F462659

General Info

Members Datasets Scaffolds Average Seq Length
551 210 1102 274

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0000390|Ga0496112_0000390_1125_1937
Length 263
Sequence VRRKVFAVVVLLTLAFLTLFWLANHYVFTQLDQISPPADVHVDTRTFAGAFMFGLALFATLFLGVVLAVFLTIGVVSGDAERGLLQPLVVRPVGRSTLLLARFLGASGVCVTYVLAVYFAAMLITGLTGHWWPDRIVSPGVELAVASLLGSVVISSTANGIAVFMLFGAGLVAGLLGTIGHALNSHAVKHASTIAAWALPFEALYQDALRMITERASGLTGFLLQLGPFGGAYVHGWGIRVWSAGYLVVVLALAIFAFSRRNL

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 12.16
Rhizosphere 87.48
Stem 0
Stem Tuber 0
Unclassified 5.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0000390 3300048915 Bacteria 28702
2 Ga0070658_10006196 3300005327 Bacteria 9697
3 Ga0070658_10032747 3300005327 Bacteria 4179
4 Ga0070658_10074166 3300005327 Bacteria 2790
5 Ga0070658_10097933 3300005327 Bacteria 2422
6 Ga0070683_100060944 3300005329 Bacteria 3507
7 Ga0070683_100114373 3300005329 Bacteria 2547
8 Ga0070680_100059844 3300005336 Bacteria 3117
9 Ga0070680_100155680 3300005336 Bacteria 1920
10 Ga0070682_100046118 3300005337 Bacteria 2704
11 Ga0070660_100095619 3300005339 Bacteria 2348
12 Ga0070660_100218508 3300005339 Unclassified 1549
13 Ga0070660_100364317 3300005339 Bacteria 1192
14 Ga0070691_10017883 3300005341 Bacteria 3263
15 Ga0070661_100044592 3300005344 Bacteria 3239
16 Ga0070671_100169974 3300005355 Bacteria 1844
17 Ga0070671_100204209 3300005355 Bacteria 1676
18 Ga0070659_100126037 3300005366 Bacteria 2077
19 Ga0070709_10009330 3300005434 Bacteria 5407
20 Ga0070709_10095595 3300005434 Bacteria 1968
21 Ga0070709_10463710 3300005434 Bacteria 956
22 Ga0070714_100020688 3300005435 Bacteria 5378
23 Ga0070714_100191461 3300005435 Bacteria 1867
24 Ga0070714_100221498 3300005435 Bacteria 1739
25 Ga0070714_100316421 3300005435 Bacteria 1458
26 Ga0070713_100058099 3300005436 Bacteria 3224
27 Ga0070713_100126923 3300005436 Bacteria 2245
28 Ga0070710_10011492 3300005437 Bacteria 4373
29 Ga0070710_10076151 3300005437 Bacteria 1946
30 Ga0070711_100053941 3300005439 Bacteria 2772
31 Ga0070711_100058321 3300005439 Bacteria 2676
32 Ga0070700_100167429 3300005441 Bacteria 1519
33 Ga0070681_10157989 3300005458 Bacteria 2191
34 Ga0070681_10163316 3300005458 Bacteria 2151
35 Ga0070681_10213515 3300005458 Bacteria 1846
36 Ga0070681_10350118 3300005458 Unclassified 1387
37 Ga0070681_10414579 3300005458 Bacteria 1259
38 Ga0070707_100006909 3300005468 Bacteria 10513
39 Ga0070698_100058786 3300005471 Bacteria 3886
40 Ga0070698_100073168 3300005471 Bacteria 3434
41 Ga0070698_100228467 3300005471 Bacteria 1794
42 Ga0070699_100230868 3300005518 Bacteria 1650
43 Ga0070679_100007521 3300005530 Bacteria 10190
44 Ga0070679_100016490 3300005530 Bacteria 7129
45 Ga0070679_100028726 3300005530 Bacteria 5486
46 Ga0070679_100063988 3300005530 Bacteria 3665
47 Ga0070679_100165919 3300005530 Bacteria 2182
48 Ga0070679_100180313 3300005530 Bacteria 2084
49 Ga0070684_100042242 3300005535 Bacteria 3935
50 Ga0070684_100061073 3300005535 Bacteria 3298
51 Ga0070684_100244271 3300005535 Bacteria 1640
52 Ga0070695_100000005 3300005545 Bacteria 97484
53 Ga0068855_100103445 3300005563 Bacteria 3276
54 Ga0068855_100107300 3300005563 Bacteria 3208
55 Ga0068855_100287987 3300005563 Bacteria 1822
56 Ga0068855_100649564 3300005563 Bacteria 1133
57 Ga0068852_100017844 3300005616 Bacteria 5579
58 Ga0068864_100503424 3300005618 Bacteria 1166
59 Ga0068861_100007248 3300005719 Bacteria 7600
60 Ga0081539_10009198 3300005985 Bacteria 8324
61 Ga0070717_10005667 3300006028 Bacteria 9124
62 Ga0070717_10008725 3300006028 Bacteria 7583
63 Ga0070717_10105223 3300006028 Bacteria 2402
64 Ga0070717_10214233 3300006028 Bacteria 1691
65 Ga0075365_10149952 3300006038 Bacteria 1622
66 Ga0070715_10000413 3300006163 Bacteria 10890
67 Ga0070715_10062866 3300006163 Bacteria 1635
68 Ga0070712_100191376 3300006175 Bacteria 1601
69 Ga0075434_100012628 3300006871 Bacteria 8009
70 Ga0075435_100127280 3300007076 Bacteria 2129
71 Ga0105240_10010198 3300009093 Bacteria 13222
72 Ga0105240_10010278 3300009093 Bacteria 13176
73 Ga0105240_10222214 3300009093 Bacteria 2200
74 Ga0105240_10402612 3300009093 Bacteria 1541
75 Ga0105245_10093210 3300009098 Bacteria 2775
76 Ga0105245_10216421 3300009098 Bacteria 1846
77 Ga0105245_10278984 3300009098 Bacteria 1633
78 Ga0105245_10427548 3300009098 Bacteria 1329
79 Ga0105248_10058885 3300009177 Bacteria 4314
80 Ga0105249_10009847 3300009553 Bacteria 8377
81 Ga0105239_10365064 3300010375 Bacteria 1631
82 Ga0157370_10007418 3300013104 Bacteria 11939
83 Ga0157370_10053485 3300013104 Bacteria 3850
84 Ga0157369_10004869 3300013105 Bacteria 15753
85 Ga0157369_10121686 3300013105 Bacteria 2769
86 Ga0157369_10896516 3300013105 Unclassified 909
87 Ga0163162_10065482 3300013306 Bacteria 3681
88 Ga0157372_10016917 3300013307 Bacteria 7829
89 Ga0157372_10464516 3300013307 Unclassified 1475
90 Ga0157372_10542427 3300013307 Bacteria 1356
91 Ga0157372_10903939 3300013307 Bacteria 1024
92 Ga0182008_10032857 3300014497 Bacteria 2605
93 Ga0182008_10053142 3300014497 Bacteria 2006
94 Ga0182008_10078443 3300014497 Bacteria 1625
