F462724

General Info

Members Datasets Scaffolds Average Seq Length
552 270 536 614

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000572|Ga0105237_1000057235
Length 658
Sequence VVAGWLSLAAGLPIIAYICGMHYVSVEGLSKSYGVKPLFTNITFHIEEGDKIALVARNGSGKSTLLKILAGKDTAEGGTVWIHKDVTVALFEQEPVFAEEKSILDNIFHHNHPVINAIKAYEAASDEEDVDKITDAIVRLDELNAWDFDTKVKQILGKLNIHHLQQAAGTLSGGQRKRVALAKTLIDIGFEHKHVLLIMDEPTNHLDVEMVEWLEHYLNQEKVTLLLVTHDRYFLDNVSEEIWEMDGSNLYVYKGDYENYLEKKTARIENDTASIDKARNTYRKELEWMRKQPKARTTKSKSRQDNFYVVEAKAKQRIEDQQVELQMKMNRLGGKIAELKKVYKSFGEKVILKGFDYTFKKGERLGVIGKNGVGKSTFINMLQGLEEPDSGKINIGETIIFGNYSQSGLVIKEDMRVIEYVKNIAEHFPLAGGGSLSAAQFLQLFLFPPEQQYTYISKLSGGEKRRLHLLSILFRNPNFLVLDEPTNDLDLPTLGILENFLSEYQGCLLIVSHDRYFMDRLVDHLLVLEGNGVVRDFPGNYSQYREWQKLDDERAEFRPPGDGYQASPSPAPAAKPVEASVAPAVVKKQLTYKEKRELEDLEKEMARLNQEKKDITEKLNSGMAPFDQLQQLSIRIGEISQLLDDKELRWLELSEMGI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
8 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
9 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
10 2914759650 Rhizosphaericola mali Isolate Rhizosphere
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
13 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
14 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
15 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
16 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
254 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
255 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
256 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
264 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 0
Rhizoplane 0.36
Rhizosphere 84.96
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_104926 2162886007 Bacteria 77416
2 JGI24739J22299_10000195 3300001989 Bacteria 20024
3 JGI25154J39366_1000003 3300002738 Bacteria 397627
4 JGI25406J46586_10006354 3300003203 Bacteria 5450
5 JGI25153J46596_10002851 3300003215 Bacteria 9818
6 rootH2_10015377 3300003320 Bacteria 18976
7 rootH2_10024015 3300003320 Bacteria 6362
8 rootH2_10025304 3300003320 Bacteria 18998
9 rootH2_10036622 3300003320 Bacteria 17189
10 rootL2_10025914 3300003322 Bacteria 5068
11 rootL2_10163372 3300003322 Bacteria 4410
12 rootH1_10004759 3300003323 Bacteria 40082
13 rootH1_10032632 3300003323 Bacteria 15899
14 rootH1_10154878 3300003323 Bacteria 9017
15 JGI25160J50197_1000175 3300003354 Bacteria 54393
16 JGI25160J50197_1001292 3300003354 Bacteria 12654
17 JGI25160J50197_1006486 3300003354 Bacteria 4728
18 Ga0055526_1010998 3300003771 Bacteria 4134
19 Ga0055528_1000108 3300003790 Bacteria 66828
20 Ga0055530_10000279 3300003791 Bacteria 46371
21 Ga0065165_1000019 3300005262 Bacteria 271815
22 Ga0065704_10070133 3300005289 Bacteria 1266035
23 Ga0065712_10005175 3300005290 Bacteria 2971
24 Ga0065712_10073607 3300005290 Bacteria 4327
25 Ga0070658_10000230 3300005327 Bacteria 49640
26 Ga0070676_10001002 3300005328 Bacteria 14031
27 Ga0070683_100001537 3300005329 Bacteria 17862
28 Ga0070683_100018456 3300005329 Bacteria 6179
29 Ga0070683_100155994 3300005329 Bacteria 2165
30 Ga0070690_100068453 3300005330 Bacteria 2303
31 Ga0070670_100024730 3300005331 Bacteria 5166
32 Ga0070670_100059989 3300005331 Bacteria 3265
33 Ga0070670_100149277 3300005331 Bacteria 2023
34 Ga0068869_100013596 3300005334 Bacteria 5417
35 Ga0068869_100017060 3300005334 Bacteria 4912
36 Ga0068869_100039456 3300005334 Bacteria 3371
37 Ga0068869_100063165 3300005334 Bacteria 2719
38 Ga0070666_10000140 3300005335 Bacteria 50189
39 Ga0070666_10006029 3300005335 Bacteria 7446
40 Ga0070666_10041011 3300005335 Bacteria 3092
41 Ga0070680_100005480 3300005336 Bacteria 9600
42 Ga0070682_100000439 3300005337 Bacteria 26883
43 Ga0070682_100002154 3300005337 Bacteria 10934
44 Ga0068868_100025638 3300005338 Bacteria 4488
45 Ga0070660_100079346 3300005339 Bacteria 2575
46 Ga0070689_100014127 3300005340 Bacteria 5793
47 Ga0070691_10000811 3300005341 Bacteria 12514
48 Ga0070661_100004500 3300005344 Bacteria 9602
49 Ga0070661_100047835 3300005344 Bacteria 3130
50 Ga0070661_100061243 3300005344 Bacteria 2762
51 Ga0070668_100000862 3300005347 Bacteria 21064
52 Ga0070668_100022308 3300005347 Bacteria 4784
53 Ga0070668_100026890 3300005347 Bacteria 4367
54 Ga0070669_100004598 3300005353 Bacteria 9963
55 Ga0070669_100049455 3300005353 Bacteria 3069
56 Ga0070675_100017355 3300005354 Bacteria 5718
57 Ga0070675_100023201 3300005354 Bacteria 4958
58 Ga0070675_100026621 3300005354 Bacteria 4642
59 Ga0070675_100071283 3300005354 Bacteria 2882
60 Ga0070675_100081255 3300005354 Bacteria 2703
61 Ga0070671_100064167 3300005355 Bacteria 3059
62 Ga0070674_100005017 3300005356 Bacteria 7601
63 Ga0070674_100041094 3300005356 Bacteria 3131
64 Ga0070673_100000096 3300005364 Bacteria 39184
65 Ga0070673_100006447 3300005364 Bacteria 7626
66 Ga0070673_100024287 3300005364 Bacteria 4442
67 Ga0070673_100030337 3300005364 Bacteria 4044
68 Ga0070688_100009498 3300005365 Bacteria 5323
69 Ga0070659_100002430 3300005366 Bacteria 13228
70 Ga0070659_100017107 3300005366 Bacteria 5451
71 Ga0070667_100002462 3300005367 Bacteria 16163
72 Ga0070667_100010439 3300005367 Bacteria 7669
73 Ga0070667_100018176 3300005367 Bacteria 5829
74 Ga0070667_100032100 3300005367 Bacteria 4379
75 Ga0070667_100033070 3300005367 Bacteria 4318
76 Ga0070667_100039986 3300005367 Bacteria 3932
77 Ga0070667_100073467 3300005367 Bacteria 2916
78 Ga0070663_100099712 3300005455 Bacteria 2166
79 Ga0070678_100000605 3300005456 Bacteria 17659
80 Ga0070678_100014157 3300005456 Bacteria 5024
81 Ga0070678_100091560 3300005456 Bacteria 2334
82 Ga0070662_100002759 3300005457 Bacteria 10857
83 Ga0070662_100002855 3300005457 Bacteria 10707
84 Ga0070662_100004733 3300005457 Bacteria 8628
85 Ga0070662_100096209 3300005457 Bacteria 2233
86 Ga0070681_10003457 3300005458 Bacteria 14796
87 Ga0068867_100002197 3300005459 Bacteria 13683
88 Ga0068867_100005892 3300005459 Bacteria 8696
89 Ga0068867_100115029 3300005459 Bacteria 2071
90 Ga0070685_10020850 3300005466 Bacteria 3552
91 Ga0070685_10051462 3300005466 Bacteria 2381
92 Ga0070698_100011022 3300005471 Bacteria 9614
93 Ga0070698_100040449 3300005471 Bacteria 4791
94 Ga0070679_100006343 3300005530 Bacteria 11012
95 Ga0070679_100036257 3300005530 Bacteria 4894
96 Ga0070684_100001959 3300005535 Bacteria 15116
97 Ga0070684_100026667 3300005535 Bacteria 4869
98 Ga0068853_100000197 3300005539 Bacteria 42626
99 Ga0068853_100000694 3300005539 Bacteria 23234
100 Ga0068853_100007233 3300005539 Bacteria 8893
101 Ga0068853_100009165 3300005539 Bacteria 7972
102 Ga0068853_100036941 3300005539 Bacteria 4155
103 Ga0070672_100000033 3300005543 Bacteria 61516
104 Ga0070686_100018894 3300005544 Unclassified 4054
105 Ga0070665_100000009 3300005548 Bacteria 562640
106 Ga0070665_100001625 3300005548 Bacteria 25892
107 Ga0070665_100002141 3300005548 Bacteria 22042
108 Ga0070665_100125872 3300005548 Bacteria 2565
109 Ga0068855_100000701 3300005563 Bacteria 40996
