291910 3300025940 Bacteria 1402
280 Ga0207711_10023960 3300025941 Bacteria 5109
281 Ga0207711_10053777 3300025941 Bacteria 3453
282 Ga0207711_10060421 3300025941 Bacteria 3266
283 Ga0207711_10080947 3300025941 Bacteria 2837
284 Ga0207711_10188401 3300025941 Bacteria 1879
285 Ga0207689_10002745 3300025942 Bacteria 16279
286 Ga0207689_10103677 3300025942 Bacteria 2337
287 Ga0207679_10003263 3300025945 Bacteria 10021
288 Ga0207679_10181299 3300025945 Bacteria 1742
289 Ga0207679_10399314 3300025945 Bacteria 1209
290 Ga0207667_10039375 3300025949 Bacteria 5038
291 Ga0207651_10003440 3300025960 Bacteria 7775
292 Ga0207651_10024415 3300025960 Bacteria 3739
293 Ga0207651_10353884 3300025960 Bacteria 1237
294 Ga0207712_10004344 3300025961 Bacteria 8955
295 Ga0207712_10005078 3300025961 Bacteria 8323
296 Ga0207712_10147093 3300025961 Bacteria 1815
297 Ga0207640_10063058 3300025981 Bacteria 2462
298 Ga0207640_10124852 3300025981 Bacteria 1851
299 Ga0207658_10029283 3300025986 Bacteria 3887
300 Ga0207677_10014269 3300026023 Bacteria 4634
301 Ga0207703_10034518 3300026035 Bacteria 4014
302 Ga0207703_10049313 3300026035 Bacteria 3404
303 Ga0207703_10089485 3300026035 Bacteria 2585
304 Ga0207678_10132093 3300026067 Bacteria 2130
305 Ga0207708_10002826 3300026075 Bacteria 12765
306 Ga0207708_10003593 3300026075 Bacteria 11431
307 Ga0207708_10240476 3300026075 Bacteria 1456
308 Ga0207708_10272816 3300026075 Bacteria 1368
309 Ga0207708_10404022 3300026075 Bacteria 1130
310 Ga0207702_10059407 3300026078 Bacteria 3257
311 Ga0207702_10135324 3300026078 Bacteria 2223
312 Ga0207641_10010305 3300026088 Bacteria 7682
313 Ga0207648_10005858 3300026089 Bacteria 12302
314 Ga0207648_10046413 3300026089 Bacteria 3809
315 Ga0207648_10131713 3300026089 Bacteria 2201
316 Ga0207648_10191616 3300026089 Bacteria 1812
317 Ga0207676_10031017 3300026095 Bacteria 4017
318 Ga0207676_10059239 3300026095 Bacteria 3023
319 Ga0207676_10159926 3300026095 Bacteria 1950
320 Ga0207674_10008877 3300026116 Bacteria 11563
321 Ga0207674_10167063 3300026116 Bacteria 2154
322 Ga0207675_100000149 3300026118 Bacteria 61117
323 Ga0207675_100083128 3300026118 Bacteria 3003
324 Ga0207675_100116442 3300026118 Bacteria 2525
325 Ga0207675_100150704 3300026118 Bacteria 2213
326 Ga0207683_10055481 3300026121 Bacteria 3474
327 Ga0207683_10060008 3300026121 Bacteria 3342
328 Ga0207683_10118218 3300026121 Bacteria 2378
329 Ga0207698_10188611 3300026142 Bacteria 1834
330 Ga0210002_1011469 3300027617 Bacteria 1369
331 Ga0209971_1017165 3300027682 Bacteria 1716
332 Ga0207428_10001068 3300027907 Bacteria 30064
333 Ga0207428_10003191 3300027907 Bacteria 16045
334 Ga0207428_10012687 3300027907 Bacteria 7389
335 Ga0207428_10017704 3300027907 Bacteria 6111
336 Ga0268266_10040490 3300028379 Bacteria 3971
337 Ga0268266_10177099 3300028379 Bacteria 1939
338 Ga0268265_10078866 3300028380 Bacteria 2591
339 Ga0268265_10331759 3300028380 Bacteria 1382
340 Ga0268264_10015584 3300028381 Bacteria 6230
341 Ga0307408_100039675 3300031548 Bacteria 3330
342 Ga0307408_100199181 3300031548 Bacteria 1619
343 Ga0307408_100275399 3300031548 Bacteria 1399
344 Ga0265314_10209772 3300031711 Bacteria 1145
345 Ga0307410_10031322 3300031852 Bacteria 3412
346 Ga0307409_100014613 3300031995 Bacteria 5116
347 Ga0307409_100020788 3300031995 Bacteria 4483
348 Ga0307409_100226555 3300031995 Bacteria 1691
349 Ga0307416_100019683 3300032002 Bacteria 4793
350 Ga0307416_100111565 3300032002 Bacteria 2411
351 Ga0307416_100273826 3300032002 Bacteria 1659
352 Ga0307414_10065988 3300032004 Bacteria 2585