95 Ga0157379_10405604 3300014968 Bacteria 1254
96 Ga0182006_1030401 3300015261 Bacteria 2183
97 Ga0206356_11336611 3300020070 Bacteria 3943
98 Ga0206356_11795027 3300020070 Unclassified 1625
99 Ga0206354_10142278 3300020081 Bacteria 5542
100 Ga0206354_10295171 3300020081 Bacteria 1424
101 Ga0206354_11330240 3300020081 Unclassified 1524
102 Ga0206353_10664370 3300020082 Bacteria 5880
103 Ga0206353_10780585 3300020082 Bacteria 2762
104 Ga0207692_10032109 3300025898 Bacteria 2520
105 Ga0207692_10080686 3300025898 Bacteria 1739
106 Ga0207692_10227821 3300025898 Bacteria 1108
107 Ga0207699_10006130 3300025906 Bacteria 5798
108 Ga0207705_10129329 3300025909 Bacteria 1878
109 Ga0207705_10153172 3300025909 Bacteria 1728
110 Ga0207707_10018384 3300025912 Bacteria 6093
111 Ga0207707_10061795 3300025912 Bacteria 3260
112 Ga0207707_10081874 3300025912 Bacteria 2818
113 Ga0207707_10130365 3300025912 Bacteria 2199
114 Ga0207707_10161842 3300025912 Bacteria 1957
115 Ga0207707_10258558 3300025912 Unclassified 1511
116 Ga0207695_10074389 3300025913 Bacteria 3459
117 Ga0207695_10097553 3300025913 Bacteria 2940
118 Ga0207695_10475942 3300025913 Bacteria 1131
119 Ga0207693_10000954 3300025915 Bacteria 25940
120 Ga0207693_10002212 3300025915 Bacteria 16954
121 Ga0207693_10035289 3300025915 Bacteria 3943
122 Ga0207693_10218265 3300025915 Bacteria 1498
123 Ga0207663_10007232 3300025916 Bacteria 5745
124 Ga0207663_10310454 3300025916 Bacteria 1182
125 Ga0207660_10022623 3300025917 Bacteria 4236
126 Ga0207660_10083203 3300025917 Bacteria 2356
127 Ga0207657_10002919 3300025919 Bacteria 18353
128 Ga0207657_10003832 3300025919 Bacteria 15975
129 Ga0207657_10017609 3300025919 Bacteria 6845
130 Ga0207657_10039166 3300025919 Bacteria 4214
131 Ga0207649_10252370 3300025920 Unclassified 1271
132 Ga0207652_10004470 3300025921 Bacteria 11386
133 Ga0207652_10037262 3300025921 Bacteria 4116
134 Ga0207652_10076420 3300025921 Bacteria 2921
135 Ga0207652_10144654 3300025921 Bacteria 2127
136 Ga0207646_10002790 3300025922 Bacteria 20372
137 Ga0207687_10031683 3300025927 Bacteria 3575
138 Ga0207687_10100865 3300025927 Bacteria 2124
139 Ga0207687_10211102 3300025927 Bacteria 1523
140 Ga0207700_10059798 3300025928 Bacteria 2883
141 Ga0207664_10005242 3300025929 Bacteria 8846
142 Ga0207664_10015703 3300025929 Bacteria 5505
143 Ga0207664_10017712 3300025929 Bacteria 5229
144 Ga0207664_10020959 3300025929 Bacteria 4851
145 Ga0207664_10030123 3300025929 Bacteria 4142
146 Ga0207664_10052115 3300025929 Bacteria 3235
147 Ga0207664_10194903 3300025929 Bacteria 1746
148 Ga0207664_10389403 3300025929 Bacteria 1238
149 Ga0207690_10084125 3300025932 Bacteria 2229
150 Ga0207706_10041735 3300025933 Bacteria 4066
151 Ga0207709_10314433 3300025935 Bacteria 1170
152 Ga0207665_10001088 3300025939 Bacteria 18283
153 Ga0207667_10132961 3300025949 Bacteria 2562
154 Ga0207667_10410362 3300025949 Bacteria 1379
155 Ga0207712_10134218 3300025961 Bacteria 1891
156 Ga0207639_10166834 3300026041 Bacteria 1861
157 Ga0207702_10008734 3300026078 Bacteria 8544
158 Ga0207702_10070586 3300026078 Bacteria 3005
159 Ga0207675_100006629 3300026118 Bacteria 10950
160 Ga0207683_10088529 3300026121 Bacteria 2755
161 Ga0268264_10170202 3300028381 Bacteria 1969
162 Ga0265337_1025091 3300028556 Bacteria 1817
163 Ga0265326_10007745 3300028558 Bacteria 3276
164 Ga0265319_1002021 3300028563 Bacteria 11416
165 Ga0265319_1006740 3300028563 Bacteria 5272
166 Ga0265334_10003017 3300028573 Bacteria 7688
167 Ga0265334_10012600 3300028573 Bacteria 3551
168 Ga0265334_10030399 3300028573 Bacteria 2162
169 Ga0265318_10000834 3300028577 Bacteria 20283
170 Ga0265318_10031712 3300028577 Bacteria 2048
171 Ga0265318_10062795 3300028577 Bacteria 1382
172 Ga0265336_10016157 3300028666 Bacteria 2443
173 Ga0265336_10016558 3300028666 Bacteria 2411
174 Ga0265338_10001061 3300028800 Bacteria 45726
175 Ga0265338_10002640 3300028800 Bacteria 26412
176 Ga0265338_10007258 3300028800 Bacteria 13833
177 Ga0265338_10009094 3300028800 Bacteria 11942
178 Ga0265338_10012741 3300028800 Bacteria 9565
179 Ga0265338_10018267 3300028800 Bacteria 7512
180 Ga0265338_10077820 3300028800 Bacteria 2801
181 Ga0265338_10138605 3300028800 Unclassified 1908
182 Ga0265338_10294606 3300028800 Bacteria 1181
183 Ga0265324_10021675 3300029957 Bacteria 2302
184 Ga0265330_10002992 3300031235 Bacteria 8987
185 Ga0265330_10062080 3300031235 Bacteria 1625
186 Ga0265332_10092633 3300031238 Bacteria 1277
187 Ga0265325_10002143 3300031241 Bacteria 13467
188 Ga0265329_10003147 3300031242 Bacteria 7265
189 Ga0265329_10023927 3300031242 Bacteria 2030
190 Ga0265340_10003429 3300031247 Bacteria 8951
191 Ga0265339_10003289 3300031249 Bacteria 11317
192 Ga0265339_10005065 3300031249 Bacteria 8848
193 Ga0265331_10002110 3300031250 Bacteria 13706
194 Ga0265327_10009412 3300031251 Bacteria 7052
195 Ga0265327_10012826 3300031251 Bacteria 5618
196 Ga0265316_10053204 3300031344 Bacteria 3173
197 Ga0265316_10112016 3300031344 Bacteria 2066
198 Ga0265313_10005925 3300031595 Bacteria 8845