110 Ga0068855_100002673 3300005563 Bacteria 21971
111 Ga0068855_100004165 3300005563 Bacteria 17643
112 Ga0068855_100081410 3300005563 Bacteria 3753
113 Ga0070664_100001378 3300005564 Bacteria 19372
114 Ga0070664_100002631 3300005564 Bacteria 14476
115 Ga0070664_100089374 3300005564 Bacteria 2665
116 Ga0070664_100097125 3300005564 Bacteria 2557
117 Ga0070664_100112531 3300005564 Bacteria 2377
118 Ga0068857_100000290 3300005577 Bacteria 34647
119 Ga0068857_100000631 3300005577 Bacteria 25869
120 Ga0068857_100016335 3300005577 Bacteria 6504
121 Ga0068856_100014785 3300005614 Bacteria 7535
122 Ga0068856_100026914 3300005614 Bacteria 5610
123 Ga0068852_100017249 3300005616 Bacteria 5662
124 Ga0068852_100038805 3300005616 Bacteria 4005
125 Ga0068852_100047116 3300005616 Bacteria 3676
126 Ga0068852_100089006 3300005616 Bacteria 2758
127 Ga0068852_100098405 3300005616 Bacteria 2634
128 Ga0068859_100005301 3300005617 Bacteria 13110
129 Ga0068859_100011172 3300005617 Bacteria 9029
130 Ga0068859_100013292 3300005617 Bacteria 8260
131 Ga0068864_100002506 3300005618 Bacteria 15183
132 Ga0068864_100003011 3300005618 Bacteria 13927
133 Ga0068864_100068121 3300005618 Bacteria 3091
134 Ga0068866_10002055 3300005718 Bacteria 8375
135 Ga0068861_100003918 3300005719 Bacteria 9949
136 Ga0068861_100035811 3300005719 Bacteria 3679
137 Ga0068861_100056332 3300005719 Bacteria 3000
138 Ga0068870_10012559 3300005840 Bacteria 3961
139 Ga0068863_100012550 3300005841 Bacteria 8177
140 Ga0068863_100015639 3300005841 Bacteria 7288
141 Ga0068863_100074607 3300005841 Bacteria 3209
142 Ga0068863_100079510 3300005841 Bacteria 3105
143 Ga0068858_100002290 3300005842 Bacteria 19387
144 Ga0068858_100008890 3300005842 Bacteria 9631
145 Ga0068860_100000078 3300005843 Bacteria 171062
146 Ga0068860_100002082 3300005843 Bacteria 21091
147 Ga0068860_100003374 3300005843 Bacteria 16426
148 Ga0068862_100010317 3300005844 Bacteria 7708
149 Ga0081540_1017990 3300005983 Bacteria 4352
150 Ga0081539_10000081 3300005985 Bacteria 222614
151 Ga0097621_100000595 3300006237 Bacteria 25494
152 Ga0097621_100002550 3300006237 Bacteria 12478
153 Ga0097621_100004248 3300006237 Bacteria 9955
154 Ga0068871_100000415 3300006358 Bacteria 29454
155 Ga0068871_100020948 3300006358 Bacteria 5016
156 Ga0068871_100118684 3300006358 Bacteria 2232
157 Ga0075428_100010006 3300006844 Bacteria 10535
158 Ga0075428_100035479 3300006844 Bacteria 5498
159 Ga0075428_100133778 3300006844 Bacteria 2696
160 Ga0075430_100008685 3300006846 Bacteria 8574
161 Ga0075431_100002821 3300006847 Bacteria 16817
162 Ga0068865_100000705 3300006881 Bacteria 18786
163 Ga0068865_100003471 3300006881 Bacteria 9444
164 Ga0097620_100005301 3300006931 Bacteria 13110
165 Ga0097620_100011171 3300006931 Bacteria 9029
166 Ga0097620_100013292 3300006931 Bacteria 8260
167 Ga0105240_10000023 3300009093 Bacteria 385028
168 Ga0105240_10000047 3300009093 Bacteria 239067
169 Ga0105240_10000263 3300009093 Bacteria 103973
170 Ga0105240_10000281 3300009093 Bacteria 100881
171 Ga0105240_10001324 3300009093 Bacteria 42710
172 Ga0105240_10010527 3300009093 Bacteria 12990
173 Ga0111539_10024385 3300009094 Bacteria 7423
174 Ga0111539_10026729 3300009094 Bacteria 7053
175 Ga0105247_10007085 3300009101 Bacteria 6886
176 Ga0105247_10007184 3300009101 Bacteria 6837
177 Ga0114129_10012009 3300009147 Bacteria 12317
178 Ga0114129_10022888 3300009147 Bacteria 8863
179 Ga0105241_10000319 3300009174 Bacteria 36268
180 Ga0105241_10006156 3300009174 Bacteria 8846
181 Ga0105241_10008606 3300009174 Bacteria 7500
182 Ga0105241_10026488 3300009174 Bacteria 4315
183 Ga0105242_10018943 3300009176 Bacteria 5390
184 Ga0105237_10000572 3300009545 Bacteria 51470
185 Ga0105237_10001668 3300009545 Bacteria 28734
186 Ga0105237_10011021 3300009545 Bacteria 9592
187 Ga0105237_10015300 3300009545 Bacteria 7991
188 Ga0105237_10051120 3300009545 Bacteria 4152
189 Ga0105237_10114993 3300009545 Bacteria 2683
190 Ga0105238_10000650 3300009551 Bacteria 36492
191 Ga0105238_10069346 3300009551 Bacteria 3526
192 Ga0105249_10004075 3300009553 Bacteria 12607
193 Ga0105249_10008383 3300009553 Bacteria 9002
194 Ga0105249_10016454 3300009553 Bacteria 6563
195 Ga0105249_10017922 3300009553 Bacteria 6293
196 Ga0105249_10020524 3300009553 Bacteria 5905
197 Ga0105249_10027133 3300009553 Bacteria 5166
198 Ga0105249_10029726 3300009553 Bacteria 4936
199 Ga0105249_10139633 3300009553 Bacteria 2322
200 Ga0105239_10000760 3300010375 Bacteria 45542
201 Ga0105239_10000916 3300010375 Bacteria 41814
202 Ga0105239_10001869 3300010375 Bacteria 27565
203 Ga0105239_10003815 3300010375 Bacteria 18323
204 Ga0105239_10038996 3300010375 Bacteria 5204
205 Ga0157373_10007735 3300013100 Bacteria 7990
206 Ga0157373_10010150 3300013100 Bacteria 6938
207 Ga0157371_10009594 3300013102 Bacteria 7611
208 Ga0157371_10020747 3300013102 Bacteria 4832
209 Ga0157371_10022767 3300013102 Bacteria 4584
210 Ga0157370_10000479 3300013104 Bacteria 49878
211 Ga0157370_10002029 3300013104 Bacteria 24887
212 Ga0157369_10031150 3300013105 Bacteria 5877
213 Ga0157369_10108958 3300013105 Bacteria 2945
214 Ga0157374_10000002 3300013296 Bacteria 1054226
215 Ga0157374_10029273 3300013296 Bacteria 4985
216 Ga0157374_10068965 3300013296 Bacteria 3328
217 Ga0157374_10111931 3300013296 Bacteria 2626
218 Ga0157378_10002110 3300013297 Bacteria 17713
219 Ga0157378_10009097 3300013297 Bacteria 8647
220 Ga0157378_10048492 3300013297 Bacteria 3777
221 Ga0157378_10052632 3300013297 Bacteria 3622
222 Ga0157378_10113820 3300013297 Bacteria 2484
223 Ga0163162_10000190 3300013306 Bacteria 56892
224 Ga0163162_10000371 3300013306 Bacteria 40778
225 Ga0163162_10001924 3300013306 Bacteria 19554
226 Ga0163162_10004419 3300013306 Bacteria 13535
227 Ga0163162_10008781 3300013306 Bacteria 9822
228 Ga0163162_10010540 3300013306 Bacteria 8988
229 Ga0163162_10012796 3300013306 Bacteria 8198
230 Ga0157372_10000716 3300013307 Bacteria 36410
231 Ga0157372_10013317 3300013307 Bacteria 8778
232 Ga0157372_10015440 3300013307 Bacteria 8185
233 Ga0157372_10017331 3300013307 Bacteria 7732
234 Ga0157372_10036689 3300013307 Bacteria 5403
235 Ga0157372_10080698 3300013307 Bacteria 3681
236 Ga0157375_10000935 3300013308 Bacteria 25338
237 Ga0157375_10012957 3300013308 Bacteria 7408
238 Ga0157375_10031490 3300013308 Bacteria 5015
239 Ga0157375_10059327 3300013308 Bacteria 3790
240 Ga0157375_10119116 3300013308 Bacteria 2747
241 Ga0163163_10000457 3300014325 Bacteria 37238
242 Ga0163163_10000616 3300014325 Bacteria 30789
243 Ga0163163_10017383 3300014325 Bacteria 6706
244 Ga0163163_10038656 3300014325 Bacteria 4652
245 Ga0163163_10044208 3300014325 Bacteria 4369
246 Ga0163163_10113180 3300014325 Bacteria 2743
247 Ga0157380_10001574 3300014326 Bacteria 15001
248 Ga0157380_10003644 3300014326 Bacteria 10593
249 Ga0157380_10020217 3300014326 Bacteria 4976
250 Ga0157380_10065795 3300014326 Bacteria 2914
