F462724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 552 | 270 | 536 | 614 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10000572|Ga0105237_1000057235 |
| Length | 658 |
| Sequence | VVAGWLSLAAGLPIIAYICGMHYVSVEGLSKSYGVKPLFTNITFHIEEGDKIALVARNGSGKSTLLKILAGKDTAEGGTVWIHKDVTVALFEQEPVFAEEKSILDNIFHHNHPVINAIKAYEAASDEEDVDKITDAIVRLDELNAWDFDTKVKQILGKLNIHHLQQAAGTLSGGQRKRVALAKTLIDIGFEHKHVLLIMDEPTNHLDVEMVEWLEHYLNQEKVTLLLVTHDRYFLDNVSEEIWEMDGSNLYVYKGDYENYLEKKTARIENDTASIDKARNTYRKELEWMRKQPKARTTKSKSRQDNFYVVEAKAKQRIEDQQVELQMKMNRLGGKIAELKKVYKSFGEKVILKGFDYTFKKGERLGVIGKNGVGKSTFINMLQGLEEPDSGKINIGETIIFGNYSQSGLVIKEDMRVIEYVKNIAEHFPLAGGGSLSAAQFLQLFLFPPEQQYTYISKLSGGEKRRLHLLSILFRNPNFLVLDEPTNDLDLPTLGILENFLSEYQGCLLIVSHDRYFMDRLVDHLLVLEGNGVVRDFPGNYSQYREWQKLDDERAEFRPPGDGYQASPSPAPAAKPVEASVAPAVVKKQLTYKEKRELEDLEKEMARLNQEKKDITEKLNSGMAPFDQLQQLSIRIGEISQLLDDKELRWLELSEMGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 8 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 9 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 10 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 11 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 12 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 13 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 14 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 15 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 16 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 19 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 243 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 249 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 254 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 256 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 257 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 258 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 259 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 260 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 261 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 264 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 265 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 267 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.1 |
| Metatranscriptomes | 0 |
| Isolates | 2.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.97 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 84.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_104926 | 2162886007 | Bacteria | 77416 |
| 2 | JGI24739J22299_10000195 | 3300001989 | Bacteria | 20024 |
| 3 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 4 | JGI25406J46586_10006354 | 3300003203 | Bacteria | 5450 |
| 5 | JGI25153J46596_10002851 | 3300003215 | Bacteria | 9818 |
| 6 | rootH2_10015377 | 3300003320 | Bacteria | 18976 |
| 7 | rootH2_10024015 | 3300003320 | Bacteria | 6362 |
| 8 | rootH2_10025304 | 3300003320 | Bacteria | 18998 |
| 9 | rootH2_10036622 | 3300003320 | Bacteria | 17189 |
| 10 | rootL2_10025914 | 3300003322 | Bacteria | 5068 |
| 11 | rootL2_10163372 | 3300003322 | Bacteria | 4410 |
| 12 | rootH1_10004759 | 3300003323 | Bacteria | 40082 |
| 13 | rootH1_10032632 | 3300003323 | Bacteria | 15899 |
| 14 | rootH1_10154878 | 3300003323 | Bacteria | 9017 |
| 15 | JGI25160J50197_1000175 | 3300003354 | Bacteria | 54393 |
| 16 | JGI25160J50197_1001292 | 3300003354 | Bacteria | 12654 |
| 17 | JGI25160J50197_1006486 | 3300003354 | Bacteria | 4728 |
| 18 | Ga0055526_1010998 | 3300003771 | Bacteria | 4134 |
| 19 | Ga0055528_1000108 | 3300003790 | Bacteria | 66828 |
| 20 | Ga0055530_10000279 | 3300003791 | Bacteria | 46371 |
| 21 | Ga0065165_1000019 | 3300005262 | Bacteria | 271815 |
| 22 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 23 | Ga0065712_10005175 | 3300005290 | Bacteria | 2971 |
| 24 | Ga0065712_10073607 | 3300005290 | Bacteria | 4327 |
| 25 | Ga0070658_10000230 | 3300005327 | Bacteria | 49640 |
| 26 | Ga0070676_10001002 | 3300005328 | Bacteria | 14031 |
| 27 | Ga0070683_100001537 | 3300005329 | Bacteria | 17862 |
| 28 | Ga0070683_100018456 | 3300005329 | Bacteria | 6179 |
| 29 | Ga0070683_100155994 | 3300005329 | Bacteria | 2165 |
| 30 | Ga0070690_100068453 | 3300005330 | Bacteria | 2303 |
| 31 | Ga0070670_100024730 | 3300005331 | Bacteria | 5166 |
| 32 | Ga0070670_100059989 | 3300005331 | Bacteria | 3265 |
| 33 | Ga0070670_100149277 | 3300005331 | Bacteria | 2023 |
| 34 | Ga0068869_100013596 | 3300005334 | Bacteria | 5417 |
| 35 | Ga0068869_100017060 | 3300005334 | Bacteria | 4912 |
| 36 | Ga0068869_100039456 | 3300005334 | Bacteria | 3371 |
| 37 | Ga0068869_100063165 | 3300005334 | Bacteria | 2719 |
| 38 | Ga0070666_10000140 | 3300005335 | Bacteria | 50189 |
| 39 | Ga0070666_10006029 | 3300005335 | Bacteria | 7446 |
| 40 | Ga0070666_10041011 | 3300005335 | Bacteria | 3092 |
| 41 | Ga0070680_100005480 | 3300005336 | Bacteria | 9600 |
| 42 | Ga0070682_100000439 | 3300005337 | Bacteria | 26883 |
| 43 | Ga0070682_100002154 | 3300005337 | Bacteria | 10934 |
| 44 | Ga0068868_100025638 | 3300005338 | Bacteria | 4488 |
| 45 | Ga0070660_100079346 | 3300005339 | Bacteria | 2575 |
| 46 | Ga0070689_100014127 | 3300005340 | Bacteria | 5793 |
| 47 | Ga0070691_10000811 | 3300005341 | Bacteria | 12514 |
| 48 | Ga0070661_100004500 | 3300005344 | Bacteria | 9602 |
| 49 | Ga0070661_100047835 | 3300005344 | Bacteria | 3130 |
| 50 | Ga0070661_100061243 | 3300005344 | Bacteria | 2762 |
| 51 | Ga0070668_100000862 | 3300005347 | Bacteria | 21064 |
| 52 | Ga0070668_100022308 | 3300005347 | Bacteria | 4784 |
| 53 | Ga0070668_100026890 | 3300005347 | Bacteria | 4367 |
| 54 | Ga0070669_100004598 | 3300005353 | Bacteria | 9963 |
| 55 | Ga0070669_100049455 | 3300005353 | Bacteria | 3069 |
| 56 | Ga0070675_100017355 | 3300005354 | Bacteria | 5718 |
| 57 | Ga0070675_100023201 | 3300005354 | Bacteria | 4958 |
| 58 | Ga0070675_100026621 | 3300005354 | Bacteria | 4642 |
| 59 | Ga0070675_100071283 | 3300005354 | Bacteria | 2882 |
| 60 | Ga0070675_100081255 | 3300005354 | Bacteria | 2703 |
| 61 | Ga0070671_100064167 | 3300005355 | Bacteria | 3059 |
| 62 | Ga0070674_100005017 | 3300005356 | Bacteria | 7601 |
| 63 | Ga0070674_100041094 | 3300005356 | Bacteria | 3131 |
| 64 | Ga0070673_100000096 | 3300005364 | Bacteria | 39184 |
| 65 | Ga0070673_100006447 | 3300005364 | Bacteria | 7626 |
| 66 | Ga0070673_100024287 | 3300005364 | Bacteria | 4442 |
| 67 | Ga0070673_100030337 | 3300005364 | Bacteria | 4044 |
| 68 | Ga0070688_100009498 | 3300005365 | Bacteria | 5323 |
| 69 | Ga0070659_100002430 | 3300005366 | Bacteria | 13228 |
| 70 | Ga0070659_100017107 | 3300005366 | Bacteria | 5451 |
| 71 | Ga0070667_100002462 | 3300005367 | Bacteria | 16163 |
| 72 | Ga0070667_100010439 | 3300005367 | Bacteria | 7669 |
| 73 | Ga0070667_100018176 | 3300005367 | Bacteria | 5829 |
| 74 | Ga0070667_100032100 | 3300005367 | Bacteria | 4379 |
| 75 | Ga0070667_100033070 | 3300005367 | Bacteria | 4318 |
| 76 | Ga0070667_100039986 | 3300005367 | Bacteria | 3932 |
| 77 | Ga0070667_100073467 | 3300005367 | Bacteria | 2916 |
| 78 | Ga0070663_100099712 | 3300005455 | Bacteria | 2166 |
| 79 | Ga0070678_100000605 | 3300005456 | Bacteria | 17659 |
| 80 | Ga0070678_100014157 | 3300005456 | Bacteria | 5024 |
| 81 | Ga0070678_100091560 | 3300005456 | Bacteria | 2334 |
| 82 | Ga0070662_100002759 | 3300005457 | Bacteria | 10857 |
| 83 | Ga0070662_100002855 | 3300005457 | Bacteria | 10707 |
| 84 | Ga0070662_100004733 | 3300005457 | Bacteria | 8628 |
| 85 | Ga0070662_100096209 | 3300005457 | Bacteria | 2233 |
| 86 | Ga0070681_10003457 | 3300005458 | Bacteria | 14796 |
| 87 | Ga0068867_100002197 | 3300005459 | Bacteria | 13683 |
| 88 | Ga0068867_100005892 | 3300005459 | Bacteria | 8696 |
| 89 | Ga0068867_100115029 | 3300005459 | Bacteria | 2071 |
| 90 | Ga0070685_10020850 | 3300005466 | Bacteria | 3552 |
| 91 | Ga0070685_10051462 | 3300005466 | Bacteria | 2381 |
| 92 | Ga0070698_100011022 | 3300005471 | Bacteria | 9614 |
| 93 | Ga0070698_100040449 | 3300005471 | Bacteria | 4791 |
| 94 | Ga0070679_100006343 | 3300005530 | Bacteria | 11012 |
| 95 | Ga0070679_100036257 | 3300005530 | Bacteria | 4894 |
| 96 | Ga0070684_100001959 | 3300005535 | Bacteria | 15116 |
| 97 | Ga0070684_100026667 | 3300005535 | Bacteria | 4869 |
| 98 | Ga0068853_100000197 | 3300005539 | Bacteria | 42626 |
| 99 | Ga0068853_100000694 | 3300005539 | Bacteria | 23234 |
| 100 | Ga0068853_100007233 | 3300005539 | Bacteria | 8893 |
| 101 | Ga0068853_100009165 | 3300005539 | Bacteria | 7972 |
| 102 | Ga0068853_100036941 | 3300005539 | Bacteria | 4155 |
| 103 | Ga0070672_100000033 | 3300005543 | Bacteria | 61516 |
| 104 | Ga0070686_100018894 | 3300005544 | Unclassified | 4054 |
| 105 | Ga0070665_100000009 | 3300005548 | Bacteria | 562640 |
| 106 | Ga0070665_100001625 | 3300005548 | Bacteria | 25892 |
| 107 | Ga0070665_100002141 | 3300005548 | Bacteria | 22042 |
| 108 | Ga0070665_100125872 | 3300005548 | Bacteria | 2565 |
| 109 | Ga0068855_100000701 | 3300005563 | Bacteria | 40996 |
| 110 | Ga0068855_100002673 | 3300005563 | Bacteria | 21971 |
| 111 | Ga0068855_100004165 | 3300005563 | Bacteria | 17643 |
| 112 | Ga0068855_100081410 | 3300005563 | Bacteria | 3753 |
| 113 | Ga0070664_100001378 | 3300005564 | Bacteria | 19372 |
| 114 | Ga0070664_100002631 | 3300005564 | Bacteria | 14476 |
| 115 | Ga0070664_100089374 | 3300005564 | Bacteria | 2665 |