199 Ga0265313_10085849 3300031595 Unclassified 1421
200 Ga0265314_10014350 3300031711 Bacteria 6346
201 Ga0265314_10016009 3300031711 Bacteria 5936
202 Ga0265314_10045679 3300031711 Bacteria 3094
203 Ga0265342_10006014 3300031712 Bacteria 9119
204 Ga0265342_10032457 3300031712 Bacteria 3220
205 Ga0265342_10038924 3300031712 Bacteria 2893
206 Ga0373945_0011082 3300035116 Bacteria 2975
207 Ga0373954_0125356 3300035118 Unclassified 1248
208 Ga0373943_0000443 3300035170 Bacteria 17555
209 Ga0373955_0179458 3300035172 Bacteria 1256
210 Ga0373962_0033519 3300035242 Bacteria 1418
211 Ga0373931_0176878 3300035691 Unclassified 1261
212 Ga0373935_0130843 3300035692 Bacteria 1686
213 Ga0373935_0382075 3300035692 Bacteria 1009
214 Ga0373947_0007024 3300035725 Bacteria 6524
215 Ga0373937_0003482 3300036401 Bacteria 13232
216 Ga0373937_0073536 3300036401 Bacteria 3153
217 Ga0373925_0000484 3300037068 Bacteria 39880
218 Ga0395898_0060665 3300037466 Bacteria 3675
219 Ga0395898_0690267 3300037466 Bacteria 963
220 Ga0395901_0044240 3300038443 Bacteria 4618
221 Ga0395901_0076604 3300038443 Bacteria 3490
222 Ga0395901_0168722 3300038443 Bacteria 2297
223 Ga0436360_0737194 3300039438 Bacteria 2918
224 Ga0466969_0001587 3300044656 Bacteria 12160
225 Ga0466969_0007204 3300044656 Bacteria 5915
226 Ga0466972_0022588 3300044658 Bacteria 3131
227 Ga0466965_0042725 3300044683 Bacteria 2237
228 Ga0466966_0005740 3300044684 Bacteria 8169
229 Ga0466966_0010826 3300044684 Bacteria 6060
230 Ga0466966_0030508 3300044684 Bacteria 3500
231 Ga0466961_0001268 3300044693 Bacteria 15583
232 Ga0466961_0003717 3300044693 Bacteria 9527
233 Ga0466961_0004913 3300044693 Bacteria 8407
234 Ga0466961_0080852 3300044693 Bacteria 2057
235 Ga0466961_0190061 3300044693 Bacteria 1273
236 Ga0466961_0272829 3300044693 Unclassified 1036
237 Ga0466963_0000045 3300044694 Bacteria 40813
238 Ga0466963_0000742 3300044694 Bacteria 16070
239 Ga0466963_0001615 3300044694 Bacteria 12253
240 Ga0466963_0003162 3300044694 Bacteria 9350
241 Ga0466963_0003847 3300044694 Bacteria 8658
242 Ga0466963_0005914 3300044694 Bacteria 7202
243 Ga0466963_0007938 3300044694 Bacteria 6354
244 Ga0466963_0010825 3300044694 Bacteria 5537
245 Ga0466963_0011035 3300044694 Bacteria 5493
246 Ga0466963_0021418 3300044694 Bacteria 4078
247 Ga0466963_0022257 3300044694 Bacteria 4012
248 Ga0466963_0025650 3300044694 Bacteria 3761
249 Ga0466963_0029393 3300044694 Bacteria 3538
250 Ga0466963_0038512 3300044694 Bacteria 3126
251 Ga0466963_0134244 3300044694 Bacteria 1711
252 Ga0466963_0143724 3300044694 Bacteria 1654
253 Ga0466963_0157940 3300044694 Bacteria 1577
254 Ga0466963_0265394 3300044694 Bacteria 1206
255 Ga0466964_0002707 3300044706 Bacteria 6353
256 Ga0466964_0003159 3300044706 Bacteria 5984
257 Ga0466964_0010448 3300044706 Bacteria 3502
258 Ga0466964_0027531 3300044706 Bacteria 2233
259 Ga0466964_0036047 3300044706 Bacteria 1981
260 Ga0466964_0056840 3300044706 Bacteria 1618
261 Ga0466964_0120692 3300044706 Unclassified 1181
262 Ga0466971_0001365 3300044719 Bacteria 10235
263 Ga0466971_0003894 3300044719 Bacteria 6398
264 Ga0466971_0058857 3300044719 Bacteria 1735
265 Ga0466971_0079962 3300044719 Bacteria 1490
266 Ga0466971_0107695 3300044719 Unclassified 1284
267 Ga0466971_0154606 3300044719 Unclassified 1072
268 Ga0466968_0004117 3300044735 Bacteria 5416
269 Ga0466968_0008769 3300044735 Bacteria 3878
270 Ga0466968_0024549 3300044735 Bacteria 2464
271 Ga0466968_0025123 3300044735 Bacteria 2439
272 Ga0466968_0027410 3300044735 Bacteria 2345
273 Ga0466968_0042299 3300044735 Bacteria 1926
274 Ga0466970_0017329 3300044765 Bacteria 3722
275 Ga0466970_0162578 3300044765 Bacteria 1235
276 Ga0466957_0002904 3300044842 Bacteria 9287
277 Ga0466957_0006323 3300044842 Bacteria 6679
278 Ga0466957_0025165 3300044842 Bacteria 3527
279 Ga0466957_0040508 3300044842 Bacteria 2814
280 Ga0466957_0071608 3300044842 Bacteria 2144
281 Ga0466957_0089840 3300044842 Unclassified 1923
282 Ga0466957_0117874 3300044842 Bacteria 1690
283 Ga0466959_0002525 3300045049 Bacteria 11734
284 Ga0466959_0016111 3300045049 Bacteria 5455
285 Ga0466959_0030041 3300045049 Bacteria 4024
286 Ga0451576_0030926 3300045051 Bacteria 5712
287 Ga0466958_0002234 3300045836 Bacteria 9646
288 Ga0466958_0002306 3300045836 Bacteria 9520
289 Ga0466958_0006062 3300045836 Bacteria 6553
290 Ga0466958_0010006 3300045836 Bacteria 5297
291 Ga0466958_0011762 3300045836 Bacteria 4941
292 Ga0466958_0027901 3300045836 Bacteria 3343
293 Ga0466958_0039654 3300045836 Bacteria 2830
294 Ga0466958_0128100 3300045836 Bacteria 1592
295 Ga0466958_0146645 3300045836 Bacteria 1487
296 Ga0466958_0171156 3300045836 Bacteria 1375
297 Ga0466967_0000248 3300045976 Bacteria 23755
298 Ga0466967_0001981 3300045976 Bacteria 12432
299 Ga0466967_0005161 3300045976 Bacteria 8985
300 Ga0466967_0005994 3300045976 Bacteria 8536
301 Ga0466967_0007978 3300045976 Bacteria 7704
302 Ga0466967_0009042 3300045976 Bacteria 7363
303 Ga0466967_0009396 3300045976 Bacteria 7252
304 Ga0466967_0016327 3300045976 Bacteria 5852
305 Ga0466967_0019504 3300045976 Bacteria 5453