251 Ga0157377_10006393 3300014745 Bacteria 5616
252 Ga0157379_10000229 3300014968 Bacteria 43909
253 Ga0157379_10007387 3300014968 Bacteria 9517
254 Ga0157379_10080248 3300014968 Bacteria 2923
255 Ga0157379_10100797 3300014968 Bacteria 2592
256 Ga0157379_10111146 3300014968 Bacteria 2461
257 Ga0157376_10000117 3300014969 Bacteria 56126
258 Ga0157376_10000453 3300014969 Bacteria 26477
259 Ga0157376_10000853 3300014969 Bacteria 20013
260 Ga0157376_10006481 3300014969 Bacteria 8272
261 Ga0157376_10021632 3300014969 Bacteria 4998
262 Ga0157376_10055580 3300014969 Bacteria 3304
263 Ga0157376_10080117 3300014969 Bacteria 2800
264 Ga0182005_1000159 3300015265 Bacteria 47132
265 Ga0163161_10004059 3300017792 Bacteria 10234
266 Ga0163161_10020358 3300017792 Bacteria 4656
267 Ga0163161_10035452 3300017792 Bacteria 3571
268 Ga0163161_10110757 3300017792 Bacteria 2052
269 Ga0213876_10002778 3300021384 Bacteria 10197
270 Ga0213876_10055314 3300021384 Bacteria 2095
271 Ga0209258_100032 3300025242 Bacteria 452764
272 Ga0209646_1000004 3300025246 Bacteria 786587
273 Ga0209026_1000132 3300025250 Bacteria 119048
274 Ga0209148_1000186 3300025254 Bacteria 117677
275 Ga0209673_1000183 3300025273 Bacteria 126175
276 Ga0209758_1000912 3300025297 Bacteria 40017
277 Ga0209758_1001642 3300025297 Bacteria 25398
278 Ga0209758_1031605 3300025297 Bacteria 2168
279 Ga0209050_1000305 3300025298 Bacteria 100790
280 Ga0207426_1000033 3300025302 Bacteria 455976
281 Ga0207426_1000104 3300025302 Bacteria 249464
282 Ga0207426_1001887 3300025302 Bacteria 15299
283 Ga0207426_1010215 3300025302 Bacteria 3657
284 Ga0209051_1011271 3300025303 Bacteria 4429
285 Ga0209257_1000233 3300025304 Bacteria 129948
286 Ga0209257_1000783 3300025304 Bacteria 46807
287 Ga0207642_10008859 3300025899 Bacteria 3476
288 Ga0207710_10003723 3300025900 Bacteria 6752
289 Ga0207688_10031071 3300025901 Bacteria 2947
290 Ga0207680_10000140 3300025903 Bacteria 34445
291 Ga0207680_10010797 3300025903 Bacteria 4584
292 Ga0207680_10014129 3300025903 Bacteria 4121
293 Ga0207680_10019116 3300025903 Bacteria 3659
294 Ga0207647_10000110 3300025904 Bacteria 62980
295 Ga0207645_10000571 3300025907 Bacteria 30525
296 Ga0207645_10002569 3300025907 Bacteria 14159
297 Ga0207645_10005503 3300025907 Bacteria 9174
298 Ga0207645_10078447 3300025907 Bacteria 2116
299 Ga0207643_10009332 3300025908 Bacteria 5273
300 Ga0207705_10013822 3300025909 Bacteria 5822
301 Ga0207654_10038450 3300025911 Bacteria 2685
302 Ga0207707_10002013 3300025912 Bacteria 18448
303 Ga0207695_10000010 3300025913 Bacteria 981919
304 Ga0207695_10000016 3300025913 Bacteria 771991
305 Ga0207695_10000128 3300025913 Bacteria 226098
306 Ga0207695_10000296 3300025913 Bacteria 123322
307 Ga0207695_10000720 3300025913 Bacteria 64304
308 Ga0207695_10080906 3300025913 Bacteria 3289
309 Ga0207671_10000025 3300025914 Bacteria 271617
310 Ga0207671_10004310 3300025914 Bacteria 13677
311 Ga0207671_10004643 3300025914 Bacteria 13008
312 Ga0207671_10014791 3300025914 Bacteria 6147
313 Ga0207671_10015822 3300025914 Bacteria 5886
314 Ga0207671_10018663 3300025914 Bacteria 5314
315 Ga0207671_10065972 3300025914 Bacteria 2693
316 Ga0207660_10002865 3300025917 Bacteria 11277
317 Ga0207662_10040084 3300025918 Bacteria 2751
318 Ga0207662_10052964 3300025918 Bacteria 2416
319 Ga0207657_10017396 3300025919 Bacteria 6894
320 Ga0207649_10001702 3300025920 Bacteria 12677
321 Ga0207649_10014475 3300025920 Bacteria 4419
322 Ga0207652_10001732 3300025921 Bacteria 19037
323 Ga0207681_10005990 3300025923 Bacteria 7457
324 Ga0207681_10094328 3300025923 Bacteria 2144
325 Ga0207694_10068347 3300025924 Bacteria 2774
326 Ga0207650_10024766 3300025925 Bacteria 4271
327 Ga0207659_10041999 3300025926 Bacteria 3204
328 Ga0207690_10018285 3300025932 Bacteria 4297
329 Ga0207706_10003814 3300025933 Bacteria 14367
330 Ga0207706_10011370 3300025933 Bacteria 8112
331 Ga0207706_10012699 3300025933 Bacteria 7668
332 Ga0207706_10025104 3300025933 Bacteria 5343
333 Ga0207706_10073896 3300025933 Bacteria 2998
334 Ga0207670_10009170 3300025936 Bacteria 5629
335 Ga0207670_10009434 3300025936 Bacteria 5571
336 Ga0207669_10011274 3300025937 Unclassified 4343
337 Ga0207704_10001086 3300025938 Bacteria 12068
338 Ga0207691_10000001 3300025940 Bacteria 220829
339 Ga0207691_10018871 3300025940 Bacteria 6532
340 Ga0207691_10027609 3300025940 Bacteria 5321
341 Ga0207691_10050436 3300025940 Bacteria 3810
342 Ga0207691_10062223 3300025940 Bacteria 3388
343 Ga0207691_10068212 3300025940 Bacteria 3214
344 Ga0207689_10000939 3300025942 Bacteria 28012
345 Ga0207689_10003471 3300025942 Bacteria 14403
346 Ga0207689_10005568 3300025942 Bacteria 11246
347 Ga0207689_10015335 3300025942 Bacteria 6486
348 Ga0207689_10017542 3300025942 Bacteria 6052
349 Ga0207689_10020199 3300025942 Bacteria 5610
350 Ga0207661_10005038 3300025944 Bacteria 9268
351 Ga0207679_10000822 3300025945 Bacteria 19983
352 Ga0207679_10004389 3300025945 Bacteria 8782
353 Ga0207679_10055578 3300025945 Bacteria 2919
354 Ga0207679_10096528 3300025945 Bacteria 2300
355 Ga0207667_10000143 3300025949 Bacteria 108717
356 Ga0207667_10000583 3300025949 Bacteria 47418
357 Ga0207667_10014323 3300025949 Bacteria 9044
358 Ga0207651_10002700 3300025960 Bacteria 8502
359 Ga0207651_10010190 3300025960 Bacteria 5195
360 Ga0207712_10008393 3300025961 Bacteria 6525
361 Ga0207712_10011203 3300025961 Bacteria 5709
362 Ga0207712_10015057 3300025961 Bacteria 4983
363 Ga0207712_10023879 3300025961 Bacteria 4041
364 Ga0207640_10047834 3300025981 Bacteria 2761
365 Ga0207658_10002549 3300025986 Bacteria 13238
366 Ga0207658_10028271 3300025986 Bacteria 3947
367 Ga0207677_10002241 3300026023 Bacteria 10147
368 Ga0207677_10074542 3300026023 Unclassified 2408
369 Ga0207703_10038318 3300026035 Bacteria 3824
370 Ga0207639_10000910 3300026041 Bacteria 20014
371 Ga0207639_10008593 3300026041 Bacteria 7007
372 Ga0207639_10012793 3300026041 Bacteria 5855
373 Ga0207678_10015295 3300026067 Bacteria 6749
374 Ga0207702_10042757 3300026078 Bacteria 3802
375 Ga0207702_10098062 3300026078 Bacteria 2581
376 Ga0207641_10000082 3300026088 Bacteria 138385
377 Ga0207641_10001344 3300026088 Bacteria 24357
378 Ga0207648_10001686 3300026089 Bacteria 24217
379 Ga0207648_10002203 3300026089 Bacteria 21158
380 Ga0207648_10017812 3300026089 Bacteria 6447
381 Ga0207648_10141902 3300026089 Bacteria 2117
382 Ga0207676_10021406 3300026095 Bacteria 4743
383 Ga0207676_10029711 3300026095 Bacteria 4095
384 Ga0207676_10038010 3300026095 Bacteria 3672
385 Ga0207674_10000822 3300026116 Bacteria 40380
386 Ga0207674_10004512 3300026116 Bacteria 16733
387 Ga0207674_10041339 3300026116 Bacteria 4768
388 Ga0207674_10042396 3300026116 Bacteria 4700
389 Ga0207674_10043884 3300026116 Bacteria 4608
390 Ga0207675_100001768 3300026118 Bacteria 21608
391 Ga0207675_100014948 3300026118 Bacteria 7245
392 Ga0207675_100025499 3300026118 Bacteria 5503