| 116 | Ga0070664_100097125 | 3300005564 | Bacteria | 2557 |
| 117 | Ga0070664_100112531 | 3300005564 | Bacteria | 2377 |
| 118 | Ga0068857_100000290 | 3300005577 | Bacteria | 34647 |
| 119 | Ga0068857_100000631 | 3300005577 | Bacteria | 25869 |
| 120 | Ga0068857_100016335 | 3300005577 | Bacteria | 6504 |
| 121 | Ga0068856_100014785 | 3300005614 | Bacteria | 7535 |
| 122 | Ga0068856_100026914 | 3300005614 | Bacteria | 5610 |
| 123 | Ga0068852_100017249 | 3300005616 | Bacteria | 5662 |
| 124 | Ga0068852_100038805 | 3300005616 | Bacteria | 4005 |
| 125 | Ga0068852_100047116 | 3300005616 | Bacteria | 3676 |
| 126 | Ga0068852_100089006 | 3300005616 | Bacteria | 2758 |
| 127 | Ga0068852_100098405 | 3300005616 | Bacteria | 2634 |
| 128 | Ga0068859_100005301 | 3300005617 | Bacteria | 13110 |
| 129 | Ga0068859_100011172 | 3300005617 | Bacteria | 9029 |
| 130 | Ga0068859_100013292 | 3300005617 | Bacteria | 8260 |
| 131 | Ga0068864_100002506 | 3300005618 | Bacteria | 15183 |
| 132 | Ga0068864_100003011 | 3300005618 | Bacteria | 13927 |
| 133 | Ga0068864_100068121 | 3300005618 | Bacteria | 3091 |
| 134 | Ga0068866_10002055 | 3300005718 | Bacteria | 8375 |
| 135 | Ga0068861_100003918 | 3300005719 | Bacteria | 9949 |
| 136 | Ga0068861_100035811 | 3300005719 | Bacteria | 3679 |
| 137 | Ga0068861_100056332 | 3300005719 | Bacteria | 3000 |
| 138 | Ga0068870_10012559 | 3300005840 | Bacteria | 3961 |
| 139 | Ga0068863_100012550 | 3300005841 | Bacteria | 8177 |
| 140 | Ga0068863_100015639 | 3300005841 | Bacteria | 7288 |
| 141 | Ga0068863_100074607 | 3300005841 | Bacteria | 3209 |
| 142 | Ga0068863_100079510 | 3300005841 | Bacteria | 3105 |
| 143 | Ga0068858_100002290 | 3300005842 | Bacteria | 19387 |
| 144 | Ga0068858_100008890 | 3300005842 | Bacteria | 9631 |
| 145 | Ga0068860_100000078 | 3300005843 | Bacteria | 171062 |
| 146 | Ga0068860_100002082 | 3300005843 | Bacteria | 21091 |
| 147 | Ga0068860_100003374 | 3300005843 | Bacteria | 16426 |
| 148 | Ga0068862_100010317 | 3300005844 | Bacteria | 7708 |
| 149 | Ga0081540_1017990 | 3300005983 | Bacteria | 4352 |
| 150 | Ga0081539_10000081 | 3300005985 | Bacteria | 222614 |
| 151 | Ga0097621_100000595 | 3300006237 | Bacteria | 25494 |
| 152 | Ga0097621_100002550 | 3300006237 | Bacteria | 12478 |
| 153 | Ga0097621_100004248 | 3300006237 | Bacteria | 9955 |
| 154 | Ga0068871_100000415 | 3300006358 | Bacteria | 29454 |
| 155 | Ga0068871_100020948 | 3300006358 | Bacteria | 5016 |
| 156 | Ga0068871_100118684 | 3300006358 | Bacteria | 2232 |
| 157 | Ga0075428_100010006 | 3300006844 | Bacteria | 10535 |
| 158 | Ga0075428_100035479 | 3300006844 | Bacteria | 5498 |
| 159 | Ga0075428_100133778 | 3300006844 | Bacteria | 2696 |
| 160 | Ga0075430_100008685 | 3300006846 | Bacteria | 8574 |
| 161 | Ga0075431_100002821 | 3300006847 | Bacteria | 16817 |
| 162 | Ga0068865_100000705 | 3300006881 | Bacteria | 18786 |
| 163 | Ga0068865_100003471 | 3300006881 | Bacteria | 9444 |
| 164 | Ga0097620_100005301 | 3300006931 | Bacteria | 13110 |
| 165 | Ga0097620_100011171 | 3300006931 | Bacteria | 9029 |
| 166 | Ga0097620_100013292 | 3300006931 | Bacteria | 8260 |
| 167 | Ga0105240_10000023 | 3300009093 | Bacteria | 385028 |
| 168 | Ga0105240_10000047 | 3300009093 | Bacteria | 239067 |
| 169 | Ga0105240_10000263 | 3300009093 | Bacteria | 103973 |
| 170 | Ga0105240_10000281 | 3300009093 | Bacteria | 100881 |
| 171 | Ga0105240_10001324 | 3300009093 | Bacteria | 42710 |
| 172 | Ga0105240_10010527 | 3300009093 | Bacteria | 12990 |
| 173 | Ga0111539_10024385 | 3300009094 | Bacteria | 7423 |
| 174 | Ga0111539_10026729 | 3300009094 | Bacteria | 7053 |
| 175 | Ga0105247_10007085 | 3300009101 | Bacteria | 6886 |
| 176 | Ga0105247_10007184 | 3300009101 | Bacteria | 6837 |
| 177 | Ga0114129_10012009 | 3300009147 | Bacteria | 12317 |
| 178 | Ga0114129_10022888 | 3300009147 | Bacteria | 8863 |
| 179 | Ga0105241_10000319 | 3300009174 | Bacteria | 36268 |
| 180 | Ga0105241_10006156 | 3300009174 | Bacteria | 8846 |
| 181 | Ga0105241_10008606 | 3300009174 | Bacteria | 7500 |
| 182 | Ga0105241_10026488 | 3300009174 | Bacteria | 4315 |
| 183 | Ga0105242_10018943 | 3300009176 | Bacteria | 5390 |
| 184 | Ga0105237_10000572 | 3300009545 | Bacteria | 51470 |
| 185 | Ga0105237_10001668 | 3300009545 | Bacteria | 28734 |
| 186 | Ga0105237_10011021 | 3300009545 | Bacteria | 9592 |
| 187 | Ga0105237_10015300 | 3300009545 | Bacteria | 7991 |
| 188 | Ga0105237_10051120 | 3300009545 | Bacteria | 4152 |
| 189 | Ga0105237_10114993 | 3300009545 | Bacteria | 2683 |
| 190 | Ga0105238_10000650 | 3300009551 | Bacteria | 36492 |
| 191 | Ga0105238_10069346 | 3300009551 | Bacteria | 3526 |
| 192 | Ga0105249_10004075 | 3300009553 | Bacteria | 12607 |
| 193 | Ga0105249_10008383 | 3300009553 | Bacteria | 9002 |
| 194 | Ga0105249_10016454 | 3300009553 | Bacteria | 6563 |
| 195 | Ga0105249_10017922 | 3300009553 | Bacteria | 6293 |
| 196 | Ga0105249_10020524 | 3300009553 | Bacteria | 5905 |
| 197 | Ga0105249_10027133 | 3300009553 | Bacteria | 5166 |
| 198 | Ga0105249_10029726 | 3300009553 | Bacteria | 4936 |
| 199 | Ga0105249_10139633 | 3300009553 | Bacteria | 2322 |
| 200 | Ga0105239_10000760 | 3300010375 | Bacteria | 45542 |
| 201 | Ga0105239_10000916 | 3300010375 | Bacteria | 41814 |
| 202 | Ga0105239_10001869 | 3300010375 | Bacteria | 27565 |
| 203 | Ga0105239_10003815 | 3300010375 | Bacteria | 18323 |
| 204 | Ga0105239_10038996 | 3300010375 | Bacteria | 5204 |
| 205 | Ga0157373_10007735 | 3300013100 | Bacteria | 7990 |
| 206 | Ga0157373_10010150 | 3300013100 | Bacteria | 6938 |
| 207 | Ga0157371_10009594 | 3300013102 | Bacteria | 7611 |
| 208 | Ga0157371_10020747 | 3300013102 | Bacteria | 4832 |
| 209 | Ga0157371_10022767 | 3300013102 | Bacteria | 4584 |
| 210 | Ga0157370_10000479 | 3300013104 | Bacteria | 49878 |
| 211 | Ga0157370_10002029 | 3300013104 | Bacteria | 24887 |
| 212 | Ga0157369_10031150 | 3300013105 | Bacteria | 5877 |
| 213 | Ga0157369_10108958 | 3300013105 | Bacteria | 2945 |
| 214 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 215 | Ga0157374_10029273 | 3300013296 | Bacteria | 4985 |
| 216 | Ga0157374_10068965 | 3300013296 | Bacteria | 3328 |
| 217 | Ga0157374_10111931 | 3300013296 | Bacteria | 2626 |
| 218 | Ga0157378_10002110 | 3300013297 | Bacteria | 17713 |
| 219 | Ga0157378_10009097 | 3300013297 | Bacteria | 8647 |
| 220 | Ga0157378_10048492 | 3300013297 | Bacteria | 3777 |
| 221 | Ga0157378_10052632 | 3300013297 | Bacteria | 3622 |
| 222 | Ga0157378_10113820 | 3300013297 | Bacteria | 2484 |
| 223 | Ga0163162_10000190 | 3300013306 | Bacteria | 56892 |
| 224 | Ga0163162_10000371 | 3300013306 | Bacteria | 40778 |
| 225 | Ga0163162_10001924 | 3300013306 | Bacteria | 19554 |
| 226 | Ga0163162_10004419 | 3300013306 | Bacteria | 13535 |
| 227 | Ga0163162_10008781 | 3300013306 | Bacteria | 9822 |
| 228 | Ga0163162_10010540 | 3300013306 | Bacteria | 8988 |
| 229 | Ga0163162_10012796 | 3300013306 | Bacteria | 8198 |
| 230 | Ga0157372_10000716 | 3300013307 | Bacteria | 36410 |
| 231 | Ga0157372_10013317 | 3300013307 | Bacteria | 8778 |
| 232 | Ga0157372_10015440 | 3300013307 | Bacteria | 8185 |
| 233 | Ga0157372_10017331 | 3300013307 | Bacteria | 7732 |
| 234 | Ga0157372_10036689 | 3300013307 | Bacteria | 5403 |
| 235 | Ga0157372_10080698 | 3300013307 | Bacteria | 3681 |
| 236 | Ga0157375_10000935 | 3300013308 | Bacteria | 25338 |
| 237 | Ga0157375_10012957 | 3300013308 | Bacteria | 7408 |
| 238 | Ga0157375_10031490 | 3300013308 | Bacteria | 5015 |
| 239 | Ga0157375_10059327 | 3300013308 | Bacteria | 3790 |
| 240 | Ga0157375_10119116 | 3300013308 | Bacteria | 2747 |
| 241 | Ga0163163_10000457 | 3300014325 | Bacteria | 37238 |
| 242 | Ga0163163_10000616 | 3300014325 | Bacteria | 30789 |
| 243 | Ga0163163_10017383 | 3300014325 | Bacteria | 6706 |
| 244 | Ga0163163_10038656 | 3300014325 | Bacteria | 4652 |
| 245 | Ga0163163_10044208 | 3300014325 | Bacteria | 4369 |
| 246 | Ga0163163_10113180 | 3300014325 | Bacteria | 2743 |
| 247 | Ga0157380_10001574 | 3300014326 | Bacteria | 15001 |
| 248 | Ga0157380_10003644 | 3300014326 | Bacteria | 10593 |
| 249 | Ga0157380_10020217 | 3300014326 | Bacteria | 4976 |
| 250 | Ga0157380_10065795 | 3300014326 | Bacteria | 2914 |
| 251 | Ga0157377_10006393 | 3300014745 | Bacteria | 5616 |
| 252 | Ga0157379_10000229 | 3300014968 | Bacteria | 43909 |
| 253 | Ga0157379_10007387 | 3300014968 | Bacteria | 9517 |
| 254 | Ga0157379_10080248 | 3300014968 | Bacteria | 2923 |
| 255 | Ga0157379_10100797 | 3300014968 | Bacteria | 2592 |
| 256 | Ga0157379_10111146 | 3300014968 | Bacteria | 2461 |
| 257 | Ga0157376_10000117 | 3300014969 | Bacteria | 56126 |
| 258 | Ga0157376_10000453 | 3300014969 | Bacteria | 26477 |
| 259 | Ga0157376_10000853 | 3300014969 | Bacteria | 20013 |
| 260 | Ga0157376_10006481 | 3300014969 | Bacteria | 8272 |
| 261 | Ga0157376_10021632 | 3300014969 | Bacteria | 4998 |
| 262 | Ga0157376_10055580 | 3300014969 | Bacteria | 3304 |
| 263 | Ga0157376_10080117 | 3300014969 | Bacteria | 2800 |
| 264 | Ga0182005_1000159 | 3300015265 | Bacteria | 47132 |
| 265 | Ga0163161_10004059 | 3300017792 | Bacteria | 10234 |
| 266 | Ga0163161_10020358 | 3300017792 | Bacteria | 4656 |
| 267 | Ga0163161_10035452 | 3300017792 | Bacteria | 3571 |
| 268 | Ga0163161_10110757 | 3300017792 | Bacteria | 2052 |