306 Ga0466967_0035433 3300045976 Bacteria 4248
307 Ga0466967_0041317 3300045976 Bacteria 3975
308 Ga0466967_0055174 3300045976 Bacteria 3500
309 Ga0466967_0060418 3300045976 Bacteria 3358
310 Ga0466967_0067342 3300045976 Bacteria 3193
311 Ga0466967_0078305 3300045976 Bacteria 2977
312 Ga0466967_0079039 3300045976 Bacteria 2964
313 Ga0466967_0080966 3300045976 Bacteria 2932
314 Ga0466967_0098162 3300045976 Bacteria 2674
315 Ga0466967_0101533 3300045976 Bacteria 2629
316 Ga0466967_0131297 3300045976 Bacteria 2325
317 Ga0466967_0139661 3300045976 Bacteria 2256
318 Ga0466967_0145661 3300045976 Bacteria 2209
319 Ga0466967_0191712 3300045976 Bacteria 1932
320 Ga0466967_0204591 3300045976 Bacteria 1871
321 Ga0466967_0215948 3300045976 Bacteria 1820
322 Ga0466967_0267726 3300045976 Bacteria 1636
323 Ga0466967_0274900 3300045976 Bacteria 1615
324 Ga0466967_0277704 3300045976 Bacteria 1606
325 Ga0466967_0385234 3300045976 Bacteria 1362
326 Ga0466967_0451451 3300045976 Bacteria 1256
327 Ga0466967_0538901 3300045976 Unclassified 1148
328 Ga0466967_0635767 3300045976 Unclassified 1055
329 Ga0495592_0000124 3300046454 Bacteria 68396
330 Ga0495592_0037333 3300046454 Bacteria 3658
331 Ga0495603_0071056 3300046455 Bacteria 2046
332 Ga0495629_0024867 3300046459 Bacteria 4261
333 Ga0495629_0030519 3300046459 Bacteria 3820
334 Ga0495629_0039310 3300046459 Bacteria 3330
335 Ga0495629_0188035 3300046459 Bacteria 1430
336 Ga0495641_0015485 3300046461 Bacteria 4067
337 Ga0495651_0000310 3300046462 Bacteria 37941
338 Ga0495651_0020794 3300046462 Bacteria 5094
339 Ga0495651_0080228 3300046462 Bacteria 2465
340 Ga0495653_0000599 3300046463 Bacteria 27664
341 Ga0495653_0057038 3300046463 Bacteria 2975
342 Ga0495653_0069673 3300046463 Bacteria 2634
343 Ga0495653_0128473 3300046463 Bacteria 1797
344 Ga0495653_0177577 3300046463 Bacteria 1464
345 Ga0495653_0240346 3300046463 Bacteria 1207
346 Ga0495580_0026161 3300046472 Bacteria 4257
347 Ga0495582_0006468 3300046473 Bacteria 6503
348 Ga0495582_0051633 3300046473 Bacteria 2267
349 Ga0495605_0103004 3300046474 Bacteria 1310
350 Ga0495639_0000425 3300046475 Bacteria 20170
351 Ga0495662_0002534 3300046476 Bacteria 9218
352 Ga0495664_0026334 3300046477 Bacteria 3386
353 Ga0495664_0086107 3300046477 Bacteria 1887
354 Ga0495584_0013031 3300046491 Bacteria 4243
355 Ga0495608_0013823 3300046511 Bacteria 5601
356 Ga0495608_0031891 3300046511 Bacteria 3561
357 Ga0495608_0033672 3300046511 Bacteria 3460
358 Ga0495608_0093833 3300046511 Unclassified 1939
359 Ga0495608_0103216 3300046511 Bacteria 1837
360 Ga0495618_0002992 3300046514 Bacteria 10684
361 Ga0495618_0018028 3300046514 Bacteria 4332
362 Ga0495618_0085934 3300046514 Bacteria 2011
363 Ga0495628_0000436 3300046516 Bacteria 37941
364 Ga0495628_0022123 3300046516 Bacteria 5226
365 Ga0495630_0006597 3300046517 Bacteria 8270
366 Ga0495630_0063359 3300046517 Bacteria 2777
367 Ga0495630_0088741 3300046517 Bacteria 2335
368 Ga0495630_0100047 3300046517 Bacteria 2193
369 Ga0495630_0141506 3300046517 Unclassified 1829
370 Ga0495644_0046046 3300046523 Bacteria 1639
371 Ga0495666_0003581 3300046526 Bacteria 7854
372 Ga0495652_0000050 3300046529 Bacteria 120480
373 Ga0495652_0059970 3300046529 Bacteria 3217
374 Ga0495652_0087919 3300046529 Bacteria 2548
375 Ga0495665_0019545 3300046531 Bacteria 3642
376 Ga0495665_0288658 3300046531 Bacteria 841
377 Ga0495640_0039931 3300046533 Bacteria 3289
378 Ga0495640_0073266 3300046533 Bacteria 2293
379 Ga0495640_0091962 3300046533 Bacteria 2001
380 Ga0495586_0014025 3300046535 Bacteria 4254
381 Ga0495587_0000084 3300046536 Bacteria 72926
382 Ga0495645_0000067 3300046543 Bacteria 73037
383 Ga0495645_0010570 3300046543 Bacteria 6478
384 Ga0495645_0040457 3300046543 Bacteria 3401
385 Ga0495645_0230273 3300046543 Bacteria 1242
386 Ga0495667_0042826 3300046559 Bacteria 3001
387 Ga0495667_0094060 3300046559 Bacteria 1941
388 Ga0495667_0111016 3300046559 Bacteria 1771
389 Ga0495667_0202788 3300046559 Bacteria 1269
390 Ga0495634_0033825 3300046642 Bacteria 3510
391 Ga0495634_0037721 3300046642 Bacteria 3300
392 Ga0495634_0042657 3300046642 Bacteria 3076
393 Ga0495634_0123711 3300046642 Bacteria 1655
394 Ga0495611_0013748 3300046648 Bacteria 3450
395 Ga0495635_0010430 3300046663 Bacteria 6500
396 Ga0495635_0029284 3300046663 Bacteria 3828
397 Ga0495635_0036618 3300046663 Bacteria 3400
398 Ga0495635_0122160 3300046663 Bacteria 1776
399 Ga0495635_0152625 3300046663 Unclassified 1572
400 Ga0495635_0203299 3300046663 Bacteria 1343
401 Ga0495657_0011175 3300046675 Bacteria 6725
402 Ga0495657_0019359 3300046675 Bacteria 4911
403 Ga0495657_0063951 3300046675 Bacteria 2425
404 Ga0495599_0000009 3300046678 Bacteria 217299
405 Ga0495599_0061928 3300046678 Bacteria 2337
406 Ga0495599_0086852 3300046678 Bacteria 1953
407 Ga0495623_0000264 3300046679 Bacteria 33990
408 Ga0495646_0009045 3300046680 Bacteria 6315
409 Ga0495647_0010335 3300046681 Bacteria 3176
410 Ga0495647_0036914 3300046681 Unclassified 1841
411 Ga0495658_0004842 3300046683 Bacteria 6604
412 Ga0495658_0084787 3300046683 Bacteria 1866