353 Ga0307411_10057464 3300032005 Bacteria 2570
354 Ga0307411_10233037 3300032005 Bacteria 1436
355 Ga0307415_100031504 3300032126 Bacteria 3417
356 Ga0307415_100193290 3300032126 Bacteria 1608
357 Ga0373950_0003933 3300034818 Bacteria 2157
358 Ga0373958_0000318 3300034819 Bacteria 5819
359 Ga0373959_0001888 3300034820 Bacteria 3343
360 Ga0373934_0055701 3300035086 Bacteria 1572
361 Ga0373949_0005555 3300035090 Bacteria 2811
362 Ga0373949_0013958 3300035090 Bacteria 1786
363 Ga0373949_0021602 3300035090 Bacteria 1478
364 Ga0373951_0001651 3300035091 Bacteria 5853
365 Ga0373952_0000341 3300035092 Bacteria 7886
366 Ga0373932_0004164 3300035112 Bacteria 3437
367 Ga0373939_0000785 3300035114 Bacteria 7825
368 Ga0373941_0002462 3300035115 Bacteria 4079
369 Ga0373960_0000213 3300035121 Bacteria 10646
370 Ga0373943_0003818 3300035170 Bacteria 6847
371 Ga0373943_0024456 3300035170 Bacteria 2816
372 Ga0373942_0003944 3300035207 Bacteria 3464
373 Ga0373961_0002356 3300035241 Bacteria 4930
374 Ga0373961_0027500 3300035241 Bacteria 1562
375 Ga0373962_0014072 3300035242 Bacteria 2034
376 Ga0373931_0006673 3300035691 Bacteria 5408
377 Ga0373931_0034667 3300035691 Bacteria 2621
378 Ga0373927_0017106 3300035695 Bacteria 4778
379 Ga0373947_0149071 3300035725 Bacteria 1505
380 Ga0373937_0025518 3300036401 Bacteria 5335
381 Ga0373937_0069137 3300036401 Bacteria 3255
382 Ga0373925_0021656 3300037068 Bacteria 4685
383 Ga0436365_0682714 3300039437 Bacteria 1794
384 Ga0436365_1775937 3300039437 Bacteria 3607
385 Ga0439433_0011357 3300041999 Bacteria 1951
386 Ga0439441_013941 3300042001 Bacteria 1402
387 Ga0439450_010750 3300042008 Bacteria 1773
388 Ga0439462_0063433 3300042015 Bacteria 1000
389 Ga0450895_002450 3300042132 Bacteria 1382
390 Ga0439446_0017402 3300042156 Bacteria 2009
391 Ga0439434_0013184 3300042435 Bacteria 2452
392 Ga0439435_0009370 3300042436 Bacteria 2295
393 Ga0439435_0012867 3300042436 Bacteria 2037
394 Ga0439435_0018425 3300042436 Bacteria 1776
395 Ga0439464_0005716 3300042439 Bacteria 3225
396 Ga0439464_0059016 3300042439 Bacteria 1121
397 Ga0451577_0125270 3300042876 Bacteria 2302
398 Ga0451576_0043767 3300045051 Bacteria 4722
399 Ga0451576_0094215 3300045051 Bacteria 3114
400 Ga0451576_0135488 3300045051 Bacteria 2568
401 Ga0451576_0413399 3300045051 Bacteria 1415
402 Ga0466958_0136682 3300045836 Bacteria 1542
403 Ga0495629_0239063 3300046459 Bacteria 1251
404 Ga0495580_0045647 3300046472 Bacteria 3112
405 Ga0495582_0173611 3300046473 Bacteria 1227
406 Ga0495639_0044046 3300046475 Bacteria 2017
407 Ga0495608_0020487 3300046511 Bacteria 4545
408 Ga0495608_0163853 3300046511 Bacteria 1413
409 Ga0495618_0143183 3300046514 Bacteria 1529
410 Ga0495630_0024119 3300046517 Bacteria 4498
411 Ga0495663_0031532 3300046525 Bacteria 1575
412 Ga0495640_0078558 3300046533 Bacteria 2198
413 Ga0495587_0022433 3300046536 Bacteria 3888
414 Ga0495621_0050051 3300046539 Bacteria 1492
415 Ga0495621_0050230 3300046539 Bacteria 1490
416 Ga0495667_0034577 3300046559 Bacteria 3379
417 Ga0495656_0039211 3300046615 Bacteria 1967
418 Ga0495656_0042749 3300046615 Bacteria 1899
419 Ga0495634_0061248 3300046642 Bacteria 2502
420 Ga0495635_0049123 3300046663 Bacteria 2908
421 Ga0495623_0125562 3300046679 Bacteria 1541
422 Ga0495646_0164759 3300046680 Bacteria 1225
423 Ga0495613_0000318 3300046689 Bacteria 43663
424 Ga0495604_0031688 3300047317 Bacteria 4193
425 Ga0495674_0061542 3300047319 Bacteria 3271
426 Ga0495674_0107881 3300047319 Bacteria 2363
427 Ga0495680_0160177 3300047322 Bacteria 1635