| 269 | Ga0213876_10002778 | 3300021384 | Bacteria | 10197 |
| 270 | Ga0213876_10055314 | 3300021384 | Bacteria | 2095 |
| 271 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 272 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 273 | Ga0209026_1000132 | 3300025250 | Bacteria | 119048 |
| 274 | Ga0209148_1000186 | 3300025254 | Bacteria | 117677 |
| 275 | Ga0209673_1000183 | 3300025273 | Bacteria | 126175 |
| 276 | Ga0209758_1000912 | 3300025297 | Bacteria | 40017 |
| 277 | Ga0209758_1001642 | 3300025297 | Bacteria | 25398 |
| 278 | Ga0209758_1031605 | 3300025297 | Bacteria | 2168 |
| 279 | Ga0209050_1000305 | 3300025298 | Bacteria | 100790 |
| 280 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 281 | Ga0207426_1000104 | 3300025302 | Bacteria | 249464 |
| 282 | Ga0207426_1001887 | 3300025302 | Bacteria | 15299 |
| 283 | Ga0207426_1010215 | 3300025302 | Bacteria | 3657 |
| 284 | Ga0209051_1011271 | 3300025303 | Bacteria | 4429 |
| 285 | Ga0209257_1000233 | 3300025304 | Bacteria | 129948 |
| 286 | Ga0209257_1000783 | 3300025304 | Bacteria | 46807 |
| 287 | Ga0207642_10008859 | 3300025899 | Bacteria | 3476 |
| 288 | Ga0207710_10003723 | 3300025900 | Bacteria | 6752 |
| 289 | Ga0207688_10031071 | 3300025901 | Bacteria | 2947 |
| 290 | Ga0207680_10000140 | 3300025903 | Bacteria | 34445 |
| 291 | Ga0207680_10010797 | 3300025903 | Bacteria | 4584 |
| 292 | Ga0207680_10014129 | 3300025903 | Bacteria | 4121 |
| 293 | Ga0207680_10019116 | 3300025903 | Bacteria | 3659 |
| 294 | Ga0207647_10000110 | 3300025904 | Bacteria | 62980 |
| 295 | Ga0207645_10000571 | 3300025907 | Bacteria | 30525 |
| 296 | Ga0207645_10002569 | 3300025907 | Bacteria | 14159 |
| 297 | Ga0207645_10005503 | 3300025907 | Bacteria | 9174 |
| 298 | Ga0207645_10078447 | 3300025907 | Bacteria | 2116 |
| 299 | Ga0207643_10009332 | 3300025908 | Bacteria | 5273 |
| 300 | Ga0207705_10013822 | 3300025909 | Bacteria | 5822 |
| 301 | Ga0207654_10038450 | 3300025911 | Bacteria | 2685 |
| 302 | Ga0207707_10002013 | 3300025912 | Bacteria | 18448 |
| 303 | Ga0207695_10000010 | 3300025913 | Bacteria | 981919 |
| 304 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 305 | Ga0207695_10000128 | 3300025913 | Bacteria | 226098 |
| 306 | Ga0207695_10000296 | 3300025913 | Bacteria | 123322 |
| 307 | Ga0207695_10000720 | 3300025913 | Bacteria | 64304 |
| 308 | Ga0207695_10080906 | 3300025913 | Bacteria | 3289 |
| 309 | Ga0207671_10000025 | 3300025914 | Bacteria | 271617 |
| 310 | Ga0207671_10004310 | 3300025914 | Bacteria | 13677 |
| 311 | Ga0207671_10004643 | 3300025914 | Bacteria | 13008 |
| 312 | Ga0207671_10014791 | 3300025914 | Bacteria | 6147 |
| 313 | Ga0207671_10015822 | 3300025914 | Bacteria | 5886 |
| 314 | Ga0207671_10018663 | 3300025914 | Bacteria | 5314 |
| 315 | Ga0207671_10065972 | 3300025914 | Bacteria | 2693 |
| 316 | Ga0207660_10002865 | 3300025917 | Bacteria | 11277 |
| 317 | Ga0207662_10040084 | 3300025918 | Bacteria | 2751 |
| 318 | Ga0207662_10052964 | 3300025918 | Bacteria | 2416 |
| 319 | Ga0207657_10017396 | 3300025919 | Bacteria | 6894 |
| 320 | Ga0207649_10001702 | 3300025920 | Bacteria | 12677 |
| 321 | Ga0207649_10014475 | 3300025920 | Bacteria | 4419 |
| 322 | Ga0207652_10001732 | 3300025921 | Bacteria | 19037 |
| 323 | Ga0207681_10005990 | 3300025923 | Bacteria | 7457 |
| 324 | Ga0207681_10094328 | 3300025923 | Bacteria | 2144 |
| 325 | Ga0207694_10068347 | 3300025924 | Bacteria | 2774 |
| 326 | Ga0207650_10024766 | 3300025925 | Bacteria | 4271 |
| 327 | Ga0207659_10041999 | 3300025926 | Bacteria | 3204 |
| 328 | Ga0207690_10018285 | 3300025932 | Bacteria | 4297 |
| 329 | Ga0207706_10003814 | 3300025933 | Bacteria | 14367 |
| 330 | Ga0207706_10011370 | 3300025933 | Bacteria | 8112 |
| 331 | Ga0207706_10012699 | 3300025933 | Bacteria | 7668 |
| 332 | Ga0207706_10025104 | 3300025933 | Bacteria | 5343 |
| 333 | Ga0207706_10073896 | 3300025933 | Bacteria | 2998 |
| 334 | Ga0207670_10009170 | 3300025936 | Bacteria | 5629 |
| 335 | Ga0207670_10009434 | 3300025936 | Bacteria | 5571 |
| 336 | Ga0207669_10011274 | 3300025937 | Unclassified | 4343 |
| 337 | Ga0207704_10001086 | 3300025938 | Bacteria | 12068 |
| 338 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 339 | Ga0207691_10018871 | 3300025940 | Bacteria | 6532 |
| 340 | Ga0207691_10027609 | 3300025940 | Bacteria | 5321 |
| 341 | Ga0207691_10050436 | 3300025940 | Bacteria | 3810 |
| 342 | Ga0207691_10062223 | 3300025940 | Bacteria | 3388 |
| 343 | Ga0207691_10068212 | 3300025940 | Bacteria | 3214 |
| 344 | Ga0207689_10000939 | 3300025942 | Bacteria | 28012 |
| 345 | Ga0207689_10003471 | 3300025942 | Bacteria | 14403 |
| 346 | Ga0207689_10005568 | 3300025942 | Bacteria | 11246 |
| 347 | Ga0207689_10015335 | 3300025942 | Bacteria | 6486 |
| 348 | Ga0207689_10017542 | 3300025942 | Bacteria | 6052 |
| 349 | Ga0207689_10020199 | 3300025942 | Bacteria | 5610 |
| 350 | Ga0207661_10005038 | 3300025944 | Bacteria | 9268 |
| 351 | Ga0207679_10000822 | 3300025945 | Bacteria | 19983 |
| 352 | Ga0207679_10004389 | 3300025945 | Bacteria | 8782 |
| 353 | Ga0207679_10055578 | 3300025945 | Bacteria | 2919 |
| 354 | Ga0207679_10096528 | 3300025945 | Bacteria | 2300 |
| 355 | Ga0207667_10000143 | 3300025949 | Bacteria | 108717 |
| 356 | Ga0207667_10000583 | 3300025949 | Bacteria | 47418 |
| 357 | Ga0207667_10014323 | 3300025949 | Bacteria | 9044 |
| 358 | Ga0207651_10002700 | 3300025960 | Bacteria | 8502 |
| 359 | Ga0207651_10010190 | 3300025960 | Bacteria | 5195 |
| 360 | Ga0207712_10008393 | 3300025961 | Bacteria | 6525 |
| 361 | Ga0207712_10011203 | 3300025961 | Bacteria | 5709 |
| 362 | Ga0207712_10015057 | 3300025961 | Bacteria | 4983 |
| 363 | Ga0207712_10023879 | 3300025961 | Bacteria | 4041 |
| 364 | Ga0207640_10047834 | 3300025981 | Bacteria | 2761 |
| 365 | Ga0207658_10002549 | 3300025986 | Bacteria | 13238 |
| 366 | Ga0207658_10028271 | 3300025986 | Bacteria | 3947 |
| 367 | Ga0207677_10002241 | 3300026023 | Bacteria | 10147 |
| 368 | Ga0207677_10074542 | 3300026023 | Unclassified | 2408 |
| 369 | Ga0207703_10038318 | 3300026035 | Bacteria | 3824 |
| 370 | Ga0207639_10000910 | 3300026041 | Bacteria | 20014 |
| 371 | Ga0207639_10008593 | 3300026041 | Bacteria | 7007 |
| 372 | Ga0207639_10012793 | 3300026041 | Bacteria | 5855 |
| 373 | Ga0207678_10015295 | 3300026067 | Bacteria | 6749 |
| 374 | Ga0207702_10042757 | 3300026078 | Bacteria | 3802 |
| 375 | Ga0207702_10098062 | 3300026078 | Bacteria | 2581 |
| 376 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 377 | Ga0207641_10001344 | 3300026088 | Bacteria | 24357 |
| 378 | Ga0207648_10001686 | 3300026089 | Bacteria | 24217 |
| 379 | Ga0207648_10002203 | 3300026089 | Bacteria | 21158 |
| 380 | Ga0207648_10017812 | 3300026089 | Bacteria | 6447 |
| 381 | Ga0207648_10141902 | 3300026089 | Bacteria | 2117 |
| 382 | Ga0207676_10021406 | 3300026095 | Bacteria | 4743 |
| 383 | Ga0207676_10029711 | 3300026095 | Bacteria | 4095 |
| 384 | Ga0207676_10038010 | 3300026095 | Bacteria | 3672 |
| 385 | Ga0207674_10000822 | 3300026116 | Bacteria | 40380 |
| 386 | Ga0207674_10004512 | 3300026116 | Bacteria | 16733 |
| 387 | Ga0207674_10041339 | 3300026116 | Bacteria | 4768 |
| 388 | Ga0207674_10042396 | 3300026116 | Bacteria | 4700 |
| 389 | Ga0207674_10043884 | 3300026116 | Bacteria | 4608 |
| 390 | Ga0207675_100001768 | 3300026118 | Bacteria | 21608 |
| 391 | Ga0207675_100014948 | 3300026118 | Bacteria | 7245 |
| 392 | Ga0207675_100025499 | 3300026118 | Bacteria | 5503 |
| 393 | Ga0207675_100042874 | 3300026118 | Bacteria | 4225 |
| 394 | Ga0207683_10000535 | 3300026121 | Bacteria | 35178 |
| 395 | Ga0207683_10010341 | 3300026121 | Bacteria | 7957 |
| 396 | Ga0207683_10040459 | 3300026121 | Bacteria | 4068 |
| 397 | Ga0207683_10075038 | 3300026121 | Bacteria | 2993 |
| 398 | Ga0207698_10001194 | 3300026142 | Bacteria | 15131 |
| 399 | Ga0207698_10015113 | 3300026142 | Bacteria | 5160 |
| 400 | Ga0207698_10026415 | 3300026142 | Bacteria | 4107 |
| 401 | Ga0207698_10046742 | 3300026142 | Bacteria | 3272 |
| 402 | Ga0209968_1003644 | 3300027526 | Bacteria | 2310 |
| 403 | Ga0207428_10048745 | 3300027907 | Bacteria | 3396 |
| 404 | Ga0268266_10000014 | 3300028379 | Bacteria | 644033 |
| 405 | Ga0268266_10001932 | 3300028379 | Bacteria | 23313 |
| 406 | Ga0268264_10000105 | 3300028381 | Bacteria | 212531 |
| 407 | Ga0268264_10000810 | 3300028381 | Bacteria | 33689 |
| 408 | Ga0268264_10003349 | 3300028381 | Bacteria | 13851 |
| 409 | Ga0307517_10002677 | 3300028786 | Bacteria | 28446 |
| 410 | Ga0307515_10000412 | 3300028794 | Bacteria | 103361 |
| 411 | Ga0265338_10020119 | 3300028800 | Bacteria | 7038 |
| 412 | Ga0307511_10001181 | 3300030521 | Bacteria | 27727 |
| 413 | Ga0265327_10000010 | 3300031251 | Bacteria | 566817 |
| 414 | Ga0265327_10000208 | 3300031251 | Bacteria | 123034 |
| 415 | Ga0265327_10000256 | 3300031251 | Bacteria | 105748 |
| 416 | Ga0307513_10111077 | 3300031456 | Bacteria | 2734 |
| 417 | Ga0307509_10090649 | 3300031507 | Bacteria | 3132 |
| 418 | Ga0307508_10000407 | 3300031616 | Bacteria | 51637 |
| 419 | Ga0265314_10040909 | 3300031711 | Bacteria | 3323 |
| 420 | Ga0307516_10003451 | 3300031730 | Bacteria | 20267 |
| 421 | Ga0307416_100039887 | 3300032002 | Bacteria | 3641 |
| 422 | Ga0307510_10004615 | 3300033180 | Bacteria | 16242 |