413 Ga0495613_0040100 3300046689 Bacteria 3470
414 Ga0495613_0243999 3300046689 Bacteria 1255
415 Ga0495624_0001713 3300046690 Bacteria 16756
416 Ga0495624_0033054 3300046690 Bacteria 3351
417 Ga0495589_0070784 3300046794 Bacteria 1705
418 Ga0495600_0101987 3300046809 Bacteria 1870
419 Ga0495581_0055001 3300047315 Bacteria 2297
420 Ga0495604_0000608 3300047317 Bacteria 30795
421 Ga0495674_0143634 3300047319 Bacteria 2004
422 Ga0495676_0010465 3300047321 Bacteria 8411
423 Ga0495676_0125333 3300047321 Unclassified 1862
424 Ga0495676_0142351 3300047321 Bacteria 1717
425 Ga0495676_0237222 3300047321 Bacteria 1250
426 Ga0495680_0008229 3300047322 Bacteria 9500
427 Ga0495680_0014247 3300047322 Bacteria 6895
428 Ga0495680_0020471 3300047322 Bacteria 5566
429 Ga0495680_0062469 3300047322 Bacteria 2863
430 Ga0495680_0087132 3300047322 Bacteria 2349
431 Ga0495680_0142954 3300047322 Bacteria 1749
432 Ga0495680_0198110 3300047322 Bacteria 1442
433 Ga0495675_0000363 3300047444 Bacteria 31622
434 Ga0495675_0192824 3300047444 Bacteria 1243
435 Ga0495684_0027169 3300047471 Bacteria 4393
436 Ga0495684_0042484 3300047471 Bacteria 3482
437 Ga0495684_0058092 3300047471 Bacteria 2947
438 Ga0495593_0018722 3300047673 Bacteria 3888
439 Ga0495602_0000234 3300048088 Bacteria 51947
440 Ga0495602_0171150 3300048088 Bacteria 1686
441 Ga0495602_0235561 3300048088 Bacteria 1372
442 Ga0496100_0025298 3300048903 Bacteria 3630
443 Ga0496100_0071062 3300048903 Bacteria 2323
444 Ga0496101_0004729 3300048904 Bacteria 8628
445 Ga0496101_0024365 3300048904 Bacteria 4188
446 Ga0496101_0194915 3300048904 Bacteria 1565
447 Ga0496101_0366832 3300048904 Bacteria 1132
448 Ga0496102_0007384 3300048905 Bacteria 9388
449 Ga0496102_0014701 3300048905 Bacteria 6804
450 Ga0496102_0083361 3300048905 Bacteria 2950
451 Ga0496104_0004243 3300048907 Bacteria 12449
452 Ga0496104_0004725 3300048907 Bacteria 11856
453 Ga0496104_0032311 3300048907 Bacteria 4870
454 Ga0496104_0100478 3300048907 Unclassified 2769
455 Ga0496104_0180244 3300048907 Bacteria 2023
456 Ga0496104_0293383 3300048907 Bacteria 1539
457 Ga0496104_0458001 3300048907 Bacteria 1187
458 Ga0496105_0000921 3300048908 Bacteria 20079
459 Ga0496105_0014440 3300048908 Bacteria 6287
460 Ga0496105_0026253 3300048908 Bacteria 4750
461 Ga0496105_0134745 3300048908 Bacteria 2035
462 Ga0496105_0144912 3300048908 Bacteria 1953
463 Ga0496105_0315064 3300048908 Bacteria 1255
464 Ga0496106_0028830 3300048909 Bacteria 4137
465 Ga0496106_0412728 3300048909 Bacteria 1085
466 Ga0496106_0436679 3300048909 Bacteria 1052
467 Ga0496107_0005357 3300048910 Bacteria 8777
468 Ga0496107_0009417 3300048910 Bacteria 6777
469 Ga0496107_0037844 3300048910 Bacteria 3463
470 Ga0496107_0137402 3300048910 Bacteria 1806
471 Ga0496107_0181310 3300048910 Bacteria 1564
472 Ga0496108_0001117 3300048911 Bacteria 21001
473 Ga0496108_0003454 3300048911 Bacteria 12673
474 Ga0496108_0008152 3300048911 Bacteria 8496
475 Ga0496108_0256254 3300048911 Unclassified 1522
476 Ga0496109_0001252 3300048912 Bacteria 21083
477 Ga0496109_0017478 3300048912 Bacteria 6289
478 Ga0496109_0032028 3300048912 Bacteria 4723
479 Ga0496109_0044918 3300048912 Bacteria 4009
480 Ga0496110_0002369 3300048913 Bacteria 14114
481 Ga0496110_0007041 3300048913 Bacteria 8949
482 Ga0496110_0053859 3300048913 Bacteria 3538
483 Ga0496110_0123517 3300048913 Bacteria 2334
484 Ga0496111_0004830 3300048914 Bacteria 8547
485 Ga0496111_0009089 3300048914 Bacteria 6614
486 Ga0496111_0044491 3300048914 Bacteria 3191
487 Ga0496111_0055089 3300048914 Bacteria 2876
488 Ga0496111_0137375 3300048914 Bacteria 1811
489 Ga0496112_0020070 3300048915 Bacteria 6327
490 Ga0496112_0029197 3300048915 Bacteria 5332
491 Ga0496112_0033345 3300048915 Bacteria 5005
492 Ga0496112_0158722 3300048915 Bacteria 2228
493 Ga0496112_0191670 3300048915 Bacteria 2006
494 Ga0496113_0008766 3300048916 Bacteria 6605
495 Ga0496113_0091318 3300048916 Bacteria 2347
496 Ga0496113_0165005 3300048916 Unclassified 1752
497 Ga0496114_0010793 3300048917 Bacteria 7271
498 Ga0496114_0015246 3300048917 Bacteria 6178
499 Ga0496114_0049946 3300048917 Bacteria 3481
500 Ga0496114_0052284 3300048917 Bacteria 3403
501 Ga0496114_0064145 3300048917 Bacteria 3076
502 Ga0496115_0025029 3300048918 Bacteria 4643
503 Ga0496115_0030409 3300048918 Bacteria 4248
504 Ga0496115_0047687 3300048918 Bacteria 3426
505 Ga0496115_0051706 3300048918 Bacteria 3294
506 Ga0496115_0197191 3300048918 Bacteria 1664
507 Ga0496115_0312951 3300048918 Bacteria 1285
508 Ga0501034_0014370 3300049571 Bacteria 8158
509 Ga0501067_0007272 3300049583 Bacteria 6147
510 Ga0501067_0018551 3300049583 Bacteria 3853
511 Ga0501067_0028496 3300049583 Bacteria 3094
512 Ga0501067_0089202 3300049583 Bacteria 1711
513 Ga0501068_0015932 3300049584 Bacteria 4329
514 Ga0501069_0011649 3300049585 Bacteria 4662
515 Ga0501069_0022556 3300049585 Bacteria 3426
516 Ga0501069_0059939 3300049585 Bacteria 2124
517 Ga0501069_0287186 3300049585 Bacteria 963
518 Ga0501070_0029335 3300049586 Bacteria 4614
519 Ga0501070_0217248 3300049586 Bacteria 1568
520 Ga0501072_0007793 3300049588 Bacteria 8135