428 Ga0495684_0000053 3300047471 Bacteria 82157
429 Ga0495602_0128724 3300048088 Bacteria 2023
430 Ga0496102_0103884 3300048905 Bacteria 2643
431 Ga0496104_0385879 3300048907 Bacteria 1313
432 Ga0496105_0242056 3300048908 Bacteria 1464
433 Ga0496109_0027806 3300048912 Bacteria 5054
434 Ga0496112_0165059 3300048915 Bacteria 2180
435 Ga0501031_0028667 3300049568 Bacteria 3630
436 Ga0501033_0134312 3300049570 Bacteria 1791
437 Ga0501034_0020238 3300049571 Bacteria 6795
438 Ga0501034_0221381 3300049571 Bacteria 1845
439 Ga0501036_0060721 3300049572 Bacteria 3202
440 Ga0501036_0207720 3300049572 Bacteria 1646
441 Ga0501036_0248055 3300049572 Bacteria 1492
442 Ga0501038_0100101 3300049574 Bacteria 2415
443 Ga0501039_0058277 3300049575 Bacteria 2991
444 Ga0501040_0067255 3300049576 Bacteria 2469
445 Ga0501040_0209231 3300049576 Bacteria 1386
446 Ga0501041_0012600 3300049577 Bacteria 5009
447 Ga0501041_0028534 3300049577 Bacteria 3366
448 Ga0501042_0017154 3300049578 Bacteria 4989
449 Ga0501046_0003786 3300049580 Bacteria 13848
450 Ga0501046_0056943 3300049580 Bacteria 3067
451 Ga0501047_0068122 3300049581 Bacteria 3429
452 Ga0501048_0099355 3300049582 Bacteria 2053
453 Ga0501068_0118578 3300049584 Bacteria 1649
454 Ga0501071_0020487 3300049587 Bacteria 4596
455 Ga0501071_0040967 3300049587 Bacteria 3316
456 Ga0501071_0146800 3300049587 Bacteria 1758
457 Ga0501072_0080262 3300049588 Bacteria 2584
458 Ga0501072_0084472 3300049588 Bacteria 2517
459 Ga0501072_0096244 3300049588 Bacteria 2353
460 Ga0501072_0180475 3300049588 Bacteria 1684
461 Ga0501074_0057226 3300049590 Bacteria 2809
462 Ga0501075_0016140 3300049591 Bacteria 5375
463 Ga0501075_0025261 3300049591 Bacteria 4365
464 Ga0501075_0038636 3300049591 Bacteria 3569
465 Ga0501076_0002349 3300049592 Bacteria 12942
466 Ga0501076_0006608 3300049592 Bacteria 8410
467 Ga0501076_0017306 3300049592 Bacteria 5476
468 Ga0501076_0098852 3300049592 Bacteria 2351
469 Ga0501076_0338303 3300049592 Bacteria 1235
470 Ga0501077_0025276 3300049593 Bacteria 3772
471 Ga0501077_0033000 3300049593 Bacteria 3296
472 Ga0501235_031474 3300049669 Bacteria 1198
473 Ga0501079_0002285 3300049741 Bacteria 13845
474 Ga0501079_0133106 3300049741 Bacteria 1935
475 Ga0501079_0305899 3300049741 Bacteria 1244
476 Ga0501081_0028820 3300049743 Bacteria 3748
477 Ga0501035_0268375 3300049822 Bacteria 1445
478 Ga0501045_0003977 3300049824 Bacteria 10174
479 Ga0501045_0016220 3300049824 Bacteria 5287
480 Ga0501045_0071237 3300049824 Bacteria 2558
481 nmdc:mga03683_18662_c1 3300050489 Bacteria 2639
482 nmdc:mga00v17_3790_c1 3300050491 Bacteria 5428
483 nmdc:mga0yw44_13906_c1 3300050492 Bacteria 4254
484 nmdc:mga0k408_8033_c1 3300050493 Bacteria 5656
485 nmdc:mga0k408_8489_c1 3300050493 Bacteria 5517
486 nmdc:mga05p37_1291_c1 3300050507 Bacteria 29083
487 nmdc:mga05p37_1981_c1 3300050507 Bacteria 23880
488 nmdc:mga05p37_2046_c1 3300050507 Bacteria 23526
489 nmdc:mga05p37_21247_c1 3300050507 Bacteria 7858
490 nmdc:mga05p37_2447_c1 3300050507 Bacteria 21583
491 nmdc:mga05p37_368308_c1 3300050507 Bacteria 1687
492 nmdc:mga05p37_36837_c2 3300050507 Bacteria 5679
493 nmdc:mga05p37_449541_c1 3300050507 Bacteria 1492
494 nmdc:mga05p37_526476_c1 3300050507 Bacteria 1351
495 nmdc:mga05p37_8178_c1 3300050507 Bacteria 12363
496 nmdc:mga05p37_8567_c1 3300050507 Bacteria 12090
497 nmdc:mga09592_128436_c1 3300050508 Bacteria 2180
498 nmdc:mga09592_20926_c1 3300050508 Bacteria 5387
499 nmdc:mga09592_4978_c1 3300050508 Bacteria 10767
500 nmdc:mga09592_55588_c1 3300050508 Bacteria 3345
501 nmdc:mga0qj67_1983_c1 3300050509 Bacteria 14579