| 423 | Ga0373937_0002054 | 3300036401 | Bacteria | 16833 |
| 424 | Ga0373937_0091036 | 3300036401 | Bacteria | 2826 |
| 425 | Ga0395899_0000088 | 3300037312 | Bacteria | 156987 |
| 426 | Ga0395899_0042234 | 3300037312 | Bacteria | 3405 |
| 427 | Ga0395900_0104647 | 3300037418 | Bacteria | 2908 |
| 428 | Ga0395905_0006828 | 3300037471 | Bacteria | 11423 |
| 429 | Ga0395901_0000474 | 3300038443 | Bacteria | 46605 |
| 430 | Ga0436365_1926928 | 3300039437 | Bacteria | 15797 |
| 431 | Ga0439431_0002077 | 3300041997 | Bacteria | 4425 |
| 432 | Ga0451577_0004985 | 3300042876 | Bacteria | 13768 |
| 433 | Ga0466969_0000109 | 3300044656 | Bacteria | 43750 |
| 434 | Ga0466972_0000019 | 3300044658 | Bacteria | 198523 |
| 435 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 436 | Ga0466972_0000418 | 3300044658 | Bacteria | 22205 |
| 437 | Ga0466972_0010056 | 3300044658 | Bacteria | 4752 |
| 438 | Ga0453684_0004866 | 3300044712 | Bacteria | 27530 |
| 439 | Ga0453684_0063704 | 3300044712 | Bacteria | 4714 |
| 440 | Ga0466970_0009450 | 3300044765 | Bacteria | 4929 |
| 441 | Ga0466970_0029586 | 3300044765 | Bacteria | 2885 |
| 442 | Ga0466957_0001179 | 3300044842 | Bacteria | 13578 |
| 443 | Ga0466957_0002435 | 3300044842 | Bacteria | 9996 |
| 444 | Ga0466959_0000380 | 3300045049 | Bacteria | 26260 |
| 445 | Ga0466959_0001404 | 3300045049 | Bacteria | 14712 |
| 446 | Ga0466959_0053171 | 3300045049 | Bacteria | 2962 |
| 447 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 448 | Ga0495627_000792 | 3300046453 | Bacteria | 23123 |
| 449 | Ga0495627_005492 | 3300046453 | Bacteria | 5103 |
| 450 | Ga0495607_0031001 | 3300046501 | Bacteria | 3276 |
| 451 | Ga0495606_0013306 | 3300046507 | Bacteria | 6515 |
| 452 | Ga0495616_0029010 | 3300046513 | Bacteria | 2925 |
| 453 | Ga0495618_0053494 | 3300046514 | Unclassified | 2553 |
| 454 | Ga0495628_0060869 | 3300046516 | Bacteria | 2962 |
| 455 | Ga0495643_0001491 | 3300046522 | Bacteria | 21273 |
| 456 | Ga0495648_0007062 | 3300046524 | Bacteria | 9049 |
| 457 | Ga0495587_0009393 | 3300046536 | Bacteria | 6269 |
| 458 | Ga0495633_0002201 | 3300046558 | Bacteria | 13949 |
| 459 | Ga0495668_0000187 | 3300046616 | Bacteria | 92571 |
| 460 | Ga0495634_0018183 | 3300046642 | Bacteria | 5007 |
| 461 | Ga0495611_0000139 | 3300046648 | Bacteria | 51212 |
| 462 | Ga0495625_0009326 | 3300046660 | Bacteria | 8224 |
| 463 | Ga0495604_0102753 | 3300047317 | Unclassified | 2098 |
| 464 | Ga0495636_0000007 | 3300047318 | Bacteria | 103085 |
| 465 | Ga0495672_0007236 | 3300047320 | Bacteria | 8375 |
| 466 | Ga0495687_000056 | 3300047443 | Bacteria | 188227 |
| 467 | Ga0495686_0000016 | 3300047472 | Bacteria | 443701 |
| 468 | Ga0495686_0000417 | 3300047472 | Bacteria | 67451 |
| 469 | Ga0495686_0033821 | 3300047472 | Bacteria | 3297 |
| 470 | Ga0496114_0007496 | 3300048917 | Bacteria | 8627 |
| 471 | Ga0496115_0047518 | 3300048918 | Bacteria | 3432 |
| 472 | Ga0496121_0000395 | 3300048924 | Bacteria | 88604 |
| 473 | Ga0496124_0098281 | 3300048927 | Bacteria | 2376 |
| 474 | Ga0501031_0031924 | 3300049568 | Bacteria | 3434 |
| 475 | Ga0501032_0000947 | 3300049569 | Bacteria | 23434 |
| 476 | Ga0501034_0009088 | 3300049571 | Bacteria | 10437 |
| 477 | Ga0501034_0018707 | 3300049571 | Bacteria | 7100 |
| 478 | Ga0501037_0027897 | 3300049573 | Bacteria | 4172 |
| 479 | Ga0501038_0012660 | 3300049574 | Bacteria | 7710 |
| 480 | Ga0501039_0031678 | 3300049575 | Bacteria | 4077 |
| 481 | Ga0501043_0005144 | 3300049579 | Bacteria | 10586 |
| 482 | Ga0501043_0020162 | 3300049579 | Bacteria | 5234 |
| 483 | Ga0501046_0009125 | 3300049580 | Bacteria | 8589 |
| 484 | Ga0501046_0103294 | 3300049580 | Bacteria | 2185 |
| 485 | Ga0501047_0006062 | 3300049581 | Bacteria | 11365 |
| 486 | Ga0501047_0013013 | 3300049581 | Bacteria | 7879 |
| 487 | Ga0501047_0013573 | 3300049581 | Bacteria | 7725 |
| 488 | Ga0501048_0003407 | 3300049582 | Bacteria | 12081 |
| 489 | Ga0501070_0010690 | 3300049586 | Bacteria | 7761 |
| 490 | Ga0501071_0040447 | 3300049587 | Bacteria | 3336 |
| 491 | Ga0501072_0045823 | 3300049588 | Bacteria | 3440 |
| 492 | Ga0501074_0000918 | 3300049590 | Bacteria | 18884 |
| 493 | Ga0501243_000059 | 3300049675 | Bacteria | 10799 |
| 494 | Ga0501245_000186 | 3300049708 | Bacteria | 6893 |
| 495 | Ga0501080_0128452 | 3300049742 | Bacteria | 2347 |
| 496 | Ga0501083_0037839 | 3300049744 | Bacteria | 3283 |
| 497 | Ga0501035_0013148 | 3300049822 | Bacteria | 7640 |
| 498 | Ga0501035_0014750 | 3300049822 | Bacteria | 7215 |
| 499 | Ga0501035_0059110 | 3300049822 | Bacteria | 3414 |
| 500 | Ga0501044_0003613 | 3300049823 | Bacteria | 17398 |
| 501 | Ga0501044_0007122 | 3300049823 | Bacteria | 12299 |
| 502 | Ga0501044_0022971 | 3300049823 | Bacteria | 6639 |
| 503 | Ga0501044_0058182 | 3300049823 | Bacteria | 3965 |
| 504 | Ga0501044_0102894 | 3300049823 | Bacteria | 2871 |
| 505 | Ga0501044_0106572 | 3300049823 | Bacteria | 2815 |
| 506 | Ga0501284_00074 | 3300050005 | Bacteria | 28202 |
| 507 | nmdc:mga05p37_8806_c1 | 3300050507 | Bacteria | 11925 |
| 508 | nmdc:mga09592_2377_c1 | 3300050508 | Bacteria | 15185 |
| 509 | nmdc:mga09592_35915_c1 | 3300050508 | Bacteria | 4150 |
| 510 | nmdc:mga09592_91006_c1 | 3300050508 | Bacteria | 2607 |
| 511 | nmdc:mga06r32_39647_c1 | 3300050510 | Bacteria | 4470 |
| 512 | nmdc:mga08y16_24106_c1 | 3300050511 | Bacteria | 6425 |
| 513 | nmdc:mga08y16_88127_c1 | 3300050511 | Bacteria | 3234 |
| 514 | Ga0500578_0000009 | 3300053086 | Bacteria | 219807 |
| 515 | Ga0500578_0022332 | 3300053086 | Bacteria | 4063 |
| 516 | Ga0500644_0000077 | 3300053088 | Bacteria | 59580 |
| 517 | Ga0500644_0011379 | 3300053088 | Bacteria | 2431 |
| 518 | Ga0500646_0000334 | 3300053090 | Bacteria | 14167 |
| 519 | Ga0500646_0000987 | 3300053090 | Bacteria | 7766 |
| 520 | Ga0500583_0000036 | 3300053092 | Bacteria | 95404 |
| 521 | Ga0500651_0055286 | 3300053093 | Bacteria | 2487 |
| 522 | Ga0500562_000083 | 3300053108 | Bacteria | 41350 |
| 523 | Ga0500569_000122 | 3300053109 | Bacteria | 12100 |
| 524 | Ga0500652_004801 | 3300053131 | Bacteria | 4213 |
| 525 | Ga0500652_007363 | 3300053131 | Bacteria | 3599 |
| 526 | Ga0500559_0019353 | 3300053136 | Bacteria | 2878 |
| 527 | Ga0500568_0000606 | 3300053139 | Bacteria | 25992 |
| 528 | Ga0500577_0000218 | 3300053142 | Bacteria | 15217 |
| 529 | Ga0500604_0005485 | 3300053151 | Bacteria | 3349 |
| 530 | Ga0500616_0007120 | 3300053153 | Bacteria | 7164 |
| 531 | Ga0500622_0000371 | 3300053156 | Bacteria | 43288 |
| 532 | Ga0500622_0001321 | 3300053156 | Bacteria | 20162 |
| 533 | Ga0500622_0004179 | 3300053156 | Bacteria | 9224 |
| 534 | Ga0500636_0016920 | 3300053177 | Bacteria | 4300 |
| 535 | Ga0500611_000076 | 3300053727 | Bacteria | 38269 |
| 536 | Ga0501084_0024217 | 3300054114 | Bacteria | 5063 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0040447 | Ga0501071_0040447_1460_3241 | 519 |
| 2 | 3300047472 | Ga0495686_0033821 | Ga0495686_0033821_564_2408 | 520 |
| 3 | 3300049744 | Ga0501083_0037839 | Ga0501083_0037839_1228_3009 | 523 |
| 4 | 3300046522 | Ga0495643_0001491 | Ga0495643_0001491_9311_11176 | 531 |
| 5 | 3300005471 | Ga0070698_100040449 | Ga0070698_1000404493 | 536 |
| 6 | 3300026118 | Ga0207675_100014948 | Ga0207675_1000149482 | 537 |
| 7 | 3300014968 | Ga0157379_10080248 | Ga0157379_100802483 | 542 |
| 8 | 3300049822 | Ga0501035_0014750 | Ga0501035_0014750_1674_3668 | 545 |
| 9 | 3300046513 | Ga0495616_0029010 | Ga0495616_0029010_727_2592 | 547 |
| 10 | 3300046660 | Ga0495625_0009326 | Ga0495625_0009326_687_2552 | 547 |
| 11 | 3300053090 | Ga0500646_0000987 | Ga0500646_0000987_3665_5530 | 547 |
| 12 | 3300046453 | Ga0495627_005492 | Ga0495627_005492_2315_4177 | 549 |
| 13 | 3300038443 | Ga0395901_0000474 | Ga0395901_0000474_36321_38216 | 555 |
| 14 | 3300046616 | Ga0495668_0000187 | Ga0495668_0000187_71705_73609 | 555 |
| 15 | 3300017792 | Ga0163161_10020358 | Ga0163161_100203583 | 561 |
| 16 | 3300046501 | Ga0495607_0031001 | Ga0495607_0031001_1009_2877 | 561 |
| 17 | 3300005329 | Ga0070683_100155994 | Ga0070683_1001559941 | 562 |
| 18 | 3300005356 | Ga0070674_100041094 | Ga0070674_1000410942 | 562 |
| 19 | 3300014326 | Ga0157380_10003644 | Ga0157380_100036448 | 565 |
| 20 | 3300045049 | Ga0466959_0053171 | Ga0466959_0053171_355_2220 | 565 |
| 21 | 3300006844 | Ga0075428_100133778 | Ga0075428_1001337781 | 566 |
| 22 | 3300027526 | Ga0209968_1003644 | Ga0209968_10036442 | 567 |
| 23 | 3300021384 | Ga0213876_10055314 | Ga0213876_100553141 | 568 |
| 24 | 3300003354 | JGI25160J50197_1001292 | JGI25160J50197_10012922 | 569 |
| 25 | 3300003790 | Ga0055528_1000108 | Ga0055528_100010810 | 569 |
| 26 | 3300003791 | Ga0055530_10000279 | Ga0055530_100002793 | 569 |
| 27 | 3300005262 | Ga0065165_1000019 | Ga0065165_100001957 | 569 |
| 28 | 3300025273 | Ga0209673_1000183 | Ga0209673_100018331 | 569 |
| 29 | 3300025298 | Ga0209050_1000305 | Ga0209050_100030558 | 569 |
| 30 | 3300025302 | Ga0207426_1010215 | Ga0207426_10102152 | 569 |
| 31 | 3300025303 | Ga0209051_1011271 | Ga0209051_10112714 | 569 |
| 32 | 3300025304 | Ga0209257_1000783 | Ga0209257_100078317 | 569 |
| 33 | 3300014969 | Ga0157376_10080117 | Ga0157376_100801172 | 570 |
| 34 | 3300048927 | Ga0496124_0098281 | Ga0496124_0098281_348_2246 | 570 |