521 Ga0501073_0051060 3300049589 Bacteria 2897
522 Ga0501074_0015975 3300049590 Bacteria 5458
523 Ga0501079_0013006 3300049741 Bacteria 6349
524 Ga0501080_0006430 3300049742 Bacteria 10544
525 Ga0501083_0025559 3300049744 Bacteria 4088
526 nmdc:mga0yw44_85354_c1 3300050492 Bacteria 1986
527 nmdc:mga08y16_229515_c1 3300050511 Bacteria 1920
528 nmdc:mga0n895_13219_c1 3300050512 Bacteria 7438
529 nmdc:mga0rr50_226870_c1 3300050513 Bacteria 1544
530 nmdc:mga08x19_90652_c1 3300050514 Bacteria 2017
531 nmdc:mga0a205_150251_c1 3300050515 Bacteria 2229
532 Ga0495601_0001954 3300053077 Bacteria 11524
533 Ga0495601_0056504 3300053077 Bacteria 2485
534 Ga0495601_0142166 3300053077 Bacteria 1565
535 Ga0495612_0014147 3300053078 Bacteria 3211
536 Ga0495612_0070892 3300053078 Bacteria 1453
537 Ga0495595_0010972 3300053084 Bacteria 3781
538 Ga0495595_0016155 3300053084 Bacteria 3188
539 Ga0495619_0003196 3300053085 Bacteria 10611
540 Ga0495619_0049518 3300053085 Bacteria 2771
541 Ga0495619_0077537 3300053085 Bacteria 2232
542 Ga0495619_0133941 3300053085 Bacteria 1704
543 Ga0501084_0043896 3300054114 Bacteria 3741
544 Ga0501082_0118250 3300060353 Bacteria 2296
545 Ga0466962_0002955 3300061719 Bacteria 8111
546 Ga0466962_0003936 3300061719 Bacteria 7107
547 Ga0466962_0006772 3300061719 Bacteria 5497
548 Ga0466962_0020794 3300061719 Bacteria 3153
549 Ga0466962_0092683 3300061719 Bacteria 1448
550 Ga0466962_0116410 3300061719 Bacteria 1288
551 Ga0530510_0083284 3300061734 Unclassified 2329
552 Ga0496112_0000390
553 Ga0070658_10006196
554 Ga0070658_10032747
555 Ga0070658_10074166
556 Ga0070658_10097933
557 Ga0070683_100060944
558 Ga0070683_100114373
559 Ga0070680_100059844
560 Ga0070680_100155680
561 Ga0070682_100046118
562 Ga0070660_100095619
563 Ga0070660_100218508
564 Ga0070660_100364317
565 Ga0070691_10017883
566 Ga0070661_100044592
567 Ga0070671_100169974
568 Ga0070671_100204209
569 Ga0070659_100126037
570 Ga0070709_10009330
571 Ga0070709_10095595
572 Ga0070709_10463710
573 Ga0070714_100020688
574 Ga0070714_100191461
575 Ga0070714_100221498
576 Ga0070714_100316421
577 Ga0070713_100058099
578 Ga0070713_100126923
579 Ga0070710_10011492
580 Ga0070710_10076151
581 Ga0070711_100053941
582 Ga0070711_100058321
583 Ga0070700_100167429
584 Ga0070681_10157989
585 Ga0070681_10163316
586 Ga0070681_10213515
587 Ga0070681_10350118
588 Ga0070681_10414579
589 Ga0070707_100006909
590 Ga0070698_100058786
591 Ga0070698_100073168
592 Ga0070698_100228467
593 Ga0070699_100230868
594 Ga0070679_100007521
595 Ga0070679_100016490
596 Ga0070679_100028726
597 Ga0070679_100063988
598 Ga0070679_100165919
599 Ga0070679_100180313
600 Ga0070684_100042242
601 Ga0070684_100061073
602 Ga0070684_100244271
603 Ga0070695_100000005
604 Ga0068855_100103445
605 Ga0068855_100107300
606 Ga0068855_100287987
607 Ga0068855_100649564
608 Ga0068852_100017844
609 Ga0068864_100503424
610 Ga0068861_100007248
611 Ga0081539_10009198
612 Ga0070717_10005667
613 Ga0070717_10008725
614 Ga0070717_10105223
615 Ga0070717_10214233
616 Ga0075365_10149952
617 Ga0070715_10000413
618 Ga0070715_10062866
619 Ga0070712_100191376
620 Ga0075434_100012628
621 Ga0075435_100127280
622 Ga0105240_10010198
623 Ga0105240_10010278
624 Ga0105240_10222214
625 Ga0105240_10402612
626 Ga0105245_10093210
627 Ga0105245_10216421
628 Ga0105245_10278984
629 Ga0105245_10427548
630 Ga0105248_10058885
631 Ga0105249_10009847
632 Ga0105239_10365064
633 Ga0157370_10007418
634 Ga0157370_10053485
635 Ga0157369_10004869
636 Ga0157369_10121686
637 Ga0157369_10896516
638 Ga0163162_10065482
639 Ga0157372_10016917
640 Ga0157372_10464516
641 Ga0157372_10542427
642 Ga0157372_10903939
643 Ga0182008_10032857
644 Ga0182008_10053142
645 Ga0182008_10078443
646 Ga0157379_10405604
647 Ga0182006_1030401
648 Ga0206356_11336611
649 Ga0206356_11795027
650 Ga0206354_10142278
651 Ga0206354_10295171
652 Ga0206354_11330240
653 Ga0206353_10664370
654 Ga0206353_10780585
655 Ga0207692_10032109
656 Ga0207692_10080686
657 Ga0207692_10227821
658 Ga0207699_10006130
659 Ga0207705_10129329
660 Ga0207705_10153172
661 Ga0207707_10018384
662 Ga0207707_10061795
663 Ga0207707_10081874
664 Ga0207707_10130365
665 Ga0207707_10161842
666 Ga0207707_10258558
667 Ga0207695_10074389
668 Ga0207695_10097553
669 Ga0207695_10475942
670 Ga0207693_10000954
671 Ga0207693_10002212
672 Ga0207693_10035289
673 Ga0207693_10218265
674 Ga0207663_10007232
675 Ga0207663_10310454
676 Ga0207660_10022623
677 Ga0207660_10083203
678 Ga0207657_10002919
679 Ga0207657_10003832
680 Ga0207657_10017609
681 Ga0207657_10039166
682 Ga0207649_10252370
683 Ga0207652_10004470
684 Ga0207652_10037262
685 Ga0207652_10076420
686 Ga0207652_10144654
687 Ga0207646_10002790
688 Ga0207687_10031683
689 Ga0207687_10100865
690 Ga0207687_10211102
691 Ga0207700_10059798
692 Ga0207664_10005242
693 Ga0207664_10015703
694 Ga0207664_10017712
695 Ga0207664_10020959
696 Ga0207664_10030123
697 Ga0207664_10052115
698 Ga0207664_10194903
699 Ga0207664_10389403
700 Ga0207690_10084125
701 Ga0207706_10041735
702 Ga0207709_10314433
703 Ga0207665_10001088
704 Ga0207667_10132961