393 Ga0207675_100042874 3300026118 Bacteria 4225
394 Ga0207683_10000535 3300026121 Bacteria 35178
395 Ga0207683_10010341 3300026121 Bacteria 7957
396 Ga0207683_10040459 3300026121 Bacteria 4068
397 Ga0207683_10075038 3300026121 Bacteria 2993
398 Ga0207698_10001194 3300026142 Bacteria 15131
399 Ga0207698_10015113 3300026142 Bacteria 5160
400 Ga0207698_10026415 3300026142 Bacteria 4107
401 Ga0207698_10046742 3300026142 Bacteria 3272
402 Ga0209968_1003644 3300027526 Bacteria 2310
403 Ga0207428_10048745 3300027907 Bacteria 3396
404 Ga0268266_10000014 3300028379 Bacteria 644033
405 Ga0268266_10001932 3300028379 Bacteria 23313
406 Ga0268264_10000105 3300028381 Bacteria 212531
407 Ga0268264_10000810 3300028381 Bacteria 33689
408 Ga0268264_10003349 3300028381 Bacteria 13851
409 Ga0307517_10002677 3300028786 Bacteria 28446
410 Ga0307515_10000412 3300028794 Bacteria 103361
411 Ga0265338_10020119 3300028800 Bacteria 7038
412 Ga0307511_10001181 3300030521 Bacteria 27727
413 Ga0265327_10000010 3300031251 Bacteria 566817
414 Ga0265327_10000208 3300031251 Bacteria 123034
415 Ga0265327_10000256 3300031251 Bacteria 105748
416 Ga0307513_10111077 3300031456 Bacteria 2734
417 Ga0307509_10090649 3300031507 Bacteria 3132
418 Ga0307508_10000407 3300031616 Bacteria 51637
419 Ga0265314_10040909 3300031711 Bacteria 3323
420 Ga0307516_10003451 3300031730 Bacteria 20267
421 Ga0307416_100039887 3300032002 Bacteria 3641
422 Ga0307510_10004615 3300033180 Bacteria 16242
423 Ga0373937_0002054 3300036401 Bacteria 16833
424 Ga0373937_0091036 3300036401 Bacteria 2826
425 Ga0395899_0000088 3300037312 Bacteria 156987
426 Ga0395899_0042234 3300037312 Bacteria 3405
427 Ga0395900_0104647 3300037418 Bacteria 2908
428 Ga0395905_0006828 3300037471 Bacteria 11423
429 Ga0395901_0000474 3300038443 Bacteria 46605
430 Ga0436365_1926928 3300039437 Bacteria 15797
431 Ga0439431_0002077 3300041997 Bacteria 4425
432 Ga0451577_0004985 3300042876 Bacteria 13768
433 Ga0466969_0000109 3300044656 Bacteria 43750
434 Ga0466972_0000019 3300044658 Bacteria 198523
435 Ga0466972_0000038 3300044658 Bacteria 135937
436 Ga0466972_0000418 3300044658 Bacteria 22205
437 Ga0466972_0010056 3300044658 Bacteria 4752
438 Ga0453684_0004866 3300044712 Bacteria 27530
439 Ga0453684_0063704 3300044712 Bacteria 4714
440 Ga0466970_0009450 3300044765 Bacteria 4929
441 Ga0466970_0029586 3300044765 Bacteria 2885
442 Ga0466957_0001179 3300044842 Bacteria 13578
443 Ga0466957_0002435 3300044842 Bacteria 9996
444 Ga0466959_0000380 3300045049 Bacteria 26260
445 Ga0466959_0001404 3300045049 Bacteria 14712
446 Ga0466959_0053171 3300045049 Bacteria 2962
447 Ga0451576_0000002 3300045051 Bacteria 1670975
448 Ga0495627_000792 3300046453 Bacteria 23123
449 Ga0495627_005492 3300046453 Bacteria 5103
450 Ga0495607_0031001 3300046501 Bacteria 3276
451 Ga0495606_0013306 3300046507 Bacteria 6515
452 Ga0495616_0029010 3300046513 Bacteria 2925
453 Ga0495618_0053494 3300046514 Unclassified 2553
454 Ga0495628_0060869 3300046516 Bacteria 2962
455 Ga0495643_0001491 3300046522 Bacteria 21273
456 Ga0495648_0007062 3300046524 Bacteria 9049
457 Ga0495587_0009393 3300046536 Bacteria 6269
458 Ga0495633_0002201 3300046558 Bacteria 13949
459 Ga0495668_0000187 3300046616 Bacteria 92571
460 Ga0495634_0018183 3300046642 Bacteria 5007
461 Ga0495611_0000139 3300046648 Bacteria 51212
462 Ga0495625_0009326 3300046660 Bacteria 8224
463 Ga0495604_0102753 3300047317 Unclassified 2098
464 Ga0495636_0000007 3300047318 Bacteria 103085
465 Ga0495672_0007236 3300047320 Bacteria 8375
466 Ga0495687_000056 3300047443 Bacteria 188227
467 Ga0495686_0000016 3300047472 Bacteria 443701
468 Ga0495686_0000417 3300047472 Bacteria 67451
469 Ga0495686_0033821 3300047472 Bacteria 3297
470 Ga0496114_0007496 3300048917 Bacteria 8627
471 Ga0496115_0047518 3300048918 Bacteria 3432
472 Ga0496121_0000395 3300048924 Bacteria 88604
473 Ga0496124_0098281 3300048927 Bacteria 2376
474 Ga0501031_0031924 3300049568 Bacteria 3434
475 Ga0501032_0000947 3300049569 Bacteria 23434
476 Ga0501034_0009088 3300049571 Bacteria 10437
477 Ga0501034_0018707 3300049571 Bacteria 7100
478 Ga0501037_0027897 3300049573 Bacteria 4172
479 Ga0501038_0012660 3300049574 Bacteria 7710
480 Ga0501039_0031678 3300049575 Bacteria 4077
481 Ga0501043_0005144 3300049579 Bacteria 10586
482 Ga0501043_0020162 3300049579 Bacteria 5234
483 Ga0501046_0009125 3300049580 Bacteria 8589
484 Ga0501046_0103294 3300049580 Bacteria 2185
485 Ga0501047_0006062 3300049581 Bacteria 11365
486 Ga0501047_0013013 3300049581 Bacteria 7879
487 Ga0501047_0013573 3300049581 Bacteria 7725
488 Ga0501048_0003407 3300049582 Bacteria 12081
489 Ga0501070_0010690 3300049586 Bacteria 7761
490 Ga0501071_0040447 3300049587 Bacteria 3336
491 Ga0501072_0045823 3300049588 Bacteria 3440
492 Ga0501074_0000918 3300049590 Bacteria 18884
493 Ga0501243_000059 3300049675 Bacteria 10799
494 Ga0501245_000186 3300049708 Bacteria 6893
495 Ga0501080_0128452 3300049742 Bacteria 2347
496 Ga0501083_0037839 3300049744 Bacteria 3283
497 Ga0501035_0013148 3300049822 Bacteria 7640
498 Ga0501035_0014750 3300049822 Bacteria 7215
499 Ga0501035_0059110 3300049822 Bacteria 3414
500 Ga0501044_0003613 3300049823 Bacteria 17398
501 Ga0501044_0007122 3300049823 Bacteria 12299
502 Ga0501044_0022971 3300049823 Bacteria 6639
503 Ga0501044_0058182 3300049823 Bacteria 3965
504 Ga0501044_0102894 3300049823 Bacteria 2871
505 Ga0501044_0106572 3300049823 Bacteria 2815
506 Ga0501284_00074 3300050005 Bacteria 28202
507 nmdc:mga05p37_8806_c1 3300050507 Bacteria 11925
508 nmdc:mga09592_2377_c1 3300050508 Bacteria 15185
509 nmdc:mga09592_35915_c1 3300050508 Bacteria 4150
510 nmdc:mga09592_91006_c1 3300050508 Bacteria 2607
511 nmdc:mga06r32_39647_c1 3300050510 Bacteria 4470
512 nmdc:mga08y16_24106_c1 3300050511 Bacteria 6425
513 nmdc:mga08y16_88127_c1 3300050511 Bacteria 3234
514 Ga0500578_0000009 3300053086 Bacteria 219807
515 Ga0500578_0022332 3300053086 Bacteria 4063
516 Ga0500644_0000077 3300053088 Bacteria 59580
517 Ga0500644_0011379 3300053088 Bacteria 2431
518 Ga0500646_0000334 3300053090 Bacteria 14167
519 Ga0500646_0000987 3300053090 Bacteria 7766
520 Ga0500583_0000036 3300053092 Bacteria 95404
521 Ga0500651_0055286 3300053093 Bacteria 2487
522 Ga0500562_000083 3300053108 Bacteria 41350
523 Ga0500569_000122 3300053109 Bacteria 12100
524 Ga0500652_004801 3300053131 Bacteria 4213
525 Ga0500652_007363 3300053131 Bacteria 3599
526 Ga0500559_0019353 3300053136 Bacteria 2878
527 Ga0500568_0000606 3300053139 Bacteria 25992
528 Ga0500577_0000218 3300053142 Bacteria 15217
529 Ga0500604_0005485 3300053151 Bacteria 3349
530 Ga0500616_0007120 3300053153 Bacteria 7164
531 Ga0500622_0000371 3300053156 Bacteria 43288
532 Ga0500622_0001321 3300053156 Bacteria 20162
533 Ga0500622_0004179 3300053156 Bacteria 9224
534 Ga0500636_0016920 3300053177 Bacteria 4300
535 Ga0500611_000076 3300053727 Bacteria 38269
536 Ga0501084_0024217 3300054114 Bacteria 5063