502 nmdc:mga0qj67_24872_c1 3300050509 Bacteria 4621
503 nmdc:mga0qj67_5153_c1 3300050509 Bacteria 9527
504 nmdc:mga0qj67_6470_c1 3300050509 Bacteria 8609
505 nmdc:mga0qj67_65521_c1 3300050509 Bacteria 2892
506 nmdc:mga0qj67_76380_c1 3300050509 Bacteria 2679
507 nmdc:mga06r32_10057_c1 3300050510 Bacteria 8537
508 nmdc:mga06r32_1463_c1 3300050510 Bacteria 21258
509 nmdc:mga06r32_67611_c1 3300050510 Bacteria 3450
510 nmdc:mga06r32_87558_c1 3300050510 Bacteria 3039
511 nmdc:mga06r32_93035_c1 3300050510 Bacteria 2948
512 nmdc:mga06r32_9552_c1 3300050510 Bacteria 8758
513 nmdc:mga08y16_10217_c1 3300050511 Bacteria 9852
514 nmdc:mga08y16_3529_c1 3300050511 Bacteria 16237
515 nmdc:mga08y16_87_c1 3300050511 Bacteria 77764
516 nmdc:mga0n895_11526_c1 3300050512 Bacteria 7893
517 nmdc:mga0n895_41549_c1 3300050512 Bacteria 4472
518 nmdc:mga0n895_631179_c1 3300050512 Bacteria 1071
519 nmdc:mga0n895_6550_c1 3300050512 Bacteria 9910
520 nmdc:mga0n895_780_c1 3300050512 Bacteria 22660
521 nmdc:mga0n895_8937_c1 3300050512 Bacteria 8732
522 nmdc:mga0n895_96956_c1 3300050512 Bacteria 2954
523 nmdc:mga0rr50_159109_c1 3300050513 Bacteria 1832
524 nmdc:mga0rr50_16_c1 3300050513 Bacteria 175739
525 nmdc:mga0rr50_170743_c1 3300050513 Bacteria 1772
526 nmdc:mga0rr50_41842_c1 3300050513 Bacteria 3342
527 nmdc:mga0rr50_8665_c1 3300050513 Bacteria 6341
528 nmdc:mga08x19_137_c1 3300050514 Bacteria 65227
529 nmdc:mga08x19_229337_c1 3300050514 Bacteria 1278
530 nmdc:mga0a205_15119_c1 3300050515 Bacteria 7210
531 nmdc:mga0a205_18629_c1 3300050515 Bacteria 6531
532 nmdc:mga0a205_42207_c1 3300050515 Bacteria 4394
533 nmdc:mga0a205_74704_c1 3300050515 Bacteria 3275
534 nmdc:mga0a205_8237_c2 3300050515 Bacteria 7691
535 nmdc:mga0a205_89293_c1 3300050515 Bacteria 2979
536 Ga0495612_0117770 3300053078 Bacteria 1141
537 Ga0495619_0003752 3300053085 Bacteria 9786
538 Ga0495619_0010615 3300053085 Bacteria 5795
539 Ga0501084_0012966 3300054114 Bacteria 6902
540 Ga0501084_0128015 3300054114 Bacteria 2137
541 Ga0501084_0245367 3300054114 Bacteria 1512
542 Ga0590071_000424 3300059421 Bacteria 12355
543 Ga0590071_015521 3300059421 Bacteria 1786
544 Ga0590074_003194 3300059423 Bacteria 2703
545 Ga0590075_002816 3300059424 Bacteria 4149
546 Ga0590075_031455 3300059424 Bacteria 1346
547 Ga0590077_001886 3300059426 Bacteria 4651
548 Ga0501082_0248685 3300060353 Bacteria 1547
549 Ga0501082_0249063 3300060353 Bacteria 1546
550 Ga0501082_0299036 3300060353 Bacteria 1401
551 Ga0530510_0004651 3300061734 Bacteria 9494
552 Ga0530510_0027049 3300061734 Bacteria 4109
553 Ga0501047_0151633
554 JGI24746J21847_1004217
555 JGI24750J21931_1001564
556 JGI24745J21846_1000914
557 Ga0065714_10072204
558 Ga0065712_10070470
559 Ga0065712_10075836
560 Ga0070658_10075296
561 Ga0070676_10009116
562 Ga0070683_100100664
563 Ga0070683_100103115
564 Ga0070690_100010549
565 Ga0070690_100204054
566 Ga0070670_100047811
567 Ga0070677_10000693
568 Ga0068869_100003252
569 Ga0070666_10012139
570 Ga0070666_10021991
571 Ga0070666_10109802
572 Ga0070680_100113330
573 Ga0070680_100142020
574 Ga0070680_100193764
575 Ga0070682_100318294
576 Ga0068868_100022053
577 Ga0068868_100049345
578 Ga0070660_100002101
579 Ga0070660_100200929
580 Ga0070689_100043463
581 Ga0070689_100235190
582 Ga0070689_100252048
583 Ga0070687_100003852
584 Ga0070668_100013130
585 Ga0070669_100005170
586 Ga0070669_100031818
587 Ga0070669_100127913
588 Ga0070669_100309650
589 Ga0070675_100000126
590 Ga0070675_100013014
591 Ga0070675_100264726
592 Ga0070671_100062947
593 Ga0070674_100096038