705 Ga0207667_10410362
706 Ga0207712_10134218
707 Ga0207639_10166834
708 Ga0207702_10008734
709 Ga0207702_10070586
710 Ga0207675_100006629
711 Ga0207683_10088529
712 Ga0268264_10170202
713 Ga0265337_1025091
714 Ga0265326_10007745
715 Ga0265319_1002021
716 Ga0265319_1006740
717 Ga0265334_10003017
718 Ga0265334_10012600
719 Ga0265334_10030399
720 Ga0265318_10000834
721 Ga0265318_10031712
722 Ga0265318_10062795
723 Ga0265336_10016157
724 Ga0265336_10016558
725 Ga0265338_10001061
726 Ga0265338_10002640
727 Ga0265338_10007258
728 Ga0265338_10009094
729 Ga0265338_10012741
730 Ga0265338_10018267
731 Ga0265338_10077820
732 Ga0265338_10138605
733 Ga0265338_10294606
734 Ga0265324_10021675
735 Ga0265330_10002992
736 Ga0265330_10062080
737 Ga0265332_10092633
738 Ga0265325_10002143
739 Ga0265329_10003147
740 Ga0265329_10023927
741 Ga0265340_10003429
742 Ga0265339_10003289
743 Ga0265339_10005065
744 Ga0265331_10002110
745 Ga0265327_10009412
746 Ga0265327_10012826
747 Ga0265316_10053204
748 Ga0265316_10112016
749 Ga0265313_10005925
750 Ga0265313_10085849
751 Ga0265314_10014350
752 Ga0265314_10016009
753 Ga0265314_10045679
754 Ga0265342_10006014
755 Ga0265342_10032457
756 Ga0265342_10038924
757 Ga0373945_0011082
758 Ga0373954_0125356
759 Ga0373943_0000443
760 Ga0373955_0179458
761 Ga0373962_0033519
762 Ga0373931_0176878
763 Ga0373935_0130843
764 Ga0373935_0382075
765 Ga0373947_0007024
766 Ga0373937_0003482
767 Ga0373937_0073536
768 Ga0373925_0000484
769 Ga0395898_0060665
770 Ga0395898_0690267
771 Ga0395901_0044240
772 Ga0395901_0076604
773 Ga0395901_0168722
774 Ga0436360_0737194
775 Ga0466969_0001587
776 Ga0466969_0007204
777 Ga0466972_0022588
778 Ga0466965_0042725
779 Ga0466966_0005740
780 Ga0466966_0010826
781 Ga0466966_0030508
782 Ga0466961_0001268
783 Ga0466961_0003717
784 Ga0466961_0004913
785 Ga0466961_0080852
786 Ga0466961_0190061
787 Ga0466961_0272829
788 Ga0466963_0000045
789 Ga0466963_0000742
790 Ga0466963_0001615
791 Ga0466963_0003162
792 Ga0466963_0003847
793 Ga0466963_0005914
794 Ga0466963_0007938
795 Ga0466963_0010825
796 Ga0466963_0011035
797 Ga0466963_0021418
798 Ga0466963_0022257
799 Ga0466963_0025650
800 Ga0466963_0029393
801 Ga0466963_0038512
802 Ga0466963_0134244
803 Ga0466963_0143724
804 Ga0466963_0157940
805 Ga0466963_0265394
806 Ga0466964_0002707
807 Ga0466964_0003159
808 Ga0466964_0010448
809 Ga0466964_0027531
810 Ga0466964_0036047
811 Ga0466964_0056840
812 Ga0466964_0120692
813 Ga0466971_0001365
814 Ga0466971_0003894
815 Ga0466971_0058857
816 Ga0466971_0079962
817 Ga0466971_0107695
818 Ga0466971_0154606
819 Ga0466968_0004117
820 Ga0466968_0008769
821 Ga0466968_0024549
822 Ga0466968_0025123
823 Ga0466968_0027410
824 Ga0466968_0042299
825 Ga0466970_0017329
826 Ga0466970_0162578
827 Ga0466957_0002904
828 Ga0466957_0006323
829 Ga0466957_0025165
830 Ga0466957_0040508
831 Ga0466957_0071608
832 Ga0466957_0089840
833 Ga0466957_0117874
834 Ga0466959_0002525
835 Ga0466959_0016111
836 Ga0466959_0030041
837 Ga0451576_0030926
838 Ga0466958_0002234
839 Ga0466958_0002306
840 Ga0466958_0006062
841 Ga0466958_0010006
842 Ga0466958_0011762
843 Ga0466958_0027901
844 Ga0466958_0039654
845 Ga0466958_0128100
846 Ga0466958_0146645
847 Ga0466958_0171156
848 Ga0466967_0000248
849 Ga0466967_0001981
850 Ga0466967_0005161
851 Ga0466967_0005994
852 Ga0466967_0007978
853 Ga0466967_0009042
854 Ga0466967_0009396
855 Ga0466967_0016327
856 Ga0466967_0019504
857 Ga0466967_0035433
858 Ga0466967_0041317
859 Ga0466967_0055174
860 Ga0466967_0060418
861 Ga0466967_0067342
862 Ga0466967_0078305
863 Ga0466967_0079039
864 Ga0466967_0080966
865 Ga0466967_0098162
866 Ga0466967_0101533
867 Ga0466967_0131297
868 Ga0466967_0139661
869 Ga0466967_0145661
870 Ga0466967_0191712
871 Ga0466967_0204591
872 Ga0466967_0215948
873 Ga0466967_0267726
874 Ga0466967_0274900
875 Ga0466967_0277704
876 Ga0466967_0385234
877 Ga0466967_0451451
878 Ga0466967_0538901
879 Ga0466967_0635767
880 Ga0495592_0000124
881 Ga0495592_0037333
882 Ga0495603_0071056
883 Ga0495629_0024867
884 Ga0495629_0030519
885 Ga0495629_0039310
886 Ga0495629_0188035
887 Ga0495641_0015485
888 Ga0495651_0000310
889 Ga0495651_0020794
890 Ga0495651_0080228
891 Ga0495653_0000599
892 Ga0495653_0057038
893 Ga0495653_0069673
894 Ga0495653_0128473
895 Ga0495653_0177577
896 Ga0495653_0240346
897 Ga0495580_0026161
898 Ga0495582_0006468
899 Ga0495582_0051633
900 Ga0495605_0103004
901 Ga0495639_0000425
902 Ga0495662_0002534
903 Ga0495664_0026334
904 Ga0495664_0086107
905 Ga0495584_0013031
906 Ga0495608_0013823
907 Ga0495608_0031891
908 Ga0495608_0033672
909 Ga0495608_0093833
910 Ga0495608_0103216
911 Ga0495618_0002992
912 Ga0495618_0018028
913 Ga0495618_0085934
914 Ga0495628_0000436
915 Ga0495628_0022123
916 Ga0495630_0006597
917 Ga0495630_0063359
918 Ga0495630_0088741
919 Ga0495630_0100047
920 Ga0495630_0141506
921 Ga0495644_0046046
922 Ga0495666_0003581
923 Ga0495652_0000050
924 Ga0495652_0059970
925 Ga0495652_0087919
926 Ga0495665_0019545
927 Ga0495665_0288658
928 Ga0495640_0039931
929 Ga0495640_0073266
930 Ga0495640_0091962
931 Ga0495586_0014025
932 Ga0495587_0000084