| 35 | 3300005719 | Ga0068861_100056332 | Ga0068861_1000563321 | 572 |
| 36 | 3300031251 | Ga0265327_10000208 | Ga0265327_1000020826 | 572 |
| 37 | 3300050508 | nmdc:mga09592_2377_c1 | nmdc:mga09592_2377_c1_7876_9774 | 572 |
| 38 | 3300005455 | Ga0070663_100099712 | Ga0070663_1000997121 | 573 |
| 39 | 3300006844 | Ga0075428_100035479 | Ga0075428_1000354792 | 573 |
| 40 | 3300026118 | Ga0207675_100042874 | Ga0207675_1000428743 | 573 |
| 41 | 3300042876 | Ga0451577_0004985 | Ga0451577_0004985_829_2709 | 573 |
| 42 | 3300049823 | Ga0501044_0058182 | Ga0501044_0058182_2019_3899 | 573 |
| 43 | 3300013307 | Ga0157372_10015440 | Ga0157372_100154405 | 574 |
| 44 | 3300053727 | Ga0500611_000076 | Ga0500611_000076_18582_20477 | 574 |
| 45 | 3300003215 | JGI25153J46596_10002851 | JGI25153J46596_100028513 | 575 |
| 46 | 3300005530 | Ga0070679_100036257 | Ga0070679_1000362571 | 575 |
| 47 | 3300014326 | Ga0157380_10065795 | Ga0157380_100657952 | 575 |
| 48 | 3300025297 | Ga0209758_1000912 | Ga0209758_10009124 | 575 |
| 49 | 3300037312 | Ga0395899_0042234 | Ga0395899_0042234_488_2395 | 575 |
| 50 | 3300049581 | Ga0501047_0006062 | Ga0501047_0006062_8233_10122 | 575 |
| 51 | 3300009094 | Ga0111539_10024385 | Ga0111539_100243853 | 576 |
| 52 | 3300014325 | Ga0163163_10113180 | Ga0163163_101131802 | 576 |
| 53 | 3300005356 | Ga0070674_100005017 | Ga0070674_1000050173 | 578 |
| 54 | 3300017792 | Ga0163161_10110757 | Ga0163161_101107571 | 578 |
| 55 | 3300025937 | Ga0207669_10011274 | Ga0207669_100112745 | 578 |
| 56 | 3300005334 | Ga0068869_100013596 | Ga0068869_1000135962 | 579 |
| 57 | 3300025942 | Ga0207689_10005568 | Ga0207689_100055683 | 579 |
| 58 | 3300005339 | Ga0070660_100079346 | Ga0070660_1000793462 | 580 |
| 59 | 3300005365 | Ga0070688_100009498 | Ga0070688_1000094983 | 580 |
| 60 | 3300005366 | Ga0070659_100002430 | Ga0070659_1000024301 | 580 |
| 61 | 3300005548 | Ga0070665_100125872 | Ga0070665_1001258721 | 580 |
| 62 | 3300005618 | Ga0068864_100003011 | Ga0068864_1000030111 | 580 |
| 63 | 3300013308 | Ga0157375_10059327 | Ga0157375_100593273 | 580 |
| 64 | 3300025904 | Ga0207647_10000110 | Ga0207647_1000011019 | 580 |
| 65 | 3300025932 | Ga0207690_10018285 | Ga0207690_100182851 | 580 |
| 66 | 3300025936 | Ga0207670_10009170 | Ga0207670_100091701 | 580 |
| 67 | 3300025940 | Ga0207691_10050436 | Ga0207691_100504362 | 580 |
| 68 | 3300026067 | Ga0207678_10015295 | Ga0207678_100152952 | 580 |
| 69 | 3300026095 | Ga0207676_10038010 | Ga0207676_100380105 | 580 |
| 70 | 3300044658 | Ga0466972_0000038 | Ga0466972_0000038_67566_69449 | 580 |
| 71 | 3300044765 | Ga0466970_0029586 | Ga0466970_0029586_510_2384 | 580 |
| 72 | 3300045049 | Ga0466959_0001404 | Ga0466959_0001404_12601_14475 | 580 |
| 73 | 3300049569 | Ga0501032_0000947 | Ga0501032_0000947_17136_19034 | 580 |
| 74 | 3300049571 | Ga0501034_0018707 | Ga0501034_0018707_598_2469 | 580 |
| 75 | 3300049581 | Ga0501047_0013013 | Ga0501047_0013013_4469_6355 | 580 |
| 76 | 3300049586 | Ga0501070_0010690 | Ga0501070_0010690_4952_6850 | 580 |
| 77 | 3300053153 | Ga0500616_0007120 | Ga0500616_0007120_4335_6329 | 580 |
| 78 | 3300025297 | Ga0209758_1031605 | Ga0209758_10316051 | 581 |
| 79 | 3300050511 | nmdc:mga08y16_88127_c1 | nmdc:mga08y16_88127_c1_852_2750 | 581 |
| 80 | 3300005616 | Ga0068852_100089006 | Ga0068852_1000890061 | 582 |
| 81 | 3300009093 | Ga0105240_10000281 | Ga0105240_1000028148 | 582 |
| 82 | 3300009545 | Ga0105237_10015300 | Ga0105237_100153004 | 582 |
| 83 | 3300013100 | Ga0157373_10010150 | Ga0157373_100101502 | 582 |
| 84 | 3300013307 | Ga0157372_10036689 | Ga0157372_100366893 | 582 |
| 85 | 3300025913 | Ga0207695_10000296 | Ga0207695_1000029654 | 582 |
| 86 | 3300025914 | Ga0207671_10015822 | Ga0207671_100158223 | 582 |
| 87 | 3300037312 | Ga0395899_0000088 | Ga0395899_0000088_16020_17888 | 582 |
| 88 | 3300005354 | Ga0070675_100017355 | Ga0070675_1000173553 | 583 |
| 89 | 3300009147 | Ga0114129_10022888 | Ga0114129_100228887 | 583 |
| 90 | 3300025908 | Ga0207643_10009332 | Ga0207643_100093321 | 583 |
| 91 | 3300031711 | Ga0265314_10040909 | Ga0265314_100409092 | 583 |
| 92 | 3300005354 | Ga0070675_100071283 | Ga0070675_1000712832 | 584 |
| 93 | 3300005466 | Ga0070685_10051462 | Ga0070685_100514621 | 584 |
| 94 | 3300009545 | Ga0105237_10051120 | Ga0105237_100511205 | 584 |
| 95 | 3300025918 | Ga0207662_10040084 | Ga0207662_100400842 | 584 |
| 96 | 3300025923 | Ga0207681_10094328 | Ga0207681_100943282 | 584 |
| 97 | 3300025925 | Ga0207650_10024766 | Ga0207650_100247663 | 584 |
| 98 | 3300025940 | Ga0207691_10027609 | Ga0207691_100276093 | 584 |
| 99 | 3300025942 | Ga0207689_10020199 | Ga0207689_100201993 | 584 |
| 100 | 3300009545 | Ga0105237_10001668 | Ga0105237_1000166811 | 585 |
| 101 | 3300013102 | Ga0157371_10009594 | Ga0157371_100095943 | 585 |
| 102 | 3300025914 | Ga0207671_10000025 | Ga0207671_1000002560 | 585 |
| 103 | 3300025919 | Ga0207657_10017396 | Ga0207657_100173967 | 585 |
| 104 | 3300026089 | Ga0207648_10017812 | Ga0207648_100178125 | 585 |
| 105 | 3300044712 | Ga0453684_0063704 | Ga0453684_0063704_1335_3212 | 585 |
| 106 | 3300047320 | Ga0495672_0007236 | Ga0495672_0007236_4776_6668 | 585 |
| 107 | 3300053086 | Ga0500578_0022332 | Ga0500578_0022332_1758_3641 | 585 |
| 108 | 3300005335 | Ga0070666_10006029 | Ga0070666_100060295 | 586 |
| 109 | 3300005337 | Ga0070682_100002154 | Ga0070682_1000021548 | 586 |
| 110 | 3300005338 | Ga0068868_100025638 | Ga0068868_1000256381 | 586 |
| 111 | 3300005354 | Ga0070675_100023201 | Ga0070675_1000232014 | 586 |
| 112 | 3300005457 | Ga0070662_100096209 | Ga0070662_1000962091 | 586 |
| 113 | 3300005539 | Ga0068853_100009165 | Ga0068853_1000091656 | 586 |
| 114 | 3300005564 | Ga0070664_100097125 | Ga0070664_1000971251 | 586 |
| 115 | 3300005614 | Ga0068856_100014785 | Ga0068856_1000147852 | 586 |
| 116 | 3300013100 | Ga0157373_10007735 | Ga0157373_100077352 | 586 |
| 117 | 3300013102 | Ga0157371_10022767 | Ga0157371_100227673 | 586 |
| 118 | 3300013296 | Ga0157374_10068965 | Ga0157374_100689652 | 586 |
| 119 | 3300025945 | Ga0207679_10096528 | Ga0207679_100965282 | 586 |
| 120 | 3300026116 | Ga0207674_10042396 | Ga0207674_100423962 | 586 |
| 121 | 3300028800 | Ga0265338_10020119 | Ga0265338_100201193 | 586 |
| 122 | 3300050005 | Ga0501284_00074 | Ga0501284_00074_20463_22337 | 586 |
| 123 | 3300005539 | Ga0068853_100000197 | Ga0068853_1000001977 | 587 |
| 124 | 3300013102 | Ga0157371_10020747 | Ga0157371_100207472 | 587 |
| 125 | 3300026041 | Ga0207639_10008593 | Ga0207639_100085932 | 587 |
| 126 | 3300026142 | Ga0207698_10026415 | Ga0207698_100264154 | 587 |
| 127 | 3300031507 | Ga0307509_10090649 | Ga0307509_100906493 | 587 |
| 128 | 3300044658 | Ga0466972_0010056 | Ga0466972_0010056_581_2479 | 587 |
| 129 | 3300049579 | Ga0501043_0005144 | Ga0501043_0005144_520_2418 | 587 |
| 130 | 3300049580 | Ga0501046_0009125 | Ga0501046_0009125_2724_4622 | 587 |
| 131 | 3300049582 | Ga0501048_0003407 | Ga0501048_0003407_8245_10143 | 587 |
| 132 | 3300049823 | Ga0501044_0003613 | Ga0501044_0003613_12295_14193 | 587 |
| 133 | 3300053092 | Ga0500583_0000036 | Ga0500583_0000036_2424_4310 | 587 |
| 134 | 3300003771 | Ga0055526_1010998 | Ga0055526_10109982 | 588 |
| 135 | 3300005466 | Ga0070685_10020850 | Ga0070685_100208503 | 588 |
| 136 | 3300013105 | Ga0157369_10031150 | Ga0157369_100311506 | 588 |
| 137 | 3300037471 | Ga0395905_0006828 | Ga0395905_0006828_1457_3358 | 588 |
| 138 | 3300048918 | Ga0496115_0047518 | Ga0496115_0047518_1066_2973 | 588 |
| 139 | 3300005329 | Ga0070683_100018456 | Ga0070683_1000184565 | 589 |
| 140 | 3300005344 | Ga0070661_100004500 | Ga0070661_1000045007 | 589 |
| 141 | 3300005347 | Ga0070668_100022308 | Ga0070668_1000223083 | 589 |
| 142 | 3300005366 | Ga0070659_100017107 | Ga0070659_1000171073 | 589 |
| 143 | 3300005535 | Ga0070684_100001959 | Ga0070684_1000019595 | 589 |
| 144 | 3300005539 | Ga0068853_100000694 | Ga0068853_10000069418 | 589 |
| 145 | 3300005563 | Ga0068855_100000701 | Ga0068855_10000070125 | 589 |
| 146 | 3300005564 | Ga0070664_100001378 | Ga0070664_10000137813 | 589 |
| 147 | 3300005577 | Ga0068857_100000631 | Ga0068857_10000063111 | 589 |
| 148 | 3300005616 | Ga0068852_100098405 | Ga0068852_1000984052 | 589 |
| 149 | 3300009093 | Ga0105240_10000263 | Ga0105240_1000026335 | 589 |
| 150 | 3300009093 | Ga0105240_10010527 | Ga0105240_100105275 | 589 |
| 151 | 3300009174 | Ga0105241_10008606 | Ga0105241_100086065 | 589 |
| 152 | 3300009545 | Ga0105237_10114993 | Ga0105237_101149932 | 589 |
| 153 | 3300009551 | Ga0105238_10000650 | Ga0105238_1000065028 | 589 |
| 154 | 3300009553 | Ga0105249_10139633 | Ga0105249_101396332 | 589 |
| 155 | 3300013307 | Ga0157372_10013317 | Ga0157372_100133172 | 589 |
| 156 | 3300013307 | Ga0157372_10080698 | Ga0157372_100806983 | 589 |
| 157 | 3300025913 | Ga0207695_10000128 | Ga0207695_1000012876 | 589 |
| 158 | 3300025913 | Ga0207695_10000720 | Ga0207695_1000072018 | 589 |
| 159 | 3300025914 | Ga0207671_10004310 | Ga0207671_100043102 | 589 |
| 160 | 3300025920 | Ga0207649_10001702 | Ga0207649_100017026 | 589 |
| 161 | 3300025924 | Ga0207694_10068347 | Ga0207694_100683473 | 589 |
| 162 | 3300025945 | Ga0207679_10000822 | Ga0207679_1000082214 | 589 |
| 163 | 3300025949 | Ga0207667_10000143 | Ga0207667_1000014377 | 589 |
| 164 | 3300026041 | Ga0207639_10000910 | Ga0207639_100009105 | 589 |