594 Ga0070673_100000690
595 Ga0070673_100035899
596 Ga0070673_100404905
597 Ga0070688_100016418
598 Ga0070688_100017879
599 Ga0070688_100020709
600 Ga0070688_100050003
601 Ga0070659_100027011
602 Ga0070659_100195266
603 Ga0070667_100009946
604 Ga0070709_10053015
605 Ga0070714_100050533
606 Ga0070713_100134339
607 Ga0070701_10027018
608 Ga0070705_100037348
609 Ga0070700_100015132
610 Ga0070700_100020842
611 Ga0070700_100023421
612 Ga0070700_100034040
613 Ga0070694_100014880
614 Ga0070694_100044907
615 Ga0070708_100031961
616 Ga0070663_100063329
617 Ga0070678_100004798
618 Ga0070678_100132984
619 Ga0070662_100014116
620 Ga0070662_100207998
621 Ga0070681_10221580
622 Ga0068867_100077239
623 Ga0068867_100136043
624 Ga0070685_10013655
625 Ga0070685_10180138
626 Ga0070707_100043580
627 Ga0070707_100189630
628 Ga0070698_100118139
629 Ga0070698_100241466
630 Ga0070698_100335289
631 Ga0070699_100009305
632 Ga0070679_100010924
633 Ga0070679_100017657
634 Ga0070679_100297894
635 Ga0070684_100014324
636 Ga0070697_100039640
637 Ga0070672_100005810
638 Ga0070686_100006981
639 Ga0070695_100044059
640 Ga0070696_100038755
641 Ga0070696_100149393
642 Ga0070693_100026270
643 Ga0070665_100026162
644 Ga0070665_100291043
645 Ga0070704_100245149
646 Ga0070704_100328976
647 Ga0068855_100040964
648 Ga0068855_100503511
649 Ga0070664_100005393
650 Ga0070664_100455719
651 Ga0068857_100118596
652 Ga0068854_100026170
653 Ga0068854_100026705
654 Ga0068856_100026269
655 Ga0070702_100005168
656 Ga0068852_100041501
657 Ga0068852_100493468
658 Ga0068859_100015581
659 Ga0068859_100224042
660 Ga0068864_100015549
661 Ga0068864_100043717
662 Ga0068866_10141662
663 Ga0068861_100004634
664 Ga0068870_10001414
665 Ga0068863_100010193
666 Ga0068863_100489042
667 Ga0068858_100011089
668 Ga0068858_100015917
669 Ga0068858_100110035
670 Ga0068858_100169950
671 Ga0068858_100188719
672 Ga0068860_100031570
673 Ga0068860_100052754
674 Ga0068860_100263379
675 Ga0068862_100007387
676 Ga0068862_100118946
677 Ga0068862_100120459
678 Ga0075364_10017344
679 Ga0075362_10000746
680 Ga0075367_10076777
681 Ga0097621_100000646
682 Ga0075370_10017428
683 Ga0068871_100000958
684 Ga0075428_100000295
685 Ga0075428_100001517
686 Ga0075428_100004388
687 Ga0075428_100062788
688 Ga0075428_100073237
689 Ga0075428_100324405
690 Ga0075430_100000640
691 Ga0075430_100003248
692 Ga0075430_100033466
693 Ga0075430_100041554
694 Ga0075430_100079109
695 Ga0075431_100004098
696 Ga0075431_100007716
697 Ga0075431_100014004
698 Ga0075431_100019376
699 Ga0075431_100074821
700 Ga0075431_100124505
701 Ga0075433_10013133
702 Ga0075433_10032578
703 Ga0075433_10102506
704 Ga0075433_10133307
705 Ga0075434_100008007
706 Ga0075434_100010265
707 Ga0075434_100016691
708 Ga0075434_100029900
709 Ga0075434_100032980
710 Ga0075434_100344070
711 Ga0075429_100000690
712 Ga0075429_100023000
713 Ga0075429_100043580
714 Ga0068865_100057791
715 Ga0075436_100003619
716 Ga0075436_100009419
717 Ga0075436_100095642
718 Ga0097620_100015581
719 Ga0097620_100224048
720 Ga0075435_100000177
721 Ga0075435_100000511
722 Ga0075435_100000948
723 Ga0075435_100010538
724 Ga0075435_100055969
725 Ga0075435_100102306
726 Ga0075435_100353576
727 Ga0105240_10026350
728 Ga0105240_10103506
729 Ga0111539_10000037
730 Ga0111539_10001120
731 Ga0111539_10001221
732 Ga0111539_10008348
733 Ga0111539_10013636
734 Ga0111539_10220065
735 Ga0111539_10594337
736 Ga0105247_10030071
737 Ga0114129_10003573
738 Ga0114129_10004316
739 Ga0114129_10008636
740 Ga0114129_10009195
741 Ga0114129_10014093
742 Ga0114129_10015583
743 Ga0114129_10055131