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0040447 Ga0501071_0040447_1460_3241 519
2 3300047472 Ga0495686_0033821 Ga0495686_0033821_564_2408 520
3 3300049744 Ga0501083_0037839 Ga0501083_0037839_1228_3009 523
4 3300046522 Ga0495643_0001491 Ga0495643_0001491_9311_11176 531
5 3300005471 Ga0070698_100040449 Ga0070698_1000404493 536
6 3300026118 Ga0207675_100014948 Ga0207675_1000149482 537
7 3300014968 Ga0157379_10080248 Ga0157379_100802483 542
8 3300049822 Ga0501035_0014750 Ga0501035_0014750_1674_3668 545
9 3300046513 Ga0495616_0029010 Ga0495616_0029010_727_2592 547
10 3300046660 Ga0495625_0009326 Ga0495625_0009326_687_2552 547
11 3300053090 Ga0500646_0000987 Ga0500646_0000987_3665_5530 547
12 3300046453 Ga0495627_005492 Ga0495627_005492_2315_4177 549
13 3300038443 Ga0395901_0000474 Ga0395901_0000474_36321_38216 555
14 3300046616 Ga0495668_0000187 Ga0495668_0000187_71705_73609 555
15 3300017792 Ga0163161_10020358 Ga0163161_100203583 561
16 3300046501 Ga0495607_0031001 Ga0495607_0031001_1009_2877 561
17 3300005329 Ga0070683_100155994 Ga0070683_1001559941 562
18 3300005356 Ga0070674_100041094 Ga0070674_1000410942 562
19 3300014326 Ga0157380_10003644 Ga0157380_100036448 565
20 3300045049 Ga0466959_0053171 Ga0466959_0053171_355_2220 565
21 3300006844 Ga0075428_100133778 Ga0075428_1001337781 566
22 3300027526 Ga0209968_1003644 Ga0209968_10036442 567
23 3300021384 Ga0213876_10055314 Ga0213876_100553141 568
24 3300003354 JGI25160J50197_1001292 JGI25160J50197_10012922 569
25 3300003790 Ga0055528_1000108 Ga0055528_100010810 569
26 3300003791 Ga0055530_10000279 Ga0055530_100002793 569
27 3300005262 Ga0065165_1000019 Ga0065165_100001957 569
28 3300025273 Ga0209673_1000183 Ga0209673_100018331 569
29 3300025298 Ga0209050_1000305 Ga0209050_100030558 569
30 3300025302 Ga0207426_1010215 Ga0207426_10102152 569
31 3300025303 Ga0209051_1011271 Ga0209051_10112714 569
32 3300025304 Ga0209257_1000783 Ga0209257_100078317 569
33 3300014969 Ga0157376_10080117 Ga0157376_100801172 570
34 3300048927 Ga0496124_0098281 Ga0496124_0098281_348_2246 570
35 3300005719 Ga0068861_100056332 Ga0068861_1000563321 572
36 3300031251 Ga0265327_10000208 Ga0265327_1000020826 572
37 3300050508 nmdc:mga09592_2377_c1 nmdc:mga09592_2377_c1_7876_9774 572
38 3300005455 Ga0070663_100099712 Ga0070663_1000997121 573
39 3300006844 Ga0075428_100035479 Ga0075428_1000354792 573
40 3300026118 Ga0207675_100042874 Ga0207675_1000428743 573
41 3300042876 Ga0451577_0004985 Ga0451577_0004985_829_2709 573
42 3300049823 Ga0501044_0058182 Ga0501044_0058182_2019_3899 573
43 3300013307 Ga0157372_10015440 Ga0157372_100154405 574
44 3300053727 Ga0500611_000076 Ga0500611_000076_18582_20477 574
45 3300003215 JGI25153J46596_10002851 JGI25153J46596_100028513 575
46 3300005530 Ga0070679_100036257 Ga0070679_1000362571 575
47 3300014326 Ga0157380_10065795 Ga0157380_100657952 575
48 3300025297 Ga0209758_1000912 Ga0209758_10009124 575
49 3300037312 Ga0395899_0042234 Ga0395899_0042234_488_2395 575
50 3300049581 Ga0501047_0006062 Ga0501047_0006062_8233_10122 575
51 3300009094 Ga0111539_10024385 Ga0111539_100243853 576
52 3300014325 Ga0163163_10113180 Ga0163163_101131802 576
53 3300005356 Ga0070674_100005017 Ga0070674_1000050173 578
54 3300017792 Ga0163161_10110757 Ga0163161_101107571 578
55 3300025937 Ga0207669_10011274 Ga0207669_100112745 578
56 3300005334 Ga0068869_100013596 Ga0068869_1000135962 579
57 3300025942 Ga0207689_10005568 Ga0207689_100055683 579
58 3300005339 Ga0070660_100079346 Ga0070660_1000793462 580
59 3300005365 Ga0070688_100009498 Ga0070688_1000094983 580
60 3300005366 Ga0070659_100002430 Ga0070659_1000024301 580
61 3300005548 Ga0070665_100125872 Ga0070665_1001258721 580
62 3300005618 Ga0068864_100003011 Ga0068864_1000030111 580
63 3300013308 Ga0157375_10059327 Ga0157375_100593273 580
64 3300025904 Ga0207647_10000110 Ga0207647_1000011019 580
65 3300025932 Ga0207690_10018285 Ga0207690_100182851 580
66 3300025936 Ga0207670_10009170 Ga0207670_100091701 580
67 3300025940 Ga0207691_10050436 Ga0207691_100504362 580
68 3300026067 Ga0207678_10015295 Ga0207678_100152952 580
69 3300026095 Ga0207676_10038010 Ga0207676_100380105 580
70 3300044658 Ga0466972_0000038 Ga0466972_0000038_67566_69449 580
71 3300044765 Ga0466970_0029586 Ga0466970_0029586_510_2384 580
72 3300045049 Ga0466959_0001404 Ga0466959_0001404_12601_14475 580
73 3300049569 Ga0501032_0000947 Ga0501032_0000947_17136_19034 580
74 3300049571 Ga0501034_0018707 Ga0501034_0018707_598_2469 580
75 3300049581 Ga0501047_0013013 Ga0501047_0013013_4469_6355 580
76 3300049586 Ga0501070_0010690 Ga0501070_0010690_4952_6850 580
77 3300053153 Ga0500616_0007120 Ga0500616_0007120_4335_6329 580
78 3300025297 Ga0209758_1031605 Ga0209758_10316051 581
79 3300050511 nmdc:mga08y16_88127_c1 nmdc:mga08y16_88127_c1_852_2750 581
80 3300005616 Ga0068852_100089006 Ga0068852_1000890061 582
81 3300009093 Ga0105240_10000281 Ga0105240_1000028148 582
82 3300009545 Ga0105237_10015300 Ga0105237_100153004 582
83 3300013100 Ga0157373_10010150 Ga0157373_100101502 582
84 3300013307 Ga0157372_10036689 Ga0157372_100366893 582
85 3300025913 Ga0207695_10000296 Ga0207695_1000029654 582
86 3300025914 Ga0207671_10015822 Ga0207671_100158223 582
87 3300037312 Ga0395899_0000088 Ga0395899_0000088_16020_17888 582
88 3300005354 Ga0070675_100017355 Ga0070675_1000173553 583
89 3300009147 Ga0114129_10022888 Ga0114129_100228887 583
90 3300025908 Ga0207643_10009332 Ga0207643_100093321 583
91 3300031711 Ga0265314_10040909 Ga0265314_100409092 583
92 3300005354 Ga0070675_100071283 Ga0070675_1000712832 584
93 3300005466 Ga0070685_10051462 Ga0070685_100514621 584
94 3300009545 Ga0105237_10051120 Ga0105237_100511205 584
95 3300025918 Ga0207662_10040084 Ga0207662_100400842 584
96 3300025923 Ga0207681_10094328 Ga0207681_100943282 584
97 3300025925 Ga0207650_10024766 Ga0207650_100247663 584
98 3300025940 Ga0207691_10027609 Ga0207691_100276093 584
99 3300025942 Ga0207689_10020199 Ga0207689_100201993 584
100 3300009545 Ga0105237_10001668 Ga0105237_1000166811 585
101 3300013102 Ga0157371_10009594 Ga0157371_100095943 585
102 3300025914 Ga0207671_10000025 Ga0207671_1000002560 585
103 3300025919 Ga0207657_10017396 Ga0207657_100173967 585
104 3300026089 Ga0207648_10017812 Ga0207648_100178125 585
105 3300044712 Ga0453684_0063704 Ga0453684_0063704_1335_3212 585
106 3300047320 Ga0495672_0007236 Ga0495672_0007236_4776_6668 585
107 3300053086 Ga0500578_0022332 Ga0500578_0022332_1758_3641 585
108 3300005335 Ga0070666_10006029 Ga0070666_100060295 586
109 3300005337 Ga0070682_100002154 Ga0070682_1000021548 586
110 3300005338 Ga0068868_100025638 Ga0068868_1000256381 586
111 3300005354 Ga0070675_100023201 Ga0070675_1000232014 586
112 3300005457 Ga0070662_100096209 Ga0070662_1000962091 586
113 3300005539 Ga0068853_100009165 Ga0068853_1000091656 586
114 3300005564 Ga0070664_100097125 Ga0070664_1000971251 586
115 3300005614 Ga0068856_100014785 Ga0068856_1000147852 586
116 3300013100 Ga0157373_10007735 Ga0157373_100077352 586
117 3300013102 Ga0157371_10022767 Ga0157371_100227673 586
118 3300013296 Ga0157374_10068965 Ga0157374_100689652 586
119 3300025945 Ga0207679_10096528 Ga0207679_100965282 586
120 3300026116 Ga0207674_10042396 Ga0207674_100423962 586
121 3300028800 Ga0265338_10020119 Ga0265338_100201193 586
122 3300050005 Ga0501284_00074 Ga0501284_00074_20463_22337 586
123 3300005539 Ga0068853_100000197 Ga0068853_1000001977 587
124 3300013102 Ga0157371_10020747 Ga0157371_100207472 587
125 3300026041 Ga0207639_10008593 Ga0207639_100085932 587
126 3300026142 Ga0207698_10026415 Ga0207698_100264154 587
127 3300031507 Ga0307509_10090649 Ga0307509_100906493 587
128 3300044658 Ga0466972_0010056 Ga0466972_0010056_581_2479 587
129 3300049579 Ga0501043_0005144 Ga0501043_0005144_520_2418 587
130 3300049580 Ga0501046_0009125 Ga0501046_0009125_2724_4622 587
131 3300049582 Ga0501048_0003407 Ga0501048_0003407_8245_10143 587
132 3300049823 Ga0501044_0003613 Ga0501044_0003613_12295_14193 587
133 3300053092 Ga0500583_0000036 Ga0500583_0000036_2424_4310 587
134 3300003771 Ga0055526_1010998 Ga0055526_10109982 588
135 3300005466 Ga0070685_10020850 Ga0070685_100208503 588
136 3300013105 Ga0157369_10031150 Ga0157369_100311506 588
137 3300037471 Ga0395905_0006828 Ga0395905_0006828_1457_3358 588
138 3300048918 Ga0496115_0047518 Ga0496115_0047518_1066_2973 588
139 3300005329 Ga0070683_100018456 Ga0070683_1000184565 589