| 165 | 3300026116 | Ga0207674_10004512 | Ga0207674_1000451211 | 589 |
| 166 | 3300026142 | Ga0207698_10046742 | Ga0207698_100467422 | 589 |
| 167 | 3300053156 | Ga0500622_0000371 | Ga0500622_0000371_4374_6278 | 589 |
| 168 | 3300003203 | JGI25406J46586_10006354 | JGI25406J46586_100063544 | 590 |
| 169 | 3300003354 | JGI25160J50197_1000175 | JGI25160J50197_100017546 | 590 |
| 170 | 3300005985 | Ga0081539_10000081 | Ga0081539_1000008171 | 590 |
| 171 | 3300025302 | Ga0207426_1000104 | Ga0207426_1000104103 | 590 |
| 172 | 3300025945 | Ga0207679_10004389 | Ga0207679_100043894 | 590 |
| 173 | 3300049822 | Ga0501035_0013148 | Ga0501035_0013148_5039_6937 | 590 |
| 174 | 3300005290 | Ga0065712_10005175 | Ga0065712_100051751 | 591 |
| 175 | 3300005329 | Ga0070683_100001537 | Ga0070683_10000153713 | 591 |
| 176 | 3300005344 | Ga0070661_100047835 | Ga0070661_1000478352 | 591 |
| 177 | 3300005535 | Ga0070684_100026667 | Ga0070684_1000266673 | 591 |
| 178 | 3300005548 | Ga0070665_100000009 | Ga0070665_100000009358 | 591 |
| 179 | 3300005564 | Ga0070664_100002631 | Ga0070664_10000263112 | 591 |
| 180 | 3300005843 | Ga0068860_100000078 | Ga0068860_10000007839 | 591 |
| 181 | 3300013306 | Ga0163162_10008781 | Ga0163162_100087817 | 591 |
| 182 | 3300014325 | Ga0163163_10000457 | Ga0163163_1000045725 | 591 |
| 183 | 3300025920 | Ga0207649_10014475 | Ga0207649_100144753 | 591 |
| 184 | 3300025933 | Ga0207706_10003814 | Ga0207706_100038145 | 591 |
| 185 | 3300025944 | Ga0207661_10005038 | Ga0207661_100050386 | 591 |
| 186 | 3300026116 | Ga0207674_10041339 | Ga0207674_100413392 | 591 |
| 187 | 3300028379 | Ga0268266_10000014 | Ga0268266_10000014314 | 591 |
| 188 | 3300028381 | Ga0268264_10000105 | Ga0268264_10000105143 | 591 |
| 189 | 3300046524 | Ga0495648_0007062 | Ga0495648_0007062_2868_4775 | 591 |
| 190 | 3300047318 | Ga0495636_0000007 | Ga0495636_0000007_96201_98090 | 591 |
| 191 | 3300049571 | Ga0501034_0009088 | Ga0501034_0009088_296_2185 | 591 |
| 192 | 3300049573 | Ga0501037_0027897 | Ga0501037_0027897_1356_3245 | 591 |
| 193 | 3300049822 | Ga0501035_0059110 | Ga0501035_0059110_1006_2895 | 591 |
| 194 | 3300049823 | Ga0501044_0022971 | Ga0501044_0022971_3817_5706 | 591 |
| 195 | 3300053156 | Ga0500622_0004179 | Ga0500622_0004179_770_2677 | 591 |
| 196 | 3300005290 | Ga0065712_10073607 | Ga0065712_100736073 | 592 |
| 197 | 3300005334 | Ga0068869_100039456 | Ga0068869_1000394561 | 592 |
| 198 | 3300005353 | Ga0070669_100004598 | Ga0070669_1000045987 | 592 |
| 199 | 3300005354 | Ga0070675_100026621 | Ga0070675_1000266215 | 592 |
| 200 | 3300005364 | Ga0070673_100006447 | Ga0070673_1000064475 | 592 |
| 201 | 3300005577 | Ga0068857_100016335 | Ga0068857_1000163355 | 592 |
| 202 | 3300005617 | Ga0068859_100013292 | Ga0068859_1000132927 | 592 |
| 203 | 3300005719 | Ga0068861_100003918 | Ga0068861_1000039187 | 592 |
| 204 | 3300005840 | Ga0068870_10012559 | Ga0068870_100125592 | 592 |
| 205 | 3300005844 | Ga0068862_100010317 | Ga0068862_1000103174 | 592 |
| 206 | 3300006931 | Ga0097620_100013292 | Ga0097620_1000132923 | 592 |
| 207 | 3300009094 | Ga0111539_10026729 | Ga0111539_100267297 | 592 |
| 208 | 3300009553 | Ga0105249_10027133 | Ga0105249_100271332 | 592 |
| 209 | 3300014325 | Ga0163163_10038656 | Ga0163163_100386562 | 592 |
| 210 | 3300014326 | Ga0157380_10001574 | Ga0157380_1000157410 | 592 |
| 211 | 3300014745 | Ga0157377_10006393 | Ga0157377_100063936 | 592 |
| 212 | 3300025923 | Ga0207681_10005990 | Ga0207681_100059905 | 592 |
| 213 | 3300025933 | Ga0207706_10012699 | Ga0207706_100126993 | 592 |
| 214 | 3300025942 | Ga0207689_10015335 | Ga0207689_100153355 | 592 |
| 215 | 3300025960 | Ga0207651_10010190 | Ga0207651_100101904 | 592 |
| 216 | 3300025961 | Ga0207712_10015057 | Ga0207712_100150575 | 592 |
| 217 | 3300025961 | Ga0207712_10023879 | Ga0207712_100238792 | 592 |
| 218 | 3300026116 | Ga0207674_10043884 | Ga0207674_100438841 | 592 |
| 219 | 3300026118 | Ga0207675_100001768 | Ga0207675_1000017689 | 592 |
| 220 | 3300027907 | Ga0207428_10048745 | Ga0207428_100487452 | 592 |
| 221 | 3300030521 | Ga0307511_10001181 | Ga0307511_1000118111 | 592 |
| 222 | 3300031251 | Ga0265327_10000010 | Ga0265327_10000010183 | 592 |
| 223 | 3300046507 | Ga0495606_0013306 | Ga0495606_0013306_3084_5000 | 592 |
| 224 | 3300050511 | nmdc:mga08y16_24106_c1 | nmdc:mga08y16_24106_c1_3908_5803 | 592 |
| 225 | 3300048924 | Ga0496121_0000395 | Ga0496121_0000395_86672_88573 | 593 |
| 226 | 3300049568 | Ga0501031_0031924 | Ga0501031_0031924_1245_3143 | 593 |
| 227 | 3300006847 | Ga0075431_100002821 | Ga0075431_1000028216 | 594 |
| 228 | 3300045051 | Ga0451576_0000002 | Ga0451576_0000002_1326048_1327949 | 594 |
| 229 | 3300050508 | nmdc:mga09592_35915_c1 | nmdc:mga09592_35915_c1_2122_3990 | 594 |
| 230 | 3300050510 | nmdc:mga06r32_39647_c1 | nmdc:mga06r32_39647_c1_426_2294 | 594 |
| 231 | 3300009147 | Ga0114129_10012009 | Ga0114129_100120096 | 595 |
| 232 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002223 | 595 |
| 233 | 3300014969 | Ga0157376_10000853 | Ga0157376_1000085312 | 595 |
| 234 | 3300032002 | Ga0307416_100039887 | Ga0307416_1000398874 | 595 |
| 235 | 3300044712 | Ga0453684_0004866 | Ga0453684_0004866_11679_13553 | 595 |
| 236 | 3300050507 | nmdc:mga05p37_8806_c1 | nmdc:mga05p37_8806_c1_6660_8555 | 595 |
| 237 | 3300003323 | rootH1_10032632 | rootH1_100326329 | 596 |
| 238 | 3300003354 | JGI25160J50197_1006486 | JGI25160J50197_10064863 | 596 |
| 239 | 3300005539 | Ga0068853_100036941 | Ga0068853_1000369415 | 596 |
| 240 | 3300006844 | Ga0075428_100010006 | Ga0075428_1000100068 | 596 |
| 241 | 3300006846 | Ga0075430_100008685 | Ga0075430_1000086853 | 596 |
| 242 | 3300009093 | Ga0105240_10000023 | Ga0105240_10000023262 | 596 |
| 243 | 3300025302 | Ga0207426_1001887 | Ga0207426_10018874 | 596 |
| 244 | 3300025913 | Ga0207695_10000016 | Ga0207695_1000001657 | 596 |
| 245 | 3300026041 | Ga0207639_10012793 | Ga0207639_100127931 | 596 |
| 246 | 3300026089 | Ga0207648_10141902 | Ga0207648_101419021 | 596 |
| 247 | 3300028794 | Ga0307515_10000412 | Ga0307515_1000041220 | 596 |
| 248 | 3300031616 | Ga0307508_10000407 | Ga0307508_1000040715 | 596 |
| 249 | 3300044658 | Ga0466972_0000418 | Ga0466972_0000418_19184_21082 | 596 |
| 250 | 3300049574 | Ga0501038_0012660 | Ga0501038_0012660_3328_5322 | 596 |
| 251 | 3300049575 | Ga0501039_0031678 | Ga0501039_0031678_1588_3486 | 596 |
| 252 | 3300049579 | Ga0501043_0020162 | Ga0501043_0020162_1162_3156 | 596 |
| 253 | 3300049823 | Ga0501044_0007122 | Ga0501044_0007122_7102_9000 | 596 |
| 254 | 3300050508 | nmdc:mga09592_91006_c1 | nmdc:mga09592_91006_c1_549_2426 | 596 |
| 255 | 3300053086 | Ga0500578_0000009 | Ga0500578_0000009_172943_174826 | 596 |
| 256 | 3300053131 | Ga0500652_007363 | Ga0500652_007363_27_1925 | 596 |
| 257 | 3300025302 | Ga0207426_1000033 | Ga0207426_1000033343 | 597 |
| 258 | 3300036401 | Ga0373937_0002054 | Ga0373937_0002054_5524_7413 | 597 |
| 259 | 3300046514 | Ga0495618_0053494 | Ga0495618_0053494_260_2149 | 597 |
| 260 | 3300046516 | Ga0495628_0060869 | Ga0495628_0060869_303_2192 | 597 |
| 261 | 3300046536 | Ga0495587_0009393 | Ga0495587_0009393_4335_6224 | 597 |
| 262 | 3300046642 | Ga0495634_0018183 | Ga0495634_0018183_65_1954 | 597 |
| 263 | 3300047317 | Ga0495604_0102753 | Ga0495604_0102753_31_1920 | 597 |
| 264 | 3300053131 | Ga0500652_004801 | Ga0500652_004801_133_2016 | 597 |
| 265 | 3300003320 | rootH2_10036622 | rootH2_1003662213 | 598 |
| 266 | 3300003323 | rootH1_10004759 | rootH1_1000475930 | 598 |
| 267 | 3300013105 | Ga0157369_10108958 | Ga0157369_101089582 | 598 |
| 268 | 3300025242 | Ga0209258_100032 | Ga0209258_100032182 | 598 |
| 269 | 3300025254 | Ga0209148_1000186 | Ga0209148_100018657 | 598 |
| 270 | 3300053088 | Ga0500644_0000077 | Ga0500644_0000077_55825_57726 | 598 |
| 271 | 3300053093 | Ga0500651_0055286 | Ga0500651_0055286_44_1948 | 598 |
| 272 | 3300053109 | Ga0500569_000122 | Ga0500569_000122_8085_9989 | 598 |
| 273 | 3300053142 | Ga0500577_0000218 | Ga0500577_0000218_2496_4400 | 598 |
| 274 | 3300053177 | Ga0500636_0016920 | Ga0500636_0016920_1066_2967 | 598 |
| 275 | 3300003320 | rootH2_10024015 | rootH2_100240152 | 599 |
| 276 | 3300005335 | Ga0070666_10041011 | Ga0070666_100410112 | 599 |
| 277 | 3300005340 | Ga0070689_100014127 | Ga0070689_1000141272 | 599 |
| 278 | 3300005618 | Ga0068864_100068121 | Ga0068864_1000681212 | 599 |
| 279 | 3300005841 | Ga0068863_100015639 | Ga0068863_1000156397 | 599 |
| 280 | 3300013296 | Ga0157374_10029273 | Ga0157374_100292733 | 599 |
| 281 | 3300013306 | Ga0163162_10010540 | Ga0163162_100105406 | 599 |
| 282 | 3300014968 | Ga0157379_10100797 | Ga0157379_101007972 | 599 |
| 283 | 3300025936 | Ga0207670_10009434 | Ga0207670_100094345 | 599 |
| 284 | 3300026023 | Ga0207677_10074542 | Ga0207677_100745422 | 599 |
| 285 | 3300026095 | Ga0207676_10029711 | Ga0207676_100297113 | 599 |
| 286 | 3300049590 | Ga0501074_0000918 | Ga0501074_0000918_8725_10623 | 599 |
| 287 | 3300005327 | Ga0070658_10000230 | Ga0070658_1000023041 | 600 |
| 288 | 3300005328 | Ga0070676_10001002 | Ga0070676_1000100211 | 600 |
| 289 | 3300005367 | Ga0070667_100002462 | Ga0070667_10000246210 | 600 |
| 290 | 3300005539 | Ga0068853_100007233 | Ga0068853_1000072334 | 600 |
| 291 | 3300005543 | Ga0070672_100000033 | Ga0070672_1000000338 | 600 |