744 Ga0114129_10058845
745 Ga0105243_10009313
746 Ga0105243_10035459
747 Ga0105243_10272003
748 Ga0105241_10036009
749 Ga0105248_10014047
750 Ga0105248_10020126
751 Ga0105248_10062898
752 Ga0105248_10073860
753 Ga0105248_10090779
754 Ga0105248_10257393
755 Ga0105248_10345633
756 Ga0105238_10450627
757 Ga0105249_10125775
758 Ga0105249_10269239
759 Ga0105249_10345163
760 Ga0105246_10013824
761 Ga0163162_10042918
762 Ga0157372_10191479
763 Ga0157372_10347068
764 Ga0157375_10052540
765 Ga0163163_10113267
766 Ga0157380_10018212
767 Ga0157380_10079243
768 Ga0157380_10133292
769 Ga0157377_10001648
770 Ga0157377_10010613
771 Ga0157377_10158042
772 Ga0157379_10004249
773 Ga0157376_10046640
774 Ga0157376_10216955
775 Ga0163161_10047653
776 Ga0207673_1000992
777 Ga0207697_10000717
778 Ga0207697_10000732
779 Ga0207697_10111593
780 Ga0207682_10008497
781 Ga0207710_10039114
782 Ga0207688_10001322
783 Ga0207688_10009961
784 Ga0207680_10102798
785 Ga0207699_10093343
786 Ga0207645_10001706
787 Ga0207645_10010770
788 Ga0207643_10001193
789 Ga0207643_10017409
790 Ga0207705_10114453
791 Ga0207707_10230368
792 Ga0207695_10257574
793 Ga0207660_10055482
794 Ga0207660_10239181
795 Ga0207662_10002832
796 Ga0207662_10016049
797 Ga0207657_10027231
798 Ga0207657_10040558
799 Ga0207657_10149148
800 Ga0207657_10282770
801 Ga0207652_10026423
802 Ga0207646_10040980
803 Ga0207646_10064873
804 Ga0207681_10003863
805 Ga0207681_10009766
806 Ga0207681_10012372
807 Ga0207681_10207476
808 Ga0207681_10266953
809 Ga0207650_10030902
810 Ga0207650_10139048
811 Ga0207659_10000586
812 Ga0207659_10005817
813 Ga0207659_10013442
814 Ga0207659_10085346
815 Ga0207659_10095935
816 Ga0207659_10127835
817 Ga0207687_10128353
818 Ga0207700_10030091
819 Ga0207664_10127107
820 Ga0207644_10045900
821 Ga0207644_10052792
822 Ga0207690_10077857
823 Ga0207706_10002692
824 Ga0207709_10015349
825 Ga0207709_10046393
826 Ga0207670_10007636
827 Ga0207670_10016026
828 Ga0207665_10076235
829 Ga0207691_10000676
830 Ga0207691_10047190
831 Ga0207691_10291910
832 Ga0207711_10023960
833 Ga0207711_10053777
834 Ga0207711_10060421
835 Ga0207711_10080947
836 Ga0207711_10188401
837 Ga0207689_10002745
838 Ga0207689_10103677
839 Ga0207679_10003263
840 Ga0207679_10181299
841 Ga0207679_10399314
842 Ga0207667_10039375
843 Ga0207651_10003440
844 Ga0207651_10024415
845 Ga0207651_10353884
846 Ga0207712_10004344
847 Ga0207712_10005078
848 Ga0207712_10147093
849 Ga0207640_10063058
850 Ga0207640_10124852
851 Ga0207658_10029283
852 Ga0207677_10014269
853 Ga0207703_10034518
854 Ga0207703_10049313
855 Ga0207703_10089485
856 Ga0207678_10132093
857 Ga0207708_10002826
858 Ga0207708_10003593
859 Ga0207708_10240476
860 Ga0207708_10272816
861 Ga0207708_10404022
862 Ga0207702_10059407
863 Ga0207702_10135324
864 Ga0207641_10010305
865 Ga0207648_10005858
866 Ga0207648_10046413
867 Ga0207648_10131713
868 Ga0207648_10191616
869 Ga0207676_10031017
870 Ga0207676_10059239
871 Ga0207676_10159926
872 Ga0207674_10008877
873 Ga0207674_10167063
874 Ga0207675_100000149
875 Ga0207675_100083128
876 Ga0207675_100116442
877 Ga0207675_100150704
878 Ga0207683_10055481
879 Ga0207683_10060008
880 Ga0207683_10118218
881 Ga0207698_10188611
882 Ga0210002_1011469
883 Ga0209971_1017165
884 Ga0207428_10001068
885 Ga0207428_10003191
886 Ga0207428_10012687
887 Ga0207428_10017704
888 Ga0268266_10040490
889 Ga0268266_10177099
890 Ga0268265_10078866
891 Ga0268265_10331759
892 Ga0268264_10015584
893 Ga0307408_100039675
894 Ga0307408_100199181
895 Ga0307408_100275399
896 Ga0265314_10209772
897 Ga0307410_10031322
898 Ga0307409_100014613
899 Ga0307409_100020788
900 Ga0307409_100226555
901 Ga0307416_100019683
902 Ga0307416_100111565
903 Ga0307416_100273826
904 Ga0307414_10065988
905 Ga0307411_10057464
906 Ga0307411_10233037
907 Ga0307415_100031504
908 Ga0307415_100193290
909 Ga0373950_0003933
910 Ga0373958_0000318
911 Ga0373959_0001888
912 Ga0373934_0055701
913 Ga0373949_0005555
914 Ga0373949_0013958
915 Ga0373949_0021602
916 Ga0373951_0001651
917 Ga0373952_0000341
918 Ga0373932_0004164
919 Ga0373939_0000785
920 Ga0373941_0002462
921 Ga0373960_0000213
922 Ga0373943_0003818
923 Ga0373943_0024456
924 Ga0373942_0003944
925 Ga0373961_0002356
926 Ga0373961_0027500
927 Ga0373962_0014072
928 Ga0373931_0006673
929 Ga0373931_0034667
930 Ga0373927_0017106
931 Ga0373947_0149071
932 Ga0373937_0025518
933 Ga0373937_0069137
934 Ga0373925_0021656
935 Ga0436365_0682714
936 Ga0436365_1775937
937 Ga0439433_0011357
938 Ga0439441_013941
939 Ga0439450_010750
940 Ga0439462_0063433
941 Ga0450895_002450
942 Ga0439446_0017402
943 Ga0439434_0013184
944 Ga0439435_0009370
945 Ga0439435_0012867
946 Ga0439435_0018425
947 Ga0439464_0005716
948 Ga0439464_0059016
949 Ga0451577_0125270
950 Ga0451576_0043767
951 Ga0451576_0094215
952 Ga0451576_0135488
953 Ga0451576_0413399
954 Ga0466958_0136682
955 Ga0495629_0239063
956 Ga0495580_0045647
957 Ga0495582_0173611
958 Ga0495639_0044046
959 Ga0495608_0020487
960 Ga0495608_0163853
961 Ga0495618_0143183
962 Ga0495630_0024119
963 Ga0495663_0031532
964 Ga0495640_0078558
965 Ga0495587_0022433
966 Ga0495621_0050051
967 Ga0495621_0050230
968 Ga0495667_0034577
969 Ga0495656_0039211
970 Ga0495656_0042749
971 Ga0495634_0061248
972 Ga0495635_0049123
973 Ga0495623_0125562
974 Ga0495646_0164759
975 Ga0495613_0000318
976 Ga0495604_0031688
977 Ga0495674_0061542
978 Ga0495674_0107881
979 Ga0495680_0160177
980 Ga0495684_0000053
981 Ga0495602_0128724
982 Ga0496102_0103884
983 Ga0496104_0385879
984 Ga0496105_0242056
985 Ga0496109_0027806
986 Ga0496112_0165059
987 Ga0501031_0028667
988 Ga0501033_0134312
989 Ga0501034_0020238
990 Ga0501034_0221381
991 Ga0501036_0060721
992 Ga0501036_0207720
993 Ga0501036_0248055
994 Ga0501038_0100101
995 Ga0501039_0058277
996 Ga0501040_0067255
997 Ga0501040_0209231
998 Ga0501041_0012600
999 Ga0501041_0028534
1000 Ga0501042_0017154
1001 Ga0501046_0003786
1002 Ga0501046_0056943
1003 Ga0501047_0068122
1004 Ga0501048_0099355
1005 Ga0501068_0118578
1006 Ga0501071_0020487
1007 Ga0501071_0040967
1008 Ga0501071_0146800
1009 Ga0501072_0080262
1010 Ga0501072_0084472
1011 Ga0501072_0096244
1012 Ga0501072_0180475
1013 Ga0501074_0057226
1014 Ga0501075_0016140
1015 Ga0501075_0025261
1016 Ga0501075_0038636
1017 Ga0501076_0002349
1018 Ga0501076_0006608
1019 Ga0501076_0017306
1020 Ga0501076_0098852
1021 Ga0501076_0338303
1022 Ga0501077_0025276
1023 Ga0501077_0033000
1024 Ga0501235_031474
1025 Ga0501079_0002285
1026 Ga0501079_0133106
1027 Ga0501079_0305899
1028 Ga0501081_0028820
1029 Ga0501035_0268375
1030 Ga0501045_0003977
1031 Ga0501045_0016220
1032 Ga0501045_0071237
1033 nmdc:mga03683_18662_c1
1034 nmdc:mga00v17_3790_c1
1035 nmdc:mga0yw44_13906_c1
1036 nmdc:mga0k408_8033_c1
1037 nmdc:mga0k408_8489_c1
1038 nmdc:mga05p37_1291_c1
1039 nmdc:mga05p37_1981_c1
1040 nmdc:mga05p37_2046_c1
1041 nmdc:mga05p37_21247_c1
1042 nmdc:mga05p37_2447_c1
1043 nmdc:mga05p37_368308_c1
1044 nmdc:mga05p37_36837_c2
1045 nmdc:mga05p37_449541_c1
1046 nmdc:mga05p37_526476_c1
1047 nmdc:mga05p37_8178_c1
1048 nmdc:mga05p37_8567_c1
1049 nmdc:mga09592_128436_c1
1050 nmdc:mga09592_20926_c1
1051 nmdc:mga09592_4978_c1
1052 nmdc:mga09592_55588_c1
1053 nmdc:mga0qj67_1983_c1
1054 nmdc:mga0qj67_24872_c1
1055 nmdc:mga0qj67_5153_c1
1056 nmdc:mga0qj67_6470_c1
1057 nmdc:mga0qj67_65521_c1
1058 nmdc:mga0qj67_76380_c1
1059 nmdc:mga06r32_10057_c1
1060 nmdc:mga06r32_1463_c1
1061 nmdc:mga06r32_67611_c1
1062 nmdc:mga06r32_87558_c1
1063 nmdc:mga06r32_93035_c1
1064 nmdc:mga06r32_9552_c1
1065 nmdc:mga08y16_10217_c1
1066 nmdc:mga08y16_3529_c1
1067 nmdc:mga08y16_87_c1
1068 nmdc:mga0n895_11526_c1
1069 nmdc:mga0n895_41549_c1
1070 nmdc:mga0n895_631179_c1
1071 nmdc:mga0n895_6550_c1
1072 nmdc:mga0n895_780_c1
1073 nmdc:mga0n895_8937_c1
1074 nmdc:mga0n895_96956_c1
1075 nmdc:mga0rr50_159109_c1
1076 nmdc:mga0rr50_16_c1
1077 nmdc:mga0rr50_170743_c1
1078 nmdc:mga0rr50_41842_c1
1079 nmdc:mga0rr50_8665_c1
1080 nmdc:mga08x19_137_c1
1081 nmdc:mga08x19_229337_c1
1082 nmdc:mga0a205_15119_c1
1083 nmdc:mga0a205_18629_c1
1084 nmdc:mga0a205_42207_c1
1085 nmdc:mga0a205_74704_c1
1086 nmdc:mga0a205_8237_c2
1087 nmdc:mga0a205_89293_c1
1088 Ga0495612_0117770
1089 Ga0495619_0003752
1090 Ga0495619_0010615
1091 Ga0501084_0012966
1092 Ga0501084_0128015
1093 Ga0501084_0245367
1094 Ga0590071_000424
1095 Ga0590071_015521
1096 Ga0590074_003194
1097 Ga0590075_002816
1098 Ga0590075_031455
1099 Ga0590077_001886
1100 Ga0501082_0248685
1101 Ga0501082_0249063
1102 Ga0501082_0299036
1103 Ga0530510_0004651
1104 Ga0530510_0027049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

9

335

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4he8-assembly2.cif.gz_C crystal structure of the membrane domain of respiratory complex i from thermus thermophilus 0.8197 6 352
7p7k-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, with dq, resting state 0.8159 1 353
7p7k-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, with dq, resting state 0.811 1 353
7p7l-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, with nadh and fmn, open state 0.8102 1 350
7p7c-assembly1.cif.gz_H complex i from e. coli, ddm/lmng-purified, apo, open state 0.809 1 350
ID Description Score Start End Superfamily
af_Q8GWD5_10_158_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3877 77 180 1.20.140.150
af_Q5A970_159_327_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.3174 127 270 1.20.58.340
af_Q8GWD5_10_158_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3041 77 180 1.20.140.150
af_A4HYA9_67_263_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3025 134 352 1.20.1250.20
af_A5PM84_63_199_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2997 126 267 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2V8HDK0-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 7.1.1.-) (NADH dehydrogenase I subunit H) (NDH-1 subunit H) 0.8225 4 353 GO:0003954
GO:0005886
GO:0009060
GO:0016655
GO:0048038
AF-A0A538HHA7-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 7.1.1.-) (NADH dehydrogenase I subunit H) (NDH-1 subunit H) 0.8187 8 352 GO:0003954
GO:0005886
GO:0009060
GO:0016655
GO:0048038
AF-A0A3D0D8R2-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 7.1.1.-) (NADH dehydrogenase I subunit H) (NDH-1 subunit H) 0.8145 1 352 GO:0003954
GO:0005886
GO:0009060
GO:0016655
GO:0019867
GO:0048038
AF-A0A2V8HDK0-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 7.1.1.-) (NADH dehydrogenase I subunit H) (NDH-1 subunit H) 0.8118 4 353 GO:0003954
GO:0005886
GO:0009060
GO:0016655
GO:0048038
AF-A0A7Y3LBR4-F1-model_v4 NADH-quinone oxidoreductase subunit H (EC 7.1.1.-) (NADH dehydrogenase I subunit H) (NDH-1 subunit H) 0.8107 1 349 GO:0003954
GO:0005886
GO:0009060
GO:0016655
GO:0048038

Map