140 3300005344 Ga0070661_100004500 Ga0070661_1000045007 589
141 3300005347 Ga0070668_100022308 Ga0070668_1000223083 589
142 3300005366 Ga0070659_100017107 Ga0070659_1000171073 589
143 3300005535 Ga0070684_100001959 Ga0070684_1000019595 589
144 3300005539 Ga0068853_100000694 Ga0068853_10000069418 589
145 3300005563 Ga0068855_100000701 Ga0068855_10000070125 589
146 3300005564 Ga0070664_100001378 Ga0070664_10000137813 589
147 3300005577 Ga0068857_100000631 Ga0068857_10000063111 589
148 3300005616 Ga0068852_100098405 Ga0068852_1000984052 589
149 3300009093 Ga0105240_10000263 Ga0105240_1000026335 589
150 3300009093 Ga0105240_10010527 Ga0105240_100105275 589
151 3300009174 Ga0105241_10008606 Ga0105241_100086065 589
152 3300009545 Ga0105237_10114993 Ga0105237_101149932 589
153 3300009551 Ga0105238_10000650 Ga0105238_1000065028 589
154 3300009553 Ga0105249_10139633 Ga0105249_101396332 589
155 3300013307 Ga0157372_10013317 Ga0157372_100133172 589
156 3300013307 Ga0157372_10080698 Ga0157372_100806983 589
157 3300025913 Ga0207695_10000128 Ga0207695_1000012876 589
158 3300025913 Ga0207695_10000720 Ga0207695_1000072018 589
159 3300025914 Ga0207671_10004310 Ga0207671_100043102 589
160 3300025920 Ga0207649_10001702 Ga0207649_100017026 589
161 3300025924 Ga0207694_10068347 Ga0207694_100683473 589
162 3300025945 Ga0207679_10000822 Ga0207679_1000082214 589
163 3300025949 Ga0207667_10000143 Ga0207667_1000014377 589
164 3300026041 Ga0207639_10000910 Ga0207639_100009105 589
165 3300026116 Ga0207674_10004512 Ga0207674_1000451211 589
166 3300026142 Ga0207698_10046742 Ga0207698_100467422 589
167 3300053156 Ga0500622_0000371 Ga0500622_0000371_4374_6278 589
168 3300003203 JGI25406J46586_10006354 JGI25406J46586_100063544 590
169 3300003354 JGI25160J50197_1000175 JGI25160J50197_100017546 590
170 3300005985 Ga0081539_10000081 Ga0081539_1000008171 590
171 3300025302 Ga0207426_1000104 Ga0207426_1000104103 590
172 3300025945 Ga0207679_10004389 Ga0207679_100043894 590
173 3300049822 Ga0501035_0013148 Ga0501035_0013148_5039_6937 590
174 3300005290 Ga0065712_10005175 Ga0065712_100051751 591
175 3300005329 Ga0070683_100001537 Ga0070683_10000153713 591
176 3300005344 Ga0070661_100047835 Ga0070661_1000478352 591
177 3300005535 Ga0070684_100026667 Ga0070684_1000266673 591
178 3300005548 Ga0070665_100000009 Ga0070665_100000009358 591
179 3300005564 Ga0070664_100002631 Ga0070664_10000263112 591
180 3300005843 Ga0068860_100000078 Ga0068860_10000007839 591
181 3300013306 Ga0163162_10008781 Ga0163162_100087817 591
182 3300014325 Ga0163163_10000457 Ga0163163_1000045725 591
183 3300025920 Ga0207649_10014475 Ga0207649_100144753 591
184 3300025933 Ga0207706_10003814 Ga0207706_100038145 591
185 3300025944 Ga0207661_10005038 Ga0207661_100050386 591
186 3300026116 Ga0207674_10041339 Ga0207674_100413392 591
187 3300028379 Ga0268266_10000014 Ga0268266_10000014314 591
188 3300028381 Ga0268264_10000105 Ga0268264_10000105143 591
189 3300046524 Ga0495648_0007062 Ga0495648_0007062_2868_4775 591
190 3300047318 Ga0495636_0000007 Ga0495636_0000007_96201_98090 591
191 3300049571 Ga0501034_0009088 Ga0501034_0009088_296_2185 591
192 3300049573 Ga0501037_0027897 Ga0501037_0027897_1356_3245 591
193 3300049822 Ga0501035_0059110 Ga0501035_0059110_1006_2895 591
194 3300049823 Ga0501044_0022971 Ga0501044_0022971_3817_5706 591
195 3300053156 Ga0500622_0004179 Ga0500622_0004179_770_2677 591
196 3300005290 Ga0065712_10073607 Ga0065712_100736073 592
197 3300005334 Ga0068869_100039456 Ga0068869_1000394561 592
198 3300005353 Ga0070669_100004598 Ga0070669_1000045987 592
199 3300005354 Ga0070675_100026621 Ga0070675_1000266215 592
200 3300005364 Ga0070673_100006447 Ga0070673_1000064475 592
201 3300005577 Ga0068857_100016335 Ga0068857_1000163355 592
202 3300005617 Ga0068859_100013292 Ga0068859_1000132927 592
203 3300005719 Ga0068861_100003918 Ga0068861_1000039187 592
204 3300005840 Ga0068870_10012559 Ga0068870_100125592 592
205 3300005844 Ga0068862_100010317 Ga0068862_1000103174 592
206 3300006931 Ga0097620_100013292 Ga0097620_1000132923 592
207 3300009094 Ga0111539_10026729 Ga0111539_100267297 592
208 3300009553 Ga0105249_10027133 Ga0105249_100271332 592
209 3300014325 Ga0163163_10038656 Ga0163163_100386562 592
210 3300014326 Ga0157380_10001574 Ga0157380_1000157410 592
211 3300014745 Ga0157377_10006393 Ga0157377_100063936 592
212 3300025923 Ga0207681_10005990 Ga0207681_100059905 592
213 3300025933 Ga0207706_10012699 Ga0207706_100126993 592
214 3300025942 Ga0207689_10015335 Ga0207689_100153355 592
215 3300025960 Ga0207651_10010190 Ga0207651_100101904 592
216 3300025961 Ga0207712_10015057 Ga0207712_100150575 592
217 3300025961 Ga0207712_10023879 Ga0207712_100238792 592
218 3300026116 Ga0207674_10043884 Ga0207674_100438841 592
219 3300026118 Ga0207675_100001768 Ga0207675_1000017689 592
220 3300027907 Ga0207428_10048745 Ga0207428_100487452 592
221 3300030521 Ga0307511_10001181 Ga0307511_1000118111 592
222 3300031251 Ga0265327_10000010 Ga0265327_10000010183 592
223 3300046507 Ga0495606_0013306 Ga0495606_0013306_3084_5000 592
224 3300050511 nmdc:mga08y16_24106_c1 nmdc:mga08y16_24106_c1_3908_5803 592
225 3300048924 Ga0496121_0000395 Ga0496121_0000395_86672_88573 593
226 3300049568 Ga0501031_0031924 Ga0501031_0031924_1245_3143 593
227 3300006847 Ga0075431_100002821 Ga0075431_1000028216 594
228 3300045051 Ga0451576_0000002 Ga0451576_0000002_1326048_1327949 594
229 3300050508 nmdc:mga09592_35915_c1 nmdc:mga09592_35915_c1_2122_3990 594
230 3300050510 nmdc:mga06r32_39647_c1 nmdc:mga06r32_39647_c1_426_2294 594
231 3300009147 Ga0114129_10012009 Ga0114129_100120096 595
232 3300013296 Ga0157374_10000002 Ga0157374_10000002223 595
233 3300014969 Ga0157376_10000853 Ga0157376_1000085312 595
234 3300032002 Ga0307416_100039887 Ga0307416_1000398874 595
235 3300044712 Ga0453684_0004866 Ga0453684_0004866_11679_13553 595
236 3300050507 nmdc:mga05p37_8806_c1 nmdc:mga05p37_8806_c1_6660_8555 595
237 3300003323 rootH1_10032632 rootH1_100326329 596
238 3300003354 JGI25160J50197_1006486 JGI25160J50197_10064863 596
239 3300005539 Ga0068853_100036941 Ga0068853_1000369415 596
240 3300006844 Ga0075428_100010006 Ga0075428_1000100068 596
241 3300006846 Ga0075430_100008685 Ga0075430_1000086853 596
242 3300009093 Ga0105240_10000023 Ga0105240_10000023262 596
243 3300025302 Ga0207426_1001887 Ga0207426_10018874 596
244 3300025913 Ga0207695_10000016 Ga0207695_1000001657 596
245 3300026041 Ga0207639_10012793 Ga0207639_100127931 596
246 3300026089 Ga0207648_10141902 Ga0207648_101419021 596
247 3300028794 Ga0307515_10000412 Ga0307515_1000041220 596
248 3300031616 Ga0307508_10000407 Ga0307508_1000040715 596
249 3300044658 Ga0466972_0000418 Ga0466972_0000418_19184_21082 596
250 3300049574 Ga0501038_0012660 Ga0501038_0012660_3328_5322 596
251 3300049575 Ga0501039_0031678 Ga0501039_0031678_1588_3486 596
252 3300049579 Ga0501043_0020162 Ga0501043_0020162_1162_3156 596
253 3300049823 Ga0501044_0007122 Ga0501044_0007122_7102_9000 596
254 3300050508 nmdc:mga09592_91006_c1 nmdc:mga09592_91006_c1_549_2426 596
255 3300053086 Ga0500578_0000009 Ga0500578_0000009_172943_174826 596
256 3300053131 Ga0500652_007363 Ga0500652_007363_27_1925 596
257 3300025302 Ga0207426_1000033 Ga0207426_1000033343 597
258 3300036401 Ga0373937_0002054 Ga0373937_0002054_5524_7413 597
259 3300046514 Ga0495618_0053494 Ga0495618_0053494_260_2149 597
260 3300046516 Ga0495628_0060869 Ga0495628_0060869_303_2192 597
261 3300046536 Ga0495587_0009393 Ga0495587_0009393_4335_6224 597
262 3300046642 Ga0495634_0018183 Ga0495634_0018183_65_1954 597
263 3300047317 Ga0495604_0102753 Ga0495604_0102753_31_1920 597
264 3300053131 Ga0500652_004801 Ga0500652_004801_133_2016 597
265 3300003320 rootH2_10036622 rootH2_1003662213 598
266 3300003323 rootH1_10004759 rootH1_1000475930 598
267 3300013105 Ga0157369_10108958 Ga0157369_101089582 598
268 3300025242 Ga0209258_100032 Ga0209258_100032182 598
269 3300025254 Ga0209148_1000186 Ga0209148_100018657 598
270 3300053088 Ga0500644_0000077 Ga0500644_0000077_55825_57726 598
271 3300053093 Ga0500651_0055286 Ga0500651_0055286_44_1948 598
272 3300053109 Ga0500569_000122 Ga0500569_000122_8085_9989 598
273 3300053142 Ga0500577_0000218 Ga0500577_0000218_2496_4400 598
274 3300053177 Ga0500636_0016920 Ga0500636_0016920_1066_2967 598
275 3300003320 rootH2_10024015 rootH2_100240152 599