| 292 | 3300005548 | Ga0070665_100001625 | Ga0070665_1000016258 | 600 |
| 293 | 3300005614 | Ga0068856_100026914 | Ga0068856_1000269142 | 600 |
| 294 | 3300005616 | Ga0068852_100017249 | Ga0068852_1000172493 | 600 |
| 295 | 3300005842 | Ga0068858_100002290 | Ga0068858_1000022903 | 600 |
| 296 | 3300006881 | Ga0068865_100000705 | Ga0068865_1000007055 | 600 |
| 297 | 3300009174 | Ga0105241_10026488 | Ga0105241_100264882 | 600 |
| 298 | 3300009553 | Ga0105249_10004075 | Ga0105249_100040758 | 600 |
| 299 | 3300013297 | Ga0157378_10048492 | Ga0157378_100484922 | 600 |
| 300 | 3300014325 | Ga0163163_10000616 | Ga0163163_1000061625 | 600 |
| 301 | 3300014968 | Ga0157379_10000229 | Ga0157379_100002294 | 600 |
| 302 | 3300014969 | Ga0157376_10000117 | Ga0157376_100001173 | 600 |
| 303 | 3300015265 | Ga0182005_1000159 | Ga0182005_100015914 | 600 |
| 304 | 3300025903 | Ga0207680_10010797 | Ga0207680_100107973 | 600 |
| 305 | 3300025907 | Ga0207645_10002569 | Ga0207645_1000256910 | 600 |
| 306 | 3300025909 | Ga0207705_10013822 | Ga0207705_100138226 | 600 |
| 307 | 3300025938 | Ga0207704_10001086 | Ga0207704_100010863 | 600 |
| 308 | 3300025940 | Ga0207691_10000001 | Ga0207691_1000000193 | 600 |
| 309 | 3300025986 | Ga0207658_10002549 | Ga0207658_100025499 | 600 |
| 310 | 3300026023 | Ga0207677_10002241 | Ga0207677_100022413 | 600 |
| 311 | 3300044842 | Ga0466957_0001179 | Ga0466957_0001179_5170_7053 | 600 |
| 312 | 3300005347 | Ga0070668_100000862 | Ga0070668_10000086219 | 601 |
| 313 | 3300005364 | Ga0070673_100000096 | Ga0070673_1000000968 | 601 |
| 314 | 3300005457 | Ga0070662_100004733 | Ga0070662_1000047338 | 601 |
| 315 | 3300005459 | Ga0068867_100005892 | Ga0068867_1000058926 | 601 |
| 316 | 3300005841 | Ga0068863_100012550 | Ga0068863_1000125508 | 601 |
| 317 | 3300025933 | Ga0207706_10011370 | Ga0207706_100113707 | 601 |
| 318 | 3300025960 | Ga0207651_10002700 | Ga0207651_100027008 | 601 |
| 319 | 3300005367 | Ga0070667_100018176 | Ga0070667_1000181763 | 602 |
| 320 | 3300005456 | Ga0070678_100000605 | Ga0070678_1000006055 | 602 |
| 321 | 3300005718 | Ga0068866_10002055 | Ga0068866_100020554 | 602 |
| 322 | 3300006237 | Ga0097621_100004248 | Ga0097621_1000042485 | 602 |
| 323 | 3300006881 | Ga0068865_100003471 | Ga0068865_1000034719 | 602 |
| 324 | 3300009093 | Ga0105240_10000047 | Ga0105240_10000047104 | 602 |
| 325 | 3300009176 | Ga0105242_10018943 | Ga0105242_100189434 | 602 |
| 326 | 3300025903 | Ga0207680_10014129 | Ga0207680_100141293 | 602 |
| 327 | 3300025907 | Ga0207645_10000571 | Ga0207645_100005719 | 602 |
| 328 | 3300025913 | Ga0207695_10000010 | Ga0207695_10000010135 | 602 |
| 329 | 3300025940 | Ga0207691_10018871 | Ga0207691_100188714 | 602 |
| 330 | 3300025942 | Ga0207689_10000939 | Ga0207689_1000093911 | 602 |
| 331 | 3300026089 | Ga0207648_10002203 | Ga0207648_1000220312 | 602 |
| 332 | 3300026121 | Ga0207683_10000535 | Ga0207683_100005359 | 602 |
| 333 | 3300037418 | Ga0395900_0104647 | Ga0395900_0104647_648_2522 | 602 |
| 334 | 3300049581 | Ga0501047_0013573 | Ga0501047_0013573_1017_2912 | 602 |
| 335 | 3300003322 | rootL2_10025914 | rootL2_100259144 | 603 |
| 336 | 3300005331 | Ga0070670_100149277 | Ga0070670_1001492771 | 603 |
| 337 | 3300005354 | Ga0070675_100081255 | Ga0070675_1000812552 | 603 |
| 338 | 3300005367 | Ga0070667_100073467 | Ga0070667_1000734672 | 603 |
| 339 | 3300005617 | Ga0068859_100011172 | Ga0068859_1000111723 | 603 |
| 340 | 3300005618 | Ga0068864_100002506 | Ga0068864_10000250611 | 603 |
| 341 | 3300005719 | Ga0068861_100035811 | Ga0068861_1000358113 | 603 |
| 342 | 3300006931 | Ga0097620_100011171 | Ga0097620_1000111713 | 603 |
| 343 | 3300009101 | Ga0105247_10007184 | Ga0105247_100071844 | 603 |
| 344 | 3300009553 | Ga0105249_10016454 | Ga0105249_100164544 | 603 |
| 345 | 3300009553 | Ga0105249_10020524 | Ga0105249_100205242 | 603 |
| 346 | 3300010375 | Ga0105239_10000760 | Ga0105239_1000076028 | 603 |
| 347 | 3300010375 | Ga0105239_10000916 | Ga0105239_1000091618 | 603 |
| 348 | 3300014325 | Ga0163163_10017383 | Ga0163163_100173834 | 603 |
| 349 | 3300014326 | Ga0157380_10020217 | Ga0157380_100202174 | 603 |
| 350 | 3300021384 | Ga0213876_10002778 | Ga0213876_100027784 | 603 |
| 351 | 3300025900 | Ga0207710_10003723 | Ga0207710_100037235 | 603 |
| 352 | 3300025914 | Ga0207671_10065972 | Ga0207671_100659721 | 603 |
| 353 | 3300025926 | Ga0207659_10041999 | Ga0207659_100419991 | 603 |
| 354 | 3300025961 | Ga0207712_10008393 | Ga0207712_100083934 | 603 |
| 355 | 3300025961 | Ga0207712_10011203 | Ga0207712_100112032 | 603 |
| 356 | 3300026095 | Ga0207676_10021406 | Ga0207676_100214064 | 603 |
| 357 | 3300026118 | Ga0207675_100025499 | Ga0207675_1000254993 | 603 |
| 358 | 3300028786 | Ga0307517_10002677 | Ga0307517_1000267716 | 603 |
| 359 | 3300039437 | Ga0436365_1926928 | Ga0436365_1926928_8967_10835 | 603 |
| 360 | 3300044842 | Ga0466957_0002435 | Ga0466957_0002435_3527_5410 | 603 |
| 361 | 3300049675 | Ga0501243_000059 | Ga0501243_000059_1582_3453 | 603 |
| 362 | 3300049708 | Ga0501245_000186 | Ga0501245_000186_4293_6164 | 603 |
| 363 | 3300013297 | Ga0157378_10052632 | Ga0157378_100526324 | 604 |
| 364 | 3300003320 | rootH2_10015377 | rootH2_1001537711 | 605 |
| 365 | 3300005331 | Ga0070670_100024730 | Ga0070670_1000247303 | 605 |
| 366 | 3300005334 | Ga0068869_100063165 | Ga0068869_1000631652 | 605 |
| 367 | 3300005459 | Ga0068867_100002197 | Ga0068867_10000219710 | 605 |
| 368 | 3300006237 | Ga0097621_100002550 | Ga0097621_10000255014 | 605 |
| 369 | 3300009553 | Ga0105249_10029726 | Ga0105249_100297264 | 605 |
| 370 | 3300013306 | Ga0163162_10012796 | Ga0163162_100127966 | 605 |
| 371 | 3300025942 | Ga0207689_10017542 | Ga0207689_100175427 | 605 |
| 372 | 3300026089 | Ga0207648_10001686 | Ga0207648_100016862 | 605 |
| 373 | 3300049823 | Ga0501044_0102894 | Ga0501044_0102894_761_2629 | 605 |
| 374 | 3300049823 | Ga0501044_0106572 | Ga0501044_0106572_879_2786 | 605 |
| 375 | 3300003320 | rootH2_10025304 | rootH2_1002530413 | 606 |
| 376 | 3300005336 | Ga0070680_100005480 | Ga0070680_1000054806 | 606 |
| 377 | 3300005337 | Ga0070682_100000439 | Ga0070682_10000043915 | 606 |
| 378 | 3300005341 | Ga0070691_10000811 | Ga0070691_100008112 | 606 |
| 379 | 3300005367 | Ga0070667_100033070 | Ga0070667_1000330702 | 606 |
| 380 | 3300005458 | Ga0070681_10003457 | Ga0070681_100034575 | 606 |
| 381 | 3300005530 | Ga0070679_100006343 | Ga0070679_1000063433 | 606 |
| 382 | 3300005563 | Ga0068855_100004165 | Ga0068855_1000041654 | 606 |
| 383 | 3300005563 | Ga0068855_100081410 | Ga0068855_1000814103 | 606 |
| 384 | 3300005843 | Ga0068860_100003374 | Ga0068860_1000033746 | 606 |
| 385 | 3300006358 | Ga0068871_100020948 | Ga0068871_1000209487 | 606 |
| 386 | 3300009093 | Ga0105240_10001324 | Ga0105240_1000132415 | 606 |
| 387 | 3300009174 | Ga0105241_10000319 | Ga0105241_1000031910 | 606 |
| 388 | 3300009545 | Ga0105237_10011021 | Ga0105237_100110215 | 606 |
| 389 | 3300010375 | Ga0105239_10003815 | Ga0105239_100038157 | 606 |
| 390 | 3300013104 | Ga0157370_10000479 | Ga0157370_1000047936 | 606 |
| 391 | 3300013306 | Ga0163162_10000190 | Ga0163162_100001904 | 606 |
| 392 | 3300014969 | Ga0157376_10055580 | Ga0157376_100555804 | 606 |
| 393 | 3300025911 | Ga0207654_10038450 | Ga0207654_100384503 | 606 |
| 394 | 3300025912 | Ga0207707_10002013 | Ga0207707_100020139 | 606 |
| 395 | 3300025913 | Ga0207695_10080906 | Ga0207695_100809062 | 606 |
| 396 | 3300025914 | Ga0207671_10014791 | Ga0207671_100147915 | 606 |
| 397 | 3300025917 | Ga0207660_10002865 | Ga0207660_100028657 | 606 |
| 398 | 3300025921 | Ga0207652_10001732 | Ga0207652_1000173210 | 606 |
| 399 | 3300025949 | Ga0207667_10014323 | Ga0207667_100143235 | 606 |
| 400 | 3300028381 | Ga0268264_10003349 | Ga0268264_100033497 | 606 |
| 401 | 3300036401 | Ga0373937_0091036 | Ga0373937_0091036_392_2278 | 606 |
| 402 | 3300047443 | Ga0495687_000056 | Ga0495687_000056_131106_133013 | 606 |
| 403 | 3300047472 | Ga0495686_0000016 | Ga0495686_0000016_114216_116138 | 606 |
| 404 | 3300049742 | Ga0501080_0128452 | Ga0501080_0128452_140_2014 | 606 |
| 405 | iso_pu_bacteria | 2818991444 | 2819586855 | 606 |
| 406 | 3300005330 | Ga0070690_100068453 | Ga0070690_1000684531 | 607 |
| 407 | 3300005347 | Ga0070668_100026890 | Ga0070668_1000268902 | 607 |
| 408 | 3300005353 | Ga0070669_100049455 | Ga0070669_1000494552 | 607 |
| 409 | 3300005563 | Ga0068855_100002673 | Ga0068855_10000267320 | 607 |
| 410 | 3300005577 | Ga0068857_100000290 | Ga0068857_1000002906 | 607 |
| 411 | 3300010375 | Ga0105239_10001869 | Ga0105239_100018697 | 607 |
| 412 | 3300013104 | Ga0157370_10002029 | Ga0157370_100020296 | 607 |
| 413 | 3300013307 | Ga0157372_10000716 | Ga0157372_1000071618 | 607 |
| 414 | 3300013307 | Ga0157372_10017331 | Ga0157372_100173315 | 607 |
| 415 | 3300014968 | Ga0157379_10111146 | Ga0157379_101111462 | 607 |
| 416 | 3300025914 | Ga0207671_10018663 | Ga0207671_100186635 | 607 |
| 417 | 3300025940 | Ga0207691_10068212 | Ga0207691_100682122 | 607 |
| 418 | 3300025949 | Ga0207667_10000583 | Ga0207667_1000058321 | 607 |
| 419 | 3300026078 | Ga0207702_10042757 | Ga0207702_100427573 | 607 |
| 420 | 3300026116 | Ga0207674_10000822 | Ga0207674_1000082228 | 607 |
| 421 | 3300026142 | Ga0207698_10001194 | Ga0207698_100011946 | 607 |