933 Ga0495645_0000067
934 Ga0495645_0010570
935 Ga0495645_0040457
936 Ga0495645_0230273
937 Ga0495667_0042826
938 Ga0495667_0094060
939 Ga0495667_0111016
940 Ga0495667_0202788
941 Ga0495634_0033825
942 Ga0495634_0037721
943 Ga0495634_0042657
944 Ga0495634_0123711
945 Ga0495611_0013748
946 Ga0495635_0010430
947 Ga0495635_0029284
948 Ga0495635_0036618
949 Ga0495635_0122160
950 Ga0495635_0152625
951 Ga0495635_0203299
952 Ga0495657_0011175
953 Ga0495657_0019359
954 Ga0495657_0063951
955 Ga0495599_0000009
956 Ga0495599_0061928
957 Ga0495599_0086852
958 Ga0495623_0000264
959 Ga0495646_0009045
960 Ga0495647_0010335
961 Ga0495647_0036914
962 Ga0495658_0004842
963 Ga0495658_0084787
964 Ga0495613_0040100
965 Ga0495613_0243999
966 Ga0495624_0001713
967 Ga0495624_0033054
968 Ga0495589_0070784
969 Ga0495600_0101987
970 Ga0495581_0055001
971 Ga0495604_0000608
972 Ga0495674_0143634
973 Ga0495676_0010465
974 Ga0495676_0125333
975 Ga0495676_0142351
976 Ga0495676_0237222
977 Ga0495680_0008229
978 Ga0495680_0014247
979 Ga0495680_0020471
980 Ga0495680_0062469
981 Ga0495680_0087132
982 Ga0495680_0142954
983 Ga0495680_0198110
984 Ga0495675_0000363
985 Ga0495675_0192824
986 Ga0495684_0027169
987 Ga0495684_0042484
988 Ga0495684_0058092
989 Ga0495593_0018722
990 Ga0495602_0000234
991 Ga0495602_0171150
992 Ga0495602_0235561
993 Ga0496100_0025298
994 Ga0496100_0071062
995 Ga0496101_0004729
996 Ga0496101_0024365
997 Ga0496101_0194915
998 Ga0496101_0366832
999 Ga0496102_0007384
1000 Ga0496102_0014701
1001 Ga0496102_0083361
1002 Ga0496104_0004243
1003 Ga0496104_0004725
1004 Ga0496104_0032311
1005 Ga0496104_0100478
1006 Ga0496104_0180244
1007 Ga0496104_0293383
1008 Ga0496104_0458001
1009 Ga0496105_0000921
1010 Ga0496105_0014440
1011 Ga0496105_0026253
1012 Ga0496105_0134745
1013 Ga0496105_0144912
1014 Ga0496105_0315064
1015 Ga0496106_0028830
1016 Ga0496106_0412728
1017 Ga0496106_0436679
1018 Ga0496107_0005357
1019 Ga0496107_0009417
1020 Ga0496107_0037844
1021 Ga0496107_0137402
1022 Ga0496107_0181310
1023 Ga0496108_0001117
1024 Ga0496108_0003454
1025 Ga0496108_0008152
1026 Ga0496108_0256254
1027 Ga0496109_0001252
1028 Ga0496109_0017478
1029 Ga0496109_0032028
1030 Ga0496109_0044918
1031 Ga0496110_0002369
1032 Ga0496110_0007041
1033 Ga0496110_0053859
1034 Ga0496110_0123517
1035 Ga0496111_0004830
1036 Ga0496111_0009089
1037 Ga0496111_0044491
1038 Ga0496111_0055089
1039 Ga0496111_0137375
1040 Ga0496112_0020070
1041 Ga0496112_0029197
1042 Ga0496112_0033345
1043 Ga0496112_0158722
1044 Ga0496112_0191670
1045 Ga0496113_0008766
1046 Ga0496113_0091318
1047 Ga0496113_0165005
1048 Ga0496114_0010793
1049 Ga0496114_0015246
1050 Ga0496114_0049946
1051 Ga0496114_0052284
1052 Ga0496114_0064145
1053 Ga0496115_0025029
1054 Ga0496115_0030409
1055 Ga0496115_0047687
1056 Ga0496115_0051706
1057 Ga0496115_0197191
1058 Ga0496115_0312951
1059 Ga0501034_0014370
1060 Ga0501067_0007272
1061 Ga0501067_0018551
1062 Ga0501067_0028496
1063 Ga0501067_0089202
1064 Ga0501068_0015932
1065 Ga0501069_0011649
1066 Ga0501069_0022556
1067 Ga0501069_0059939
1068 Ga0501069_0287186
1069 Ga0501070_0029335
1070 Ga0501070_0217248
1071 Ga0501072_0007793
1072 Ga0501073_0051060
1073 Ga0501074_0015975
1074 Ga0501079_0013006
1075 Ga0501080_0006430
1076 Ga0501083_0025559
1077 nmdc:mga0yw44_85354_c1
1078 nmdc:mga08y16_229515_c1
1079 nmdc:mga0n895_13219_c1
1080 nmdc:mga0rr50_226870_c1
1081 nmdc:mga08x19_90652_c1
1082 nmdc:mga0a205_150251_c1
1083 Ga0495601_0001954
1084 Ga0495601_0056504
1085 Ga0495601_0142166
1086 Ga0495612_0014147
1087 Ga0495612_0070892
1088 Ga0495595_0010972
1089 Ga0495595_0016155
1090 Ga0495619_0003196
1091 Ga0495619_0049518
1092 Ga0495619_0077537
1093 Ga0495619_0133941
1094 Ga0501084_0043896
1095 Ga0501082_0118250
1096 Ga0466962_0002955
1097 Ga0466962_0003936
1098 Ga0466962_0006772
1099 Ga0466962_0020794
1100 Ga0466962_0092683
1101 Ga0466962_0116410
1102 Ga0530510_0083284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.6433 50 269
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.627 4 271
7r88-assembly1.cif.gz_B the structure of human abcg5-i529w/abcg8-wt 0.6262 4 269
6xjh-assembly1.cif.gz_A pmtcd abc exporter without the basket domain at c2 symmetry 0.6254 2 272
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.621 4 271
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6029 62 261 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.574 59 266 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5592 59 266 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4533 62 261 3.40.1710.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.445 7 267 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538DXG2-F1-model_v4 ABC transporter permease 0.9068 2 272 GO:0005886
GO:0140359
AF-A0A7W0RZZ3-F1-model_v4 ABC transporter permease 0.906 1 272 GO:0005886
GO:0140359
AF-A0A7W0RZZ3-F1-model_v4 ABC transporter permease 0.9029 1 272 GO:0005886
GO:0140359
AF-A0A538DXG2-F1-model_v4 ABC transporter permease 0.9004 2 272 GO:0005886
GO:0140359
AF-A0A7W1LP47-F1-model_v4 ABC transporter permease subunit 0.8972 90 272 GO:0005886
GO:0140359

Map