276 3300005335 Ga0070666_10041011 Ga0070666_100410112 599
277 3300005340 Ga0070689_100014127 Ga0070689_1000141272 599
278 3300005618 Ga0068864_100068121 Ga0068864_1000681212 599
279 3300005841 Ga0068863_100015639 Ga0068863_1000156397 599
280 3300013296 Ga0157374_10029273 Ga0157374_100292733 599
281 3300013306 Ga0163162_10010540 Ga0163162_100105406 599
282 3300014968 Ga0157379_10100797 Ga0157379_101007972 599
283 3300025936 Ga0207670_10009434 Ga0207670_100094345 599
284 3300026023 Ga0207677_10074542 Ga0207677_100745422 599
285 3300026095 Ga0207676_10029711 Ga0207676_100297113 599
286 3300049590 Ga0501074_0000918 Ga0501074_0000918_8725_10623 599
287 3300005327 Ga0070658_10000230 Ga0070658_1000023041 600
288 3300005328 Ga0070676_10001002 Ga0070676_1000100211 600
289 3300005367 Ga0070667_100002462 Ga0070667_10000246210 600
290 3300005539 Ga0068853_100007233 Ga0068853_1000072334 600
291 3300005543 Ga0070672_100000033 Ga0070672_1000000338 600
292 3300005548 Ga0070665_100001625 Ga0070665_1000016258 600
293 3300005614 Ga0068856_100026914 Ga0068856_1000269142 600
294 3300005616 Ga0068852_100017249 Ga0068852_1000172493 600
295 3300005842 Ga0068858_100002290 Ga0068858_1000022903 600
296 3300006881 Ga0068865_100000705 Ga0068865_1000007055 600
297 3300009174 Ga0105241_10026488 Ga0105241_100264882 600
298 3300009553 Ga0105249_10004075 Ga0105249_100040758 600
299 3300013297 Ga0157378_10048492 Ga0157378_100484922 600
300 3300014325 Ga0163163_10000616 Ga0163163_1000061625 600
301 3300014968 Ga0157379_10000229 Ga0157379_100002294 600
302 3300014969 Ga0157376_10000117 Ga0157376_100001173 600
303 3300015265 Ga0182005_1000159 Ga0182005_100015914 600
304 3300025903 Ga0207680_10010797 Ga0207680_100107973 600
305 3300025907 Ga0207645_10002569 Ga0207645_1000256910 600
306 3300025909 Ga0207705_10013822 Ga0207705_100138226 600
307 3300025938 Ga0207704_10001086 Ga0207704_100010863 600
308 3300025940 Ga0207691_10000001 Ga0207691_1000000193 600
309 3300025986 Ga0207658_10002549 Ga0207658_100025499 600
310 3300026023 Ga0207677_10002241 Ga0207677_100022413 600
311 3300044842 Ga0466957_0001179 Ga0466957_0001179_5170_7053 600
312 3300005347 Ga0070668_100000862 Ga0070668_10000086219 601
313 3300005364 Ga0070673_100000096 Ga0070673_1000000968 601
314 3300005457 Ga0070662_100004733 Ga0070662_1000047338 601
315 3300005459 Ga0068867_100005892 Ga0068867_1000058926 601
316 3300005841 Ga0068863_100012550 Ga0068863_1000125508 601
317 3300025933 Ga0207706_10011370 Ga0207706_100113707 601
318 3300025960 Ga0207651_10002700 Ga0207651_100027008 601
319 3300005367 Ga0070667_100018176 Ga0070667_1000181763 602
320 3300005456 Ga0070678_100000605 Ga0070678_1000006055 602
321 3300005718 Ga0068866_10002055 Ga0068866_100020554 602
322 3300006237 Ga0097621_100004248 Ga0097621_1000042485 602
323 3300006881 Ga0068865_100003471 Ga0068865_1000034719 602
324 3300009093 Ga0105240_10000047 Ga0105240_10000047104 602
325 3300009176 Ga0105242_10018943 Ga0105242_100189434 602
326 3300025903 Ga0207680_10014129 Ga0207680_100141293 602
327 3300025907 Ga0207645_10000571 Ga0207645_100005719 602
328 3300025913 Ga0207695_10000010 Ga0207695_10000010135 602
329 3300025940 Ga0207691_10018871 Ga0207691_100188714 602
330 3300025942 Ga0207689_10000939 Ga0207689_1000093911 602
331 3300026089 Ga0207648_10002203 Ga0207648_1000220312 602
332 3300026121 Ga0207683_10000535 Ga0207683_100005359 602
333 3300037418 Ga0395900_0104647 Ga0395900_0104647_648_2522 602
334 3300049581 Ga0501047_0013573 Ga0501047_0013573_1017_2912 602
335 3300003322 rootL2_10025914 rootL2_100259144 603
336 3300005331 Ga0070670_100149277 Ga0070670_1001492771 603
337 3300005354 Ga0070675_100081255 Ga0070675_1000812552 603
338 3300005367 Ga0070667_100073467 Ga0070667_1000734672 603
339 3300005617 Ga0068859_100011172 Ga0068859_1000111723 603
340 3300005618 Ga0068864_100002506 Ga0068864_10000250611 603
341 3300005719 Ga0068861_100035811 Ga0068861_1000358113 603
342 3300006931 Ga0097620_100011171 Ga0097620_1000111713 603
343 3300009101 Ga0105247_10007184 Ga0105247_100071844 603
344 3300009553 Ga0105249_10016454 Ga0105249_100164544 603
345 3300009553 Ga0105249_10020524 Ga0105249_100205242 603
346 3300010375 Ga0105239_10000760 Ga0105239_1000076028 603
347 3300010375 Ga0105239_10000916 Ga0105239_1000091618 603
348 3300014325 Ga0163163_10017383 Ga0163163_100173834 603
349 3300014326 Ga0157380_10020217 Ga0157380_100202174 603
350 3300021384 Ga0213876_10002778 Ga0213876_100027784 603
351 3300025900 Ga0207710_10003723 Ga0207710_100037235 603
352 3300025914 Ga0207671_10065972 Ga0207671_100659721 603
353 3300025926 Ga0207659_10041999 Ga0207659_100419991 603
354 3300025961 Ga0207712_10008393 Ga0207712_100083934 603
355 3300025961 Ga0207712_10011203 Ga0207712_100112032 603
356 3300026095 Ga0207676_10021406 Ga0207676_100214064 603
357 3300026118 Ga0207675_100025499 Ga0207675_1000254993 603
358 3300028786 Ga0307517_10002677 Ga0307517_1000267716 603
359 3300039437 Ga0436365_1926928 Ga0436365_1926928_8967_10835 603
360 3300044842 Ga0466957_0002435 Ga0466957_0002435_3527_5410 603
361 3300049675 Ga0501243_000059 Ga0501243_000059_1582_3453 603
362 3300049708 Ga0501245_000186 Ga0501245_000186_4293_6164 603
363 3300013297 Ga0157378_10052632 Ga0157378_100526324 604
364 3300003320 rootH2_10015377 rootH2_1001537711 605
365 3300005331 Ga0070670_100024730 Ga0070670_1000247303 605
366 3300005334 Ga0068869_100063165 Ga0068869_1000631652 605
367 3300005459 Ga0068867_100002197 Ga0068867_10000219710 605
368 3300006237 Ga0097621_100002550 Ga0097621_10000255014 605
369 3300009553 Ga0105249_10029726 Ga0105249_100297264 605
370 3300013306 Ga0163162_10012796 Ga0163162_100127966 605
371 3300025942 Ga0207689_10017542 Ga0207689_100175427 605
372 3300026089 Ga0207648_10001686 Ga0207648_100016862 605
373 3300049823 Ga0501044_0102894 Ga0501044_0102894_761_2629 605
374 3300049823 Ga0501044_0106572 Ga0501044_0106572_879_2786 605
375 3300003320 rootH2_10025304 rootH2_1002530413 606
376 3300005336 Ga0070680_100005480 Ga0070680_1000054806 606
377 3300005337 Ga0070682_100000439 Ga0070682_10000043915 606
378 3300005341 Ga0070691_10000811 Ga0070691_100008112 606
379 3300005367 Ga0070667_100033070 Ga0070667_1000330702 606
380 3300005458 Ga0070681_10003457 Ga0070681_100034575 606
381 3300005530 Ga0070679_100006343 Ga0070679_1000063433 606
382 3300005563 Ga0068855_100004165 Ga0068855_1000041654 606
383 3300005563 Ga0068855_100081410 Ga0068855_1000814103 606
384 3300005843 Ga0068860_100003374 Ga0068860_1000033746 606
385 3300006358 Ga0068871_100020948 Ga0068871_1000209487 606
386 3300009093 Ga0105240_10001324 Ga0105240_1000132415 606
387 3300009174 Ga0105241_10000319 Ga0105241_1000031910 606
388 3300009545 Ga0105237_10011021 Ga0105237_100110215 606
389 3300010375 Ga0105239_10003815 Ga0105239_100038157 606
390 3300013104 Ga0157370_10000479 Ga0157370_1000047936 606
391 3300013306 Ga0163162_10000190 Ga0163162_100001904 606
392 3300014969 Ga0157376_10055580 Ga0157376_100555804 606
393 3300025911 Ga0207654_10038450 Ga0207654_100384503 606
394 3300025912 Ga0207707_10002013 Ga0207707_100020139 606
395 3300025913 Ga0207695_10080906 Ga0207695_100809062 606
396 3300025914 Ga0207671_10014791 Ga0207671_100147915 606
397 3300025917 Ga0207660_10002865 Ga0207660_100028657 606
398 3300025921 Ga0207652_10001732 Ga0207652_1000173210 606
399 3300025949 Ga0207667_10014323 Ga0207667_100143235 606
400 3300028381 Ga0268264_10003349 Ga0268264_100033497 606
401 3300036401 Ga0373937_0091036 Ga0373937_0091036_392_2278 606
402 3300047443 Ga0495687_000056 Ga0495687_000056_131106_133013 606
403 3300047472 Ga0495686_0000016 Ga0495686_0000016_114216_116138 606
404 3300049742 Ga0501080_0128452 Ga0501080_0128452_140_2014 606
405 iso_pu_bacteria 2818991444 2819586855 606
406 3300005330 Ga0070690_100068453 Ga0070690_1000684531 607
407 3300005347 Ga0070668_100026890 Ga0070668_1000268902 607
408 3300005353 Ga0070669_100049455 Ga0070669_1000494552 607
409 3300005563 Ga0068855_100002673 Ga0068855_10000267320 607
410 3300005577 Ga0068857_100000290 Ga0068857_1000002906 607
411 3300010375 Ga0105239_10001869 Ga0105239_100018697 607
412 3300013104 Ga0157370_10002029 Ga0157370_100020296 607
413 3300013307 Ga0157372_10000716 Ga0157372_1000071618 607
414 3300013307 Ga0157372_10017331 Ga0157372_100173315 607
415 3300014968 Ga0157379_10111146 Ga0157379_101111462 607
416 3300025914 Ga0207671_10018663 Ga0207671_100186635 607
417 3300025940 Ga0207691_10068212 Ga0207691_100682122 607
418 3300025949 Ga0207667_10000583 Ga0207667_1000058321 607
419 3300026078 Ga0207702_10042757 Ga0207702_100427573 607
420 3300026116 Ga0207674_10000822 Ga0207674_1000082228 607
421 3300026142 Ga0207698_10001194 Ga0207698_100011946 607
422 3300044658 Ga0466972_0000019 Ga0466972_0000019_709_2589 607
423 3300044765 Ga0466970_0009450 Ga0466970_0009450_2858_4738 607
424 3300046453 Ga0495627_000792 Ga0495627_000792_14051_15964 607
425 3300046558 Ga0495633_0002201 Ga0495633_0002201_11531_13444 607
426 3300049580 Ga0501046_0103294 Ga0501046_0103294_94_2010 607
427 3300049588 Ga0501072_0045823 Ga0501072_0045823_213_2129 607
428 3300054114 Ga0501084_0024217 Ga0501084_0024217_2294_4210 607
429 iso_pu_bacteria 2821136567 2821140725 607
430 iso_pu_bacteria 2904467357 2904471227 607
431 3300001989 JGI24739J22299_10000195 JGI24739J22299_100001953 608
432 3300005331 Ga0070670_100059989 Ga0070670_1000599892 608
433 3300005367 Ga0070667_100010439 Ga0070667_1000104396 608
434 3300005841 Ga0068863_100074607 Ga0068863_1000746072 608
435 3300006237 Ga0097621_100000595 Ga0097621_10000059519 608
436 3300006358 Ga0068871_100000415 Ga0068871_10000041520 608
437 3300009551 Ga0105238_10069346 Ga0105238_100693461 608
438 3300010375 Ga0105239_10038996 Ga0105239_100389962 608
439 3300013296 Ga0157374_10111931 Ga0157374_101119312 608
440 3300013297 Ga0157378_10002110 Ga0157378_100021109 608
441 3300013306 Ga0163162_10000371 Ga0163162_1000037117 608
442 3300013308 Ga0157375_10000935 Ga0157375_1000093513 608
443 3300014968 Ga0157379_10007387 Ga0157379_100073877 608
444 3300014969 Ga0157376_10000453 Ga0157376_1000045310 608
445 3300017792 Ga0163161_10004059 Ga0163161_100040593 608
446 3300025297 Ga0209758_1001642 Ga0209758_100164221 608
447 3300025986 Ga0207658_10028271 Ga0207658_100282711 608
448 3300026121 Ga0207683_10075038 Ga0207683_100750382 608
449 3300044656 Ga0466969_0000109 Ga0466969_0000109_17595_19481 608
450 3300045049 Ga0466959_0000380 Ga0466959_0000380_11245_13131 608
451 iso_pu_bacteria 2738541278 2738726524 608
452 iso_pu_bacteria 2818991442 2819574637 608
453 iso_pu_bacteria 2929921140 2929922185 608
454 iso_pu_bacteria 8003151029 8003155200 608
455 3300005456 Ga0070678_100014157 Ga0070678_1000141571 609
456 3300005457 Ga0070662_100002855 Ga0070662_1000028552 609
457 3300005471 Ga0070698_100011022 Ga0070698_1000110228 609
458 3300005983 Ga0081540_1017990 Ga0081540_10179902 609
459 3300009553 Ga0105249_10017922 Ga0105249_100179223 609
460 3300013306 Ga0163162_10004419 Ga0163162_1000441913 609
461 3300013308 Ga0157375_10119116 Ga0157375_101191162 609
462 3300017792 Ga0163161_10035452 Ga0163161_100354522 609
463 3300025304 Ga0209257_1000233 Ga0209257_100023360 609
464 3300025907 Ga0207645_10005503 Ga0207645_100055038 609
465 3300025933 Ga0207706_10073896 Ga0207706_100738963 609
466 3300026088 Ga0207641_10001344 Ga0207641_1000134414 609
467 3300048917 Ga0496114_0007496 Ga0496114_0007496_6428_8338 609
468 iso_pu_bacteria 2929154850 2929156996 609
469 3300005335 Ga0070666_10000140 Ga0070666_1000014028 610
470 3300005355 Ga0070671_100064167 Ga0070671_1000641673 610
471 3300005364 Ga0070673_100024287 Ga0070673_1000242872 610
472 3300005364 Ga0070673_100030337 Ga0070673_1000303371 610
473 3300005367 Ga0070667_100032100 Ga0070667_1000321003 610
474 3300005456 Ga0070678_100091560 Ga0070678_1000915602 610
475 3300005459 Ga0068867_100115029 Ga0068867_1001150291 610
476 3300005544 Ga0070686_100018894 Ga0070686_1000188943 610
477 3300005564 Ga0070664_100112531 Ga0070664_1001125311 610
478 3300005616 Ga0068852_100047116 Ga0068852_1000471163 610
479 3300005617 Ga0068859_100005301 Ga0068859_1000053019 610
480 3300005841 Ga0068863_100079510 Ga0068863_1000795102 610
481 3300005842 Ga0068858_100008890 Ga0068858_1000088909 610
482 3300005843 Ga0068860_100002082 Ga0068860_1000020822 610
483 3300006358 Ga0068871_100118684 Ga0068871_1001186841 610
484 3300006931 Ga0097620_100005301 Ga0097620_1000053016 610
485 3300009101 Ga0105247_10007085 Ga0105247_100070855 610
486 3300009174 Ga0105241_10006156 Ga0105241_100061568 610
487 3300009553 Ga0105249_10008383 Ga0105249_1000838310 610
488 3300013297 Ga0157378_10009097 Ga0157378_100090977 610
489 3300013297 Ga0157378_10113820 Ga0157378_101138202 610
490 3300013306 Ga0163162_10001924 Ga0163162_1000192415 610
491 3300013308 Ga0157375_10012957 Ga0157375_100129575 610
492 3300014325 Ga0163163_10044208 Ga0163163_100442082 610
493 3300014969 Ga0157376_10021632 Ga0157376_100216324 610
494 3300025901 Ga0207688_10031071 Ga0207688_100310711 610
495 3300025903 Ga0207680_10000140 Ga0207680_1000014022 610
496 3300025907 Ga0207645_10078447 Ga0207645_100784471 610
497 3300025914 Ga0207671_10004643 Ga0207671_100046434 610
498 3300025918 Ga0207662_10052964 Ga0207662_100529641 610
499 3300025940 Ga0207691_10062223 Ga0207691_100622232 610
500 3300025942 Ga0207689_10003471 Ga0207689_1000347110 610
501 3300025945 Ga0207679_10055578 Ga0207679_100555781 610
502 3300025981 Ga0207640_10047834 Ga0207640_100478341 610
503 3300026035 Ga0207703_10038318 Ga0207703_100383182 610
504 3300026088 Ga0207641_10000082 Ga0207641_1000008251 610
505 3300026121 Ga0207683_10010341 Ga0207683_100103411 610
506 3300026121 Ga0207683_10040459 Ga0207683_100404591 610
507 3300026142 Ga0207698_10015113 Ga0207698_100151135 610
508 3300028381 Ga0268264_10000810 Ga0268264_1000081019 610
509 3300041997 Ga0439431_0002077 Ga0439431_0002077_2014_3909 610
510 iso_pu_bacteria 2818991460 2819676526 610
511 iso_pu_bacteria 2881955468 2881957910 610
512 iso_pu_bacteria 2914759650 2914761151 610
513 iso_pu_bacteria 2929177148 2929178108 610
514 iso_pu_bacteria 2929239360 2929240420 610
515 iso_pu_bacteria 2945977869 2945980470 610
516 iso_pu_bacteria 2946013367 2946013668 610
517 3300003322 rootL2_10163372 rootL2_101633722 611
518 3300003323 rootH1_10154878 rootH1_101548786 611
519 3300005334 Ga0068869_100017060 Ga0068869_1000170603 611
520 3300005344 Ga0070661_100061243 Ga0070661_1000612432 611
521 3300005367 Ga0070667_100039986 Ga0070667_1000399863 611
522 3300005457 Ga0070662_100002759 Ga0070662_1000027596 611
523 3300005564 Ga0070664_100089374 Ga0070664_1000893742 611
524 3300005616 Ga0068852_100038805 Ga0068852_1000388052 611
525 3300013308 Ga0157375_10031490 Ga0157375_100314906 611
526 3300014969 Ga0157376_10006481 Ga0157376_100064815 611
527 3300025899 Ga0207642_10008859 Ga0207642_100088592 611
528 3300025903 Ga0207680_10019116 Ga0207680_100191161 611
529 3300025933 Ga0207706_10025104 Ga0207706_100251042 611
530 3300026078 Ga0207702_10098062 Ga0207702_100980622 611
531 3300031456 Ga0307513_10111077 Ga0307513_101110771 611
532 3300053090 Ga0500646_0000334 Ga0500646_0000334_4877_6802 611
533 3300053136 Ga0500559_0019353 Ga0500559_0019353_499_2400 611
534 3300053151 Ga0500604_0005485 Ga0500604_0005485_1267_3165 611
535 iso_pu_bacteria 2884791551 2884796380 611
536 3300002738 JGI25154J39366_1000003 JGI25154J39366_1000003201 612
537 3300025246 Ga0209646_1000004 Ga0209646_1000004138 612
538 3300025250 Ga0209026_1000132 Ga0209026_100013288 612
539 3300047472 Ga0495686_0000417 Ga0495686_0000417_62873_64777 612
540 3300053139 Ga0500568_0000606 Ga0500568_0000606_532_2448 612
541 3300053088 Ga0500644_0011379 Ga0500644_0011379_448_2373 613
542 3300053108 Ga0500562_000083 Ga0500562_000083_32221_34146 613
543 3300053156 Ga0500622_0001321 Ga0500622_0001321_14094_16019 613
544 3300009545 Ga0105237_10000572 Ga0105237_1000057235 614
545 3300031730 Ga0307516_10003451 Ga0307516_100034514 614
546 3300033180 Ga0307510_10004615 Ga0307510_100046158 614
547 3300046648 Ga0495611_0000139 Ga0495611_0000139_29696_31672 614
548 3300005548 Ga0070665_100002141 Ga0070665_10000214111 621
549 3300028379 Ga0268266_10001932 Ga0268266_1000193214 621
550 3300031251 Ga0265327_10000256 Ga0265327_1000025645 621
551 2162886007 SwRhRL2b_contig_104926 SwRhRL2b_0327.00003430 623
552 3300005289 Ga0065704_10070133 Ga0065704_10070133703 623

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16326

ABC_tran_CTD

ABC transporter C-terminal domain

589

655

0.96

PF12848

ABC_tran_Xtn

ABC transporter

243

327

0.92

PF00005

ABC_tran

ABC transporter

39

204

0.84

PF00005

ABC_tran

ABC transporter

352

487

0.81

Feature Viewer

pLDDT pTM Quality
76.23 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map