| 422 | 3300044658 | Ga0466972_0000019 | Ga0466972_0000019_709_2589 | 607 |
| 423 | 3300044765 | Ga0466970_0009450 | Ga0466970_0009450_2858_4738 | 607 |
| 424 | 3300046453 | Ga0495627_000792 | Ga0495627_000792_14051_15964 | 607 |
| 425 | 3300046558 | Ga0495633_0002201 | Ga0495633_0002201_11531_13444 | 607 |
| 426 | 3300049580 | Ga0501046_0103294 | Ga0501046_0103294_94_2010 | 607 |
| 427 | 3300049588 | Ga0501072_0045823 | Ga0501072_0045823_213_2129 | 607 |
| 428 | 3300054114 | Ga0501084_0024217 | Ga0501084_0024217_2294_4210 | 607 |
| 429 | iso_pu_bacteria | 2821136567 | 2821140725 | 607 |
| 430 | iso_pu_bacteria | 2904467357 | 2904471227 | 607 |
| 431 | 3300001989 | JGI24739J22299_10000195 | JGI24739J22299_100001953 | 608 |
| 432 | 3300005331 | Ga0070670_100059989 | Ga0070670_1000599892 | 608 |
| 433 | 3300005367 | Ga0070667_100010439 | Ga0070667_1000104396 | 608 |
| 434 | 3300005841 | Ga0068863_100074607 | Ga0068863_1000746072 | 608 |
| 435 | 3300006237 | Ga0097621_100000595 | Ga0097621_10000059519 | 608 |
| 436 | 3300006358 | Ga0068871_100000415 | Ga0068871_10000041520 | 608 |
| 437 | 3300009551 | Ga0105238_10069346 | Ga0105238_100693461 | 608 |
| 438 | 3300010375 | Ga0105239_10038996 | Ga0105239_100389962 | 608 |
| 439 | 3300013296 | Ga0157374_10111931 | Ga0157374_101119312 | 608 |
| 440 | 3300013297 | Ga0157378_10002110 | Ga0157378_100021109 | 608 |
| 441 | 3300013306 | Ga0163162_10000371 | Ga0163162_1000037117 | 608 |
| 442 | 3300013308 | Ga0157375_10000935 | Ga0157375_1000093513 | 608 |
| 443 | 3300014968 | Ga0157379_10007387 | Ga0157379_100073877 | 608 |
| 444 | 3300014969 | Ga0157376_10000453 | Ga0157376_1000045310 | 608 |
| 445 | 3300017792 | Ga0163161_10004059 | Ga0163161_100040593 | 608 |
| 446 | 3300025297 | Ga0209758_1001642 | Ga0209758_100164221 | 608 |
| 447 | 3300025986 | Ga0207658_10028271 | Ga0207658_100282711 | 608 |
| 448 | 3300026121 | Ga0207683_10075038 | Ga0207683_100750382 | 608 |
| 449 | 3300044656 | Ga0466969_0000109 | Ga0466969_0000109_17595_19481 | 608 |
| 450 | 3300045049 | Ga0466959_0000380 | Ga0466959_0000380_11245_13131 | 608 |
| 451 | iso_pu_bacteria | 2738541278 | 2738726524 | 608 |
| 452 | iso_pu_bacteria | 2818991442 | 2819574637 | 608 |
| 453 | iso_pu_bacteria | 2929921140 | 2929922185 | 608 |
| 454 | iso_pu_bacteria | 8003151029 | 8003155200 | 608 |
| 455 | 3300005456 | Ga0070678_100014157 | Ga0070678_1000141571 | 609 |
| 456 | 3300005457 | Ga0070662_100002855 | Ga0070662_1000028552 | 609 |
| 457 | 3300005471 | Ga0070698_100011022 | Ga0070698_1000110228 | 609 |
| 458 | 3300005983 | Ga0081540_1017990 | Ga0081540_10179902 | 609 |
| 459 | 3300009553 | Ga0105249_10017922 | Ga0105249_100179223 | 609 |
| 460 | 3300013306 | Ga0163162_10004419 | Ga0163162_1000441913 | 609 |
| 461 | 3300013308 | Ga0157375_10119116 | Ga0157375_101191162 | 609 |
| 462 | 3300017792 | Ga0163161_10035452 | Ga0163161_100354522 | 609 |
| 463 | 3300025304 | Ga0209257_1000233 | Ga0209257_100023360 | 609 |
| 464 | 3300025907 | Ga0207645_10005503 | Ga0207645_100055038 | 609 |
| 465 | 3300025933 | Ga0207706_10073896 | Ga0207706_100738963 | 609 |
| 466 | 3300026088 | Ga0207641_10001344 | Ga0207641_1000134414 | 609 |
| 467 | 3300048917 | Ga0496114_0007496 | Ga0496114_0007496_6428_8338 | 609 |
| 468 | iso_pu_bacteria | 2929154850 | 2929156996 | 609 |
| 469 | 3300005335 | Ga0070666_10000140 | Ga0070666_1000014028 | 610 |
| 470 | 3300005355 | Ga0070671_100064167 | Ga0070671_1000641673 | 610 |
| 471 | 3300005364 | Ga0070673_100024287 | Ga0070673_1000242872 | 610 |
| 472 | 3300005364 | Ga0070673_100030337 | Ga0070673_1000303371 | 610 |
| 473 | 3300005367 | Ga0070667_100032100 | Ga0070667_1000321003 | 610 |
| 474 | 3300005456 | Ga0070678_100091560 | Ga0070678_1000915602 | 610 |
| 475 | 3300005459 | Ga0068867_100115029 | Ga0068867_1001150291 | 610 |
| 476 | 3300005544 | Ga0070686_100018894 | Ga0070686_1000188943 | 610 |
| 477 | 3300005564 | Ga0070664_100112531 | Ga0070664_1001125311 | 610 |
| 478 | 3300005616 | Ga0068852_100047116 | Ga0068852_1000471163 | 610 |
| 479 | 3300005617 | Ga0068859_100005301 | Ga0068859_1000053019 | 610 |
| 480 | 3300005841 | Ga0068863_100079510 | Ga0068863_1000795102 | 610 |
| 481 | 3300005842 | Ga0068858_100008890 | Ga0068858_1000088909 | 610 |
| 482 | 3300005843 | Ga0068860_100002082 | Ga0068860_1000020822 | 610 |
| 483 | 3300006358 | Ga0068871_100118684 | Ga0068871_1001186841 | 610 |
| 484 | 3300006931 | Ga0097620_100005301 | Ga0097620_1000053016 | 610 |
| 485 | 3300009101 | Ga0105247_10007085 | Ga0105247_100070855 | 610 |
| 486 | 3300009174 | Ga0105241_10006156 | Ga0105241_100061568 | 610 |
| 487 | 3300009553 | Ga0105249_10008383 | Ga0105249_1000838310 | 610 |
| 488 | 3300013297 | Ga0157378_10009097 | Ga0157378_100090977 | 610 |
| 489 | 3300013297 | Ga0157378_10113820 | Ga0157378_101138202 | 610 |
| 490 | 3300013306 | Ga0163162_10001924 | Ga0163162_1000192415 | 610 |
| 491 | 3300013308 | Ga0157375_10012957 | Ga0157375_100129575 | 610 |
| 492 | 3300014325 | Ga0163163_10044208 | Ga0163163_100442082 | 610 |
| 493 | 3300014969 | Ga0157376_10021632 | Ga0157376_100216324 | 610 |
| 494 | 3300025901 | Ga0207688_10031071 | Ga0207688_100310711 | 610 |
| 495 | 3300025903 | Ga0207680_10000140 | Ga0207680_1000014022 | 610 |
| 496 | 3300025907 | Ga0207645_10078447 | Ga0207645_100784471 | 610 |
| 497 | 3300025914 | Ga0207671_10004643 | Ga0207671_100046434 | 610 |
| 498 | 3300025918 | Ga0207662_10052964 | Ga0207662_100529641 | 610 |
| 499 | 3300025940 | Ga0207691_10062223 | Ga0207691_100622232 | 610 |
| 500 | 3300025942 | Ga0207689_10003471 | Ga0207689_1000347110 | 610 |
| 501 | 3300025945 | Ga0207679_10055578 | Ga0207679_100555781 | 610 |
| 502 | 3300025981 | Ga0207640_10047834 | Ga0207640_100478341 | 610 |
| 503 | 3300026035 | Ga0207703_10038318 | Ga0207703_100383182 | 610 |
| 504 | 3300026088 | Ga0207641_10000082 | Ga0207641_1000008251 | 610 |
| 505 | 3300026121 | Ga0207683_10010341 | Ga0207683_100103411 | 610 |
| 506 | 3300026121 | Ga0207683_10040459 | Ga0207683_100404591 | 610 |
| 507 | 3300026142 | Ga0207698_10015113 | Ga0207698_100151135 | 610 |
| 508 | 3300028381 | Ga0268264_10000810 | Ga0268264_1000081019 | 610 |
| 509 | 3300041997 | Ga0439431_0002077 | Ga0439431_0002077_2014_3909 | 610 |
| 510 | iso_pu_bacteria | 2818991460 | 2819676526 | 610 |
| 511 | iso_pu_bacteria | 2881955468 | 2881957910 | 610 |
| 512 | iso_pu_bacteria | 2914759650 | 2914761151 | 610 |
| 513 | iso_pu_bacteria | 2929177148 | 2929178108 | 610 |
| 514 | iso_pu_bacteria | 2929239360 | 2929240420 | 610 |
| 515 | iso_pu_bacteria | 2945977869 | 2945980470 | 610 |
| 516 | iso_pu_bacteria | 2946013367 | 2946013668 | 610 |
| 517 | 3300003322 | rootL2_10163372 | rootL2_101633722 | 611 |
| 518 | 3300003323 | rootH1_10154878 | rootH1_101548786 | 611 |
| 519 | 3300005334 | Ga0068869_100017060 | Ga0068869_1000170603 | 611 |
| 520 | 3300005344 | Ga0070661_100061243 | Ga0070661_1000612432 | 611 |
| 521 | 3300005367 | Ga0070667_100039986 | Ga0070667_1000399863 | 611 |
| 522 | 3300005457 | Ga0070662_100002759 | Ga0070662_1000027596 | 611 |
| 523 | 3300005564 | Ga0070664_100089374 | Ga0070664_1000893742 | 611 |
| 524 | 3300005616 | Ga0068852_100038805 | Ga0068852_1000388052 | 611 |
| 525 | 3300013308 | Ga0157375_10031490 | Ga0157375_100314906 | 611 |
| 526 | 3300014969 | Ga0157376_10006481 | Ga0157376_100064815 | 611 |
| 527 | 3300025899 | Ga0207642_10008859 | Ga0207642_100088592 | 611 |
| 528 | 3300025903 | Ga0207680_10019116 | Ga0207680_100191161 | 611 |
| 529 | 3300025933 | Ga0207706_10025104 | Ga0207706_100251042 | 611 |
| 530 | 3300026078 | Ga0207702_10098062 | Ga0207702_100980622 | 611 |
| 531 | 3300031456 | Ga0307513_10111077 | Ga0307513_101110771 | 611 |
| 532 | 3300053090 | Ga0500646_0000334 | Ga0500646_0000334_4877_6802 | 611 |
| 533 | 3300053136 | Ga0500559_0019353 | Ga0500559_0019353_499_2400 | 611 |
| 534 | 3300053151 | Ga0500604_0005485 | Ga0500604_0005485_1267_3165 | 611 |
| 535 | iso_pu_bacteria | 2884791551 | 2884796380 | 611 |
| 536 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_1000003201 | 612 |
| 537 | 3300025246 | Ga0209646_1000004 | Ga0209646_1000004138 | 612 |
| 538 | 3300025250 | Ga0209026_1000132 | Ga0209026_100013288 | 612 |
| 539 | 3300047472 | Ga0495686_0000417 | Ga0495686_0000417_62873_64777 | 612 |
| 540 | 3300053139 | Ga0500568_0000606 | Ga0500568_0000606_532_2448 | 612 |
| 541 | 3300053088 | Ga0500644_0011379 | Ga0500644_0011379_448_2373 | 613 |
| 542 | 3300053108 | Ga0500562_000083 | Ga0500562_000083_32221_34146 | 613 |
| 543 | 3300053156 | Ga0500622_0001321 | Ga0500622_0001321_14094_16019 | 613 |
| 544 | 3300009545 | Ga0105237_10000572 | Ga0105237_1000057235 | 614 |
| 545 | 3300031730 | Ga0307516_10003451 | Ga0307516_100034514 | 614 |
| 546 | 3300033180 | Ga0307510_10004615 | Ga0307510_100046158 | 614 |
| 547 | 3300046648 | Ga0495611_0000139 | Ga0495611_0000139_29696_31672 | 614 |
| 548 | 3300005548 | Ga0070665_100002141 | Ga0070665_10000214111 | 621 |
| 549 | 3300028379 | Ga0268266_10001932 | Ga0268266_1000193214 | 621 |
| 550 | 3300031251 | Ga0265327_10000256 | Ga0265327_1000025645 | 621 |
| 551 | 2162886007 | SwRhRL2b_contig_104926 | SwRhRL2b_0327.00003430 | 623 |
| 552 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133703 | 623 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar