F462654

General Info

Members Datasets Scaffolds Average Seq Length
551 214 1102 202

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0268251|Ga0495674_0268251_218_865
Length 215
Sequence MTEKTPAAPADDDKVGSDLEDFAQQIADQIASFLLALQAIARGEATGGRAIALLLLEVSQVLLAGGRLGVHEDFTPADEYEPDAGPDPDLDAMRLRLAVLLEGVDAYTEVFDPYVDPPEAVSSLLSDDLTSIATALAHGLRHYRAGRVSEALWWWQFSYVSTWGTDASGVLRALQSVVAHDRLDAEFESEQDQVAAADEILESASPDQNAVTSAP

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
96 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2643221576 Nocardioides sp. Root614 Isolate Unclassified
204 2643221590 Nocardioides sp. Root682 Isolate Unclassified
205 2643221615 Nocardioides sp. Root224 Isolate Unclassified
206 2643221641 Nocardioides sp. Root122 Isolate Unclassified
207 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
208 2739367898 Nocardioides sp. CF479 Isolate Unclassified
209 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
210 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
211 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
212 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
213 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
214 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0.91
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 0.18
Rhizoplane 12.16
Rhizosphere 74.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0268251 3300047319 Bacteria 1401
2 LJQas_1000886 3300000549 Bacteria 4654
3 JGI24735J21928_10011538 3300002067 Bacteria 2799
4 JGI24735J21928_10038073 3300002067 Bacteria 1408
5 Ga0007429J51699_1030170 3300003579 Bacteria 953
6 Ga0058862_11973219 3300004803 Bacteria 912
7 Ga0070658_10264283 3300005327 Bacteria 1462
8 Ga0070683_100032397 3300005329 Bacteria 4760
9 Ga0070683_100186903 3300005329 Bacteria 1967
10 Ga0070683_100232983 3300005329 Bacteria 1751
11 Ga0070683_100236366 3300005329 Bacteria 1738
12 Ga0070683_100732942 3300005329 Bacteria 947
13 Ga0070670_100267966 3300005331 Bacteria 1490
14 Ga0070670_100857784 3300005331 Bacteria 822
15 Ga0070677_10245743 3300005333 Bacteria 886
16 Ga0070682_100051474 3300005337 Bacteria 2574
17 Ga0070682_100092451 3300005337 Bacteria 1982
18 Ga0070682_100187528 3300005337 Bacteria 1450
19 Ga0070660_100170838 3300005339 Bacteria 1756
20 Ga0070687_100074342 3300005343 Bacteria 1834
21 Ga0070687_100127465 3300005343 Bacteria 1465
22 Ga0070687_100160809 3300005343 Bacteria 1327
23 Ga0070692_10033937 3300005345 Bacteria 2574
24 Ga0070675_100193740 3300005354 Bacteria 1762
25 Ga0070659_100021922 3300005366 Bacteria 4873
26 Ga0070659_100037671 3300005366 Bacteria 3771
27 Ga0070659_100443870 3300005366 Bacteria 1100
28 Ga0070714_100007180 3300005435 Bacteria 8645
29 Ga0070678_100365332 3300005456 Bacteria 1245
30 Ga0068867_100110519 3300005459 Bacteria 2111
31 Ga0070685_10170117 3300005466 Bacteria 1396
32 Ga0070685_10399236 3300005466 Bacteria 952
33 Ga0070685_10633622 3300005466 Bacteria 773
34 Ga0070698_100019628 3300005471 Bacteria 7090
35 Ga0070679_100003923 3300005530 Bacteria 13682
36 Ga0070679_100583125 3300005530 Bacteria 1062
37 Ga0070679_100967322 3300005530 Bacteria 795
38 Ga0070684_100000262 3300005535 Bacteria 36422
39 Ga0070684_100475254 3300005535 Bacteria 1156
40 Ga0070684_100527499 3300005535 Bacteria 1095
41 Ga0070672_100275470 3300005543 Bacteria 1422
42 Ga0070686_100119417 3300005544 Bacteria 1808
43 Ga0068855_100423594 3300005563 Bacteria 1456
44 Ga0068857_100023461 3300005577 Bacteria 5431
45 Ga0068857_100943635 3300005577 Bacteria 829
46 Ga0070702_100170635 3300005615 Bacteria 1415
47 Ga0070702_100572846 3300005615 Bacteria 842
48 Ga0068864_100079751 3300005618 Bacteria 2867
49 Ga0068861_100021428 3300005719 Bacteria 4644
50 Ga0068861_100227920 3300005719 Bacteria 1579
51 Ga0068861_100368685 3300005719 Bacteria 1265
52 Ga0068861_100840188 3300005719 Bacteria 865
53 Ga0068863_101106589 3300005841 Bacteria 797
54 Ga0068860_100000544 3300005843 Bacteria 45936
55 Ga0068860_100314961 3300005843 Bacteria 1535
56 Ga0075365_10017520 3300006038 Bacteria 4384
57 Ga0075365_10036399 3300006038 Bacteria 3188
58 Ga0075365_10056429 3300006038 Bacteria 2610
59 Ga0075365_10063915 3300006038 Bacteria 2464
60 Ga0075365_10077900 3300006038 Bacteria 2240
61 Ga0075365_10093702 3300006038 Bacteria 2049
62 Ga0075365_10104067 3300006038 Bacteria 1946
63 Ga0075365_10431421 3300006038 Bacteria 930
64 Ga0075368_10013032 3300006042 Bacteria 3049
65 Ga0075368_10141752 3300006042 Bacteria 1002
66 Ga0075363_100003808 3300006048 Bacteria 6503
67 Ga0075363_100032580 3300006048 Bacteria 2708
68 Ga0075363_100077638 3300006048 Bacteria 1812
69 Ga0075363_100119036 3300006048 Bacteria 1473
70 Ga0075364_10015610 3300006051 Bacteria 4713
71 Ga0075364_10019192 3300006051 Bacteria 4289
72 Ga0075364_10029701 3300006051 Bacteria 3506
73 Ga0075364_10034809 3300006051 Bacteria 3253
74 Ga0075364_10100126 3300006051 Bacteria 1929
75 Ga0075364_10142360 3300006051 Bacteria 1614
76 Ga0075367_10001582 3300006178 Bacteria 9864
77 Ga0075367_10017877 3300006178 Bacteria 3900
78 Ga0075367_10058070 3300006178 Bacteria 2302
79 Ga0075370_10070178 3300006353 Bacteria 2004
80 Ga0075370_10109582 3300006353 Bacteria 1602
81 Ga0068871_100296276 3300006358 Bacteria 1419
82 Ga0068865_100054911 3300006881 Bacteria 2771
83 Ga0068865_100156717 3300006881 Bacteria 1733
84 Ga0111539_10142146 3300009094 Bacteria 2809
85 Ga0105245_10001690 3300009098 Bacteria 20066
86 Ga0105245_10198709 3300009098 Bacteria 1924
87 Ga0105245_10296487 3300009098 Bacteria 1585
88 Ga0105243_10180317 3300009148 Bacteria 1836
89 Ga0105243_10278588 3300009148 Bacteria 1505
90 Ga0105242_10171959 3300009176 Bacteria 1905
91 Ga0105242_11806880 3300009176 Bacteria 650
92 Ga0105238_10330121 3300009551 Bacteria 1512
93 Ga0105249_10050959 3300009553 Bacteria 3775
94 Ga0105249_10178825 3300009553 Bacteria 2062
95 Ga0105249_10964438 3300009553 Bacteria 921
96 Ga0105249_11134332 3300009553 Bacteria 852
97 Ga0105239_10149178 3300010375 Bacteria 2609
98 Ga0105239_11499289 3300010375 Bacteria 779
99 Ga0105246_10013087 3300011119 Bacteria 5192
100 Ga0157318_1003404 3300012482 Bacteria 921
101 Ga0157370_10404478 3300013104 Bacteria 1256
102 Ga0157369_10084195 3300013105 Bacteria 3399
103 Ga0157374_10249195 3300013296 Bacteria 1747
104 Ga0157378_10577689 3300013297 Bacteria 1133
105 Ga0163162_10397895 3300013306 Bacteria 1510
106 Ga0163162_11358850 3300013306 Bacteria 808
107 Ga0157375_10026202 3300013308 Bacteria 5430
108 Ga0157375_10141886 3300013308 Bacteria 2530
109 Ga0157375_10376252 3300013308 Bacteria 1587
110 Ga0157375_10452309 3300013308 Bacteria 1450
111 Ga0163163_10077134 3300014325 Bacteria 3328
112 Ga0163163_10109025 3300014325 Bacteria 2796
113 Ga0163163_10518734 3300014325 Bacteria 1254
114 Ga0182008_10050144 3300014497 Bacteria 2072
115 Ga0157377_10026414 3300014745 Bacteria 3107
116 Ga0157379_10138427 3300014968 Bacteria 2194
117 Ga0163161_10062965 3300017792 Bacteria 2703
118 Ga0163161_10366531 3300017792 Bacteria 1148
119 Ga0197907_10442695 3300020069 Bacteria 1265
120 Ga0206353_11314776 3300020082 Bacteria 756
121 Ga0207688_10388005 3300025901 Bacteria 865
122 Ga0207647_10002943 3300025904 Bacteria 12814
123 Ga0207647_10156398 3300025904 Bacteria 1331
124 Ga0207705_10067320 3300025909 Bacteria 2592
125 Ga0207705_10527917 3300025909 Bacteria 917
126 Ga0207707_10057596 3300025912 Bacteria 3382
127 Ga0207662_10022882 3300025918 Bacteria 3587
128 Ga0207657_10758224 3300025919 Bacteria 752
129 Ga0207657_10766747 3300025919 Bacteria 747
130 Ga0207652_10210034 3300025921 Bacteria 1753
131 Ga0207694_10077596 3300025924 Bacteria 2603
132 Ga0207687_10018441 3300025927 Bacteria 4607
133 Ga0207687_10089740 3300025927 Bacteria 2239
134 Ga0207687_10312087 3300025927 Bacteria 1270
135 Ga0207687_10319663 3300025927 Bacteria 1256
136 Ga0207687_10450507 3300025927 Bacteria 1067
137 Ga0207664_10004815 3300025929 Bacteria 9176
138 Ga0207690_10013614 3300025932 Bacteria 4891
139 Ga0207690_10029359 3300025932 Bacteria 3495
140 Ga0207709_10011212 3300025935 Bacteria 4944
141 Ga0207709_10214502 3300025935 Bacteria 1384
142 Ga0207709_10309072 3300025935 Bacteria 1179
143 Ga0207669_10149956 3300025937 Bacteria 1632
144 Ga0207669_10540374 3300025937 Bacteria 939
145 Ga0207704_10021668 3300025938 Bacteria 3427
146 Ga0207691_10065935 3300025940 Bacteria 3276
147 Ga0207661_10063131 3300025944 Bacteria 2999
148 Ga0207661_10080119 3300025944 Bacteria 2693
149 Ga0207661_10135657 3300025944 Bacteria 2113
150 Ga0207661_10271623 3300025944 Bacteria 1513
151 Ga0207661_10724890 3300025944 Bacteria 915
152 Ga0207661_10836147 3300025944 Bacteria 848
153 Ga0207679_10632521 3300025945 Bacteria 967
154 Ga0207667_10354659 3300025949 Bacteria 1496
155 Ga0207712_10097177 3300025961 Bacteria 2182
156 Ga0207712_10356507 3300025961 Bacteria 1217
157 Ga0207712_10468784 3300025961 Bacteria 1071
158 Ga0207668_10044849 3300025972 Bacteria 3012
159 Ga0207668_10750797 3300025972 Bacteria 861
160 Ga0207639_10507116 3300026041 Bacteria 1103
161 Ga0207639_10869900 3300026041 Bacteria 842
162 Ga0207678_10100326 3300026067 Bacteria 2473
163 Ga0207678_10171886 3300026067 Bacteria 1850
164 Ga0207708_10075367 3300026075 Bacteria 2587
165 Ga0207708_10103863 3300026075 Bacteria 2201
166 Ga0207702_10231509 3300026078 Bacteria 1727
167 Ga0207648_10090625 3300026089 Bacteria 2672
168 Ga0207676_10056377 3300026095 Bacteria 3089
169 Ga0207674_10010432 3300026116 Bacteria 10521
170 Ga0207674_10236685 3300026116 Bacteria 1773
171 Ga0207674_10336480 3300026116 Bacteria 1459
172 Ga0207675_100077205 3300026118 Bacteria 3120
173 Ga0207675_100115031 3300026118 Bacteria 2541
174 Ga0207675_100171483 3300026118 Bacteria 2074
175 Ga0207675_100257212 3300026118 Bacteria 1691
176 Ga0207675_100412246 3300026118 Bacteria 1333
177 Ga0207675_100679763 3300026118 Bacteria 1037
178 Ga0207683_10144481 3300026121 Bacteria 2144
179 Ga0207683_10352537 3300026121 Bacteria 1351
180 Ga0207683_10457464 3300026121 Bacteria 1177
181 Ga0209813_10008386 3300027866 Bacteria 2609
182 Ga0209813_10023695 3300027866 Bacteria 1747
183 Ga0207428_10311215 3300027907 Bacteria 1164
184 Ga0268266_10002310 3300028379 Bacteria 20684
185 Ga0268264_10000343 3300028381 Bacteria 71702
186 Ga0316176_1202969 3300030732 Bacteria 743
187 Ga0314311_1229792 3300030733 Bacteria 682
188 Ga0316181_1175264 3300030744 Bacteria 1766
189 Ga0316181_1269571 3300030744 Bacteria 950
190 Ga0307405_10094258 3300031731 Bacteria 1991
191 Ga0307405_10129800 3300031731 Bacteria 1740
192 Ga0307405_10292964 3300031731 Bacteria 1231
193 Ga0307413_10437647 3300031824 Bacteria 1034
194 Ga0307413_10673160 3300031824 Bacteria 856
195 Ga0307410_10003277 3300031852 Bacteria 8087
196 Ga0307410_10021431 3300031852 Bacteria 3975
197 Ga0307410_10142437 3300031852 Bacteria 1775
198 Ga0307410_10210891 3300031852 Bacteria 1488
199 Ga0307410_10230717 3300031852 Bacteria 1429
200 Ga0307410_10504172 3300031852 Bacteria 996
201 Ga0307406_10026262 3300031901 Bacteria 3495
202 Ga0307406_10759502 3300031901 Bacteria 815
203 Ga0307407_10182075 3300031903 Bacteria 1393
204 Ga0307407_10268780 3300031903 Bacteria 1176
205 Ga0307407_10317016 3300031903 Bacteria 1093
206 Ga0307407_10373419 3300031903 Bacteria 1016
207 Ga0307407_10403328 3300031903 Bacteria 981
208 Ga0307412_10311290 3300031911 Bacteria 1249
209 Ga0307409_100082229 3300031995 Bacteria 2606
210 Ga0307409_100125031 3300031995 Bacteria 2186
211 Ga0307409_100125381 3300031995 Bacteria 2183
212 Ga0307409_100174733 3300031995 Bacteria 1894
213 Ga0307409_100206444 3300031995 Bacteria 1762
214 Ga0307409_100336745 3300031995 Bacteria 1418
215 Ga0307409_100340676 3300031995 Bacteria 1411
216 Ga0307409_100463501 3300031995 Bacteria 1226
217 Ga0307409_100577603 3300031995 Bacteria 1107
218 Ga0307409_100590113 3300031995 Bacteria 1096
219 Ga0307409_100672191 3300031995 Bacteria 1032
220 Ga0307409_101056696 3300031995 Bacteria 832
221 Ga0307409_101076170 3300031995 Bacteria 825
222 Ga0307416_100042695 3300032002 Bacteria 3542
223 Ga0307416_100042956 3300032002 Bacteria 3535
224 Ga0307416_100072030 3300032002 Bacteria 2874
225 Ga0307416_100109418 3300032002 Bacteria 2430
226 Ga0307416_100120535 3300032002 Bacteria 2336
227 Ga0307416_100249313 3300032002 Bacteria 1727
228 Ga0307416_100315547 3300032002 Bacteria 1562
229 Ga0307416_101773402 3300032002 Bacteria 721
230 Ga0307414_10746698 3300032004 Bacteria 889
231 Ga0307411_10011403 3300032005 Bacteria 4797
232 Ga0307411_10057247 3300032005 Bacteria 2574
233 Ga0307411_10205508 3300032005 Bacteria 1516
234 Ga0307411_10363163 3300032005 Bacteria 1185
235 Ga0307411_10741407 3300032005 Bacteria 860
236 Ga0307411_11302177 3300032005 Bacteria 662
237 Ga0307415_100047035 3300032126 Bacteria 2902
238 Ga0307415_100067585 3300032126 Bacteria 2498
239 Ga0307415_100413361 3300032126 Bacteria 1155
240 Ga0307415_100496208 3300032126 Bacteria 1066
241 Ga0395900_0234535 3300037418 Bacteria 1844
242 Ga0395900_0615010 3300037418 Bacteria 1026
243 Ga0395898_0324364 3300037466 Bacteria 1469
244 Ga0395905_0006364 3300037471 Bacteria 11901
245 Ga0395905_0107981 3300037471 Bacteria 2613
246 Ga0395901_0025580 3300038443 Bacteria 6059
247 Ga0451789_0246594 3300041443 Bacteria 729
248 Ga0451791_0150779 3300041451 Bacteria 831
249 Ga0451791_1358030 3300041451 Bacteria 1044
250 Ga0451798_0158997 3300041458 Bacteria 851
251 Ga0451800_1332833 3300041459 Bacteria 760
252 Ga0451837_1225009 3300041494 Bacteria 1341
253 Ga0451845_0268253 3300041501 Bacteria 1190
254 Ga0451843_0180449 3300041509 Bacteria 1212
255 Ga0451843_0464138 3300041509 Bacteria 1320
256 Ga0466969_0080831 3300044656 Bacteria 1552
257 Ga0466972_0060856 3300044658 Bacteria 1811
258 Ga0466965_0047750 3300044683 Bacteria 2120
259 Ga0466965_0047949 3300044683 Bacteria 2115
260 Ga0466965_0167882 3300044683 Bacteria 1153
261 Ga0466965_0452951 3300044683 Bacteria 715
262 Ga0466966_0163200 3300044684 Bacteria 1356
263 Ga0466966_0169151 3300044684 Bacteria 1329
264 Ga0466966_0214644 3300044684 Bacteria 1162
265 Ga0466961_0063316 3300044693 Bacteria 2350
266 Ga0466961_0133698 3300044693 Bacteria 1554
267 Ga0466961_0399671 3300044693 Bacteria 834
268 Ga0466961_0404991 3300044693 Bacteria 828
269 Ga0466963_0020012 3300044694 Bacteria 4206
270 Ga0466963_0044994 3300044694 Bacteria 2906
271 Ga0466963_0133400 3300044694 Bacteria 1717
272 Ga0466964_0008348 3300044706 Bacteria 3888
273 Ga0466964_0012447 3300044706 Bacteria 3219
274 Ga0466964_0077278 3300044706 Bacteria 1421
275 Ga0466971_0029453 3300044719 Bacteria 2456
276 Ga0466970_0013826 3300044765 Bacteria 4139
277 Ga0466970_0045611 3300044765 Bacteria 2334
278 Ga0466970_0082943 3300044765 Bacteria 1734
279 Ga0466970_0085102 3300044765 Bacteria 1712
280 Ga0466970_0156977 3300044765 Bacteria 1257
281 Ga0466970_0246597 3300044765 Bacteria 1000
282 Ga0466970_0262366 3300044765 Bacteria 969
283 Ga0466957_0012740 3300044842 Bacteria 4872
284 Ga0466957_0146991 3300044842 Bacteria 1522
285 Ga0466957_0174664 3300044842 Bacteria 1401
286 Ga0466957_0240740 3300044842 Bacteria 1200
287 Ga0466957_0350943 3300044842 Bacteria 1001
288 Ga0466960_0018339 3300044901 Bacteria 3065
289 Ga0466960_0066661 3300044901 Bacteria 1781
290 Ga0466960_0096934 3300044901 Bacteria 1512
291 Ga0466960_0129244 3300044901 Bacteria 1331
292 Ga0466960_0189944 3300044901 Bacteria 1117
293 Ga0466960_0199084 3300044901 Bacteria 1093
294 Ga0466960_0327441 3300044901 Bacteria 869
295 Ga0466959_0161782 3300045049 Bacteria 1574
296 Ga0466959_0211581 3300045049 Bacteria 1347
297 Ga0451576_0033822 3300045051 Bacteria 5432
298 Ga0466958_0253839 3300045836 Bacteria 1125
299 Ga0466967_0014020 3300045976 Bacteria 6223
300 Ga0466967_0046909 3300045976 Bacteria 3764
301 Ga0466967_0059623 3300045976 Bacteria 3379
302 Ga0466967_0085164 3300045976 Bacteria 2861
303 Ga0466967_0099369 3300045976 Bacteria 2658
304 Ga0466967_0103995 3300045976 Bacteria 2599
305 Ga0466967_0222989 3300045976 Bacteria 1792
306 Ga0466967_0223890 3300045976 Bacteria 1789
307 Ga0466967_0453172 3300045976 Bacteria 1254
308 Ga0466967_0655729 3300045976 Bacteria 1038
309 Ga0495641_0114300 3300046461 Bacteria 1204
310 Ga0495664_0285523 3300046477 Bacteria 997
311 Ga0495630_0642381 3300046517 Bacteria 813
312 Ga0495665_0170881 3300046531 Bacteria 1132
313 Ga0495657_0058020 3300046675 Bacteria 2572
314 Ga0495658_0172346 3300046683 Bacteria 1340
315 Ga0496100_0011077 3300048903 Bacteria 5119
316 Ga0496100_0089094 3300048903 Bacteria 2101
317 Ga0496100_0153537 3300048903 Bacteria 1645
318 Ga0496100_0834377 3300048903 Bacteria 723
319 Ga0496101_0087943 3300048904 Bacteria 2307
320 Ga0496101_0144721 3300048904 Bacteria 1814
321 Ga0496101_0151918 3300048904 Bacteria 1772
322 Ga0496101_0247766 3300048904 Bacteria 1388
323 Ga0496102_0016389 3300048905 Bacteria 6473
324 Ga0496102_0074212 3300048905 Bacteria 3126
325 Ga0496102_0080391 3300048905 Bacteria 3003
326 Ga0496102_0159069 3300048905 Bacteria 2124
327 Ga0496103_0027597 3300048906 Bacteria 3441
328 Ga0496103_0053466 3300048906 Bacteria 2503
329 Ga0496103_0136264 3300048906 Bacteria 1569
330 Ga0496103_0153488 3300048906 Bacteria 1475
331 Ga0496104_0001682 3300048907 Bacteria 19101
332 Ga0496104_0319280 3300048907 Bacteria 1466
333 Ga0496105_0014737 3300048908 Bacteria 6223
334 Ga0496105_0041488 3300048908 Bacteria 3793
335 Ga0496105_0595320 3300048908 Bacteria 859
336 Ga0496106_0031984 3300048909 Bacteria 3921
337 Ga0496106_0148078 3300048909 Bacteria 1850
338 Ga0496106_0301161 3300048909 Bacteria 1286
339 Ga0496106_0320346 3300048909 Bacteria 1244
340 Ga0496106_0555235 3300048909 Bacteria 921
341 Ga0496107_0086749 3300048910 Bacteria 2285
342 Ga0496107_0151327 3300048910 Bacteria 1716
343 Ga0496107_0264365 3300048910 Bacteria 1280
344 Ga0496108_0166802 3300048911 Bacteria 1904
345 Ga0496108_0274550 3300048911 Bacteria 1467
346 Ga0496108_0337224 3300048911 Bacteria 1315
347 Ga0496108_0351716 3300048911 Bacteria 1286
348 Ga0496108_0394640 3300048911 Bacteria 1208
349 Ga0496109_0011176 3300048912 Bacteria 7704
350 Ga0496109_0024192 3300048912 Bacteria 5397
351 Ga0496109_0047644 3300048912 Bacteria 3897
352 Ga0496109_0075850 3300048912 Bacteria 3091
353 Ga0496109_0128903 3300048912 Bacteria 2360
354 Ga0496109_0242086 3300048912 Bacteria 1698
355 Ga0496109_0249389 3300048912 Bacteria 1672
356 Ga0496109_0514495 3300048912 Bacteria 1130
357 Ga0496110_0038344 3300048913 Bacteria 4169
358 Ga0496111_0138030 3300048914 Bacteria 1807
359 Ga0496111_0155637 3300048914 Bacteria 1696
360 Ga0496111_0338283 3300048914 Bacteria 1114
361 Ga0496111_0380400 3300048914 Bacteria 1044
362 Ga0496111_0413479 3300048914 Bacteria 996
363 Ga0496112_0529627 3300048915 Bacteria 1113
364 Ga0496113_0064020 3300048916 Bacteria 2780
365 Ga0496113_0577696 3300048916 Bacteria 901
366 Ga0496114_0019195 3300048917 Bacteria 5538
367 Ga0496114_0020655 3300048917 Bacteria 5345
368 Ga0496114_0040166 3300048917 Bacteria 3872
369 Ga0496114_0055888 3300048917 Bacteria 3293
370 Ga0496114_0099061 3300048917 Bacteria 2486
371 Ga0496114_0170040 3300048917 Bacteria 1899
372 Ga0496114_0176382 3300048917 Bacteria 1865
373 Ga0496115_0028756 3300048918 Bacteria 4359
374 Ga0496115_0036113 3300048918 Bacteria 3911
375 Ga0496115_0174669 3300048918 Bacteria 1776
376 Ga0496115_0190329 3300048918 Bacteria 1695
377 Ga0496124_0278387 3300048927 Bacteria 1221
378 Ga0501311_018967 3300049527 Bacteria 918
379 Ga0501031_0026527 3300049568 Bacteria 3777
380 Ga0501031_0039926 3300049568 Bacteria 3064
381 Ga0501031_0045554 3300049568 Bacteria 2862
382 Ga0501031_0085046 3300049568 Bacteria 2062
383 Ga0501031_0118539 3300049568 Bacteria 1729
384 Ga0501031_0283672 3300049568 Bacteria 1074
385 Ga0501033_0116073 3300049570 Bacteria 1945
386 Ga0501033_0167934 3300049570 Bacteria 1577
387 Ga0501034_0201831 3300049571 Bacteria 1946
388 Ga0501034_0255212 3300049571 Bacteria 1697
389 Ga0501034_0356802 3300049571 Bacteria 1389
390 Ga0501034_0670116 3300049571 Bacteria 938
391 Ga0501036_0072073 3300049572 Bacteria 2920
392 Ga0501036_0079913 3300049572 Bacteria 2765
393 Ga0501036_0118277 3300049572 Bacteria 2238
394 Ga0501036_0246309 3300049572 Bacteria 1498
395 Ga0501036_0281785 3300049572 Bacteria 1391
396 Ga0501037_0031352 3300049573 Bacteria 3925
397 Ga0501037_0195456 3300049573 Bacteria 1431
398 Ga0501037_0513857 3300049573 Bacteria 811
399 Ga0501038_0017369 3300049574 Bacteria 6503
400 Ga0501038_0106877 3300049574 Bacteria 2322
401 Ga0501038_0313817 3300049574 Bacteria 1228
402 Ga0501038_0433287 3300049574 Bacteria 1013
403 Ga0501039_0018443 3300049575 Bacteria 5357
404 Ga0501039_0073471 3300049575 Bacteria 2657
405 Ga0501039_0141519 3300049575 Bacteria 1889
406 Ga0501040_0011089 3300049576 Bacteria 5893
407 Ga0501040_0023657 3300049576 Bacteria 4120
408 Ga0501040_0064335 3300049576 Bacteria 2525
409 Ga0501040_0179239 3300049576 Bacteria 1502
410 Ga0501040_0313196 3300049576 Bacteria 1122
411 Ga0501040_0317359 3300049576 Bacteria 1114
412 Ga0501042_0008549 3300049578 Bacteria 6768
413 Ga0501042_0261557 3300049578 Bacteria 1249
414 Ga0501042_0275610 3300049578 Bacteria 1215
415 Ga0501043_0232973 3300049579 Bacteria 1422
416 Ga0501043_0496425 3300049579 Bacteria 912
417 Ga0501046_0002442 3300049580 Bacteria 17420
418 Ga0501046_0158092 3300049580 Bacteria 1706
419 Ga0501046_0486539 3300049580 Bacteria 885
420 Ga0501048_0021253 3300049582 Bacteria 4752
421 Ga0501048_0039807 3300049582 Bacteria 3370
422 Ga0501048_0193583 3300049582 Bacteria 1441
423 Ga0501048_0198571 3300049582 Bacteria 1422
424 Ga0501048_0231990 3300049582 Bacteria 1310
425 Ga0501048_0503370 3300049582 Bacteria 868
426 Ga0501048_0664205 3300049582 Bacteria 748
427 Ga0501067_0015381 3300049583 Bacteria 4236
428 Ga0501067_0019936 3300049583 Bacteria 3710
429 Ga0501067_0030766 3300049583 Bacteria 2977
430 Ga0501067_0043364 3300049583 Bacteria 2498
431 Ga0501067_0070776 3300049583 Bacteria 1931
432 Ga0501067_0092088 3300049583 Bacteria 1683
433 Ga0501068_0008758 3300049584 Bacteria 5646
434 Ga0501068_0035749 3300049584 Bacteria 2967
435 Ga0501068_0096659 3300049584 Bacteria 1827
436 Ga0501068_0151484 3300049584 Bacteria 1458
437 Ga0501069_0052876 3300049585 Bacteria 2262
438 Ga0501069_0065223 3300049585 Bacteria 2036
439 Ga0501069_0072810 3300049585 Bacteria 1927
440 Ga0501069_0088223 3300049585 Bacteria 1753
441 Ga0501069_0090290 3300049585 Bacteria 1732
442 Ga0501069_0285877 3300049585 Bacteria 966
443 Ga0501069_0427277 3300049585 Bacteria 786
444 Ga0501070_0003141 3300049586 Bacteria 14380
445 Ga0501070_0061272 3300049586 Bacteria 3117
446 Ga0501070_0069265 3300049586 Bacteria 2921
447 Ga0501070_0105357 3300049586 Bacteria 2331
448 Ga0501070_0122033 3300049586 Bacteria 2153
449 Ga0501070_0153256 3300049586 Bacteria 1901
450 Ga0501070_0675695 3300049586 Bacteria 818
451 Ga0501070_0687974 3300049586 Bacteria 809
452 Ga0501070_0913232 3300049586 Bacteria 684
453 Ga0501071_0019623 3300049587 Bacteria 4691
454 Ga0501071_0030588 3300049587 Bacteria 3809
455 Ga0501071_0074441 3300049587 Bacteria 2478
456 Ga0501071_0091801 3300049587 Bacteria 2231
457 Ga0501071_0199488 3300049587 Bacteria 1503
458 Ga0501071_0208559 3300049587 Bacteria 1469
459 Ga0501071_0223950 3300049587 Bacteria 1416
460 Ga0501072_0022923 3300049588 Bacteria 4847
461 Ga0501072_0066636 3300049588 Bacteria 2840
462 Ga0501072_0080470 3300049588 Bacteria 2581
463 Ga0501072_0128404 3300049588 Bacteria 2020
464 Ga0501072_0217531 3300049588 Bacteria 1523
465 Ga0501072_0232732 3300049588 Bacteria 1468
466 Ga0501073_0034147 3300049589 Bacteria 3621
467 Ga0501073_0134633 3300049589 Bacteria 1712
468 Ga0501074_0029635 3300049590 Bacteria 3965
469 Ga0501074_0030609 3300049590 Bacteria 3900
470 Ga0501074_0258177 3300049590 Bacteria 1239
471 Ga0501075_0045373 3300049591 Bacteria 3299
472 Ga0501075_0128778 3300049591 Bacteria 1928
473 Ga0501076_0006326 3300049592 Bacteria 8581
474 Ga0501076_0054789 3300049592 Bacteria 3161
475 Ga0501076_0200056 3300049592 Bacteria 1631
476 Ga0501076_0233070 3300049592 Bacteria 1505
477 Ga0501077_0107424 3300049593 Bacteria 1768
478 Ga0501079_0188383 3300049741 Bacteria 1610
479 Ga0501079_0313280 3300049741 Bacteria 1228
480 Ga0501079_0434564 3300049741 Bacteria 1031
481 Ga0501079_0554206 3300049741 Bacteria 904
482 Ga0501080_0256113 3300049742 Bacteria 1595
483 Ga0501080_0279324 3300049742 Bacteria 1518
484 Ga0501080_0305794 3300049742 Bacteria 1441
485 Ga0501035_0254971 3300049822 Bacteria 1488
486 Ga0501035_0396253 3300049822 Bacteria 1149
487 Ga0501045_0090806 3300049824 Bacteria 2257
488 Ga0501045_0167639 3300049824 Bacteria 1636
489 Ga0501045_0238918 3300049824 Bacteria 1352
490 nmdc:mga03n38_34099_c1 3300050490 Bacteria 2171
491 nmdc:mga03n38_5964_c1 3300050490 Bacteria 4195
492 nmdc:mga00v17_12221_c1 3300050491 Bacteria 4735
493 nmdc:mga00v17_62629_c1 3300050491 Bacteria 2289
494 nmdc:mga00v17_6384_c1 3300050491 Bacteria 6256
495 nmdc:mga0yw44_14720_c1 3300050492 Bacteria 4164
496 nmdc:mga0yw44_14746_c1 3300050492 Bacteria 4161
497 nmdc:mga0yw44_245310_c1 3300050492 Bacteria 1191
498 nmdc:mga0yw44_28346_c1 3300050492 Bacteria 3220
499 nmdc:mga0yw44_292165_c1 3300050492 Bacteria 1091
500 nmdc:mga0yw44_46907_c1 3300050492 Bacteria 2598
501 nmdc:mga0yw44_517105_c1 3300050492 Bacteria 810
502 nmdc:mga0yw44_61114_c1 3300050492 Bacteria 2310
503 nmdc:mga06z11_222492_c1 3300050494 Bacteria 1103
504 nmdc:mga06z11_28159_c1 3300050494 Bacteria 2693
505 nmdc:mga06z11_53951_c1 3300050494 Bacteria 2070
506 nmdc:mga04h51_28328_c1 3300050495 Bacteria 1747
507 nmdc:mga04h51_9970_c1 3300050495 Bacteria 2595
508 nmdc:mga07m45_16576_c1 3300050496 Bacteria 3052
509 nmdc:mga07m45_172453_c1 3300050496 Bacteria 922
510 nmdc:mga07m45_21281_c1 3300050496 Bacteria 3530
511 nmdc:mga07m45_56491_c1 3300050496 Bacteria 1803
512 nmdc:mga07m45_8828_c1 3300050496 Bacteria 5199
513 nmdc:mga0sz30_11971_c1 3300050516 Bacteria 1008
514 Ga0495601_0062145 3300053077 Bacteria 2372
515 Ga0495595_0032008 3300053084 Bacteria 2367
516 Ga0500644_0000352 3300053088 Bacteria 22817
517 Ga0500644_0045431 3300053088 Bacteria 1480
518 Ga0500554_034778 3300053102 Bacteria 1511
519 Ga0500556_0003157 3300053104 Bacteria 4909
520 Ga0500593_004364 3300053117 Bacteria 5466
521 Ga0501084_0078479 3300054114 Bacteria 2767
522 Ga0501084_0110050 3300054114 Bacteria 2315
523 Ga0501084_0168186 3300054114 Bacteria 1850
524 Ga0501084_0524235 3300054114 Bacteria 1002
525 Ga0501082_0017286 3300060353 Bacteria 6213
526 Ga0501082_0042593 3300060353 Bacteria 3914
527 Ga0501082_0140317 3300060353 Bacteria 2098
528 Ga0501082_0254939 3300060353 Bacteria 1526
529 Ga0501082_0361195 3300060353 Bacteria 1267
530 Ga0501082_0477570 3300060353 Bacteria 1089
531 Ga0501082_0798439 3300060353 Bacteria 826
532 Ga0466962_0005875 3300061719 Bacteria 5896
533 Ga0530510_0110569 3300061734 Bacteria 2012
534 Ga0530510_0159571 3300061734 Bacteria 1668
535 Ga0530510_0213652 3300061734 Bacteria 1433
536 Ga0530510_0288002 3300061734 Bacteria 1228
537 Ga0530510_0532427 3300061734 Bacteria 892
538 Ga0530510_0722334 3300061734 Bacteria 759
539 Ga0530510_0756623 3300061734 Bacteria 741
540 2643892712 2643221576 Bacteria 5214352
541 2643962161 2643221590 Bacteria 5214697
542 2644090573 2643221615 Bacteria 5487866
543 2644232055 2643221641 Bacteria 4490190
544 2644320330 2643221657 Bacteria 5490246
545 2740168572 2739367898 Bacteria 4367674
546 2774395082 2773857762 Bacteria 5971770
547 2809194087 2808606439 Bacteria 5952208
548 2812348816 2811994878 Bacteria 5992952
549 2857485316 2857481737 Bacteria 4761446
550 2891973420 2891968417 Bacteria 5821697
551 8054611498 8054609563 Bacteria 5170090
552 Ga0495674_0268251
553 LJQas_1000886
554 JGI24735J21928_10011538
555 JGI24735J21928_10038073
556 Ga0007429J51699_1030170
557 Ga0058862_11973219
558 Ga0070658_10264283
559 Ga0070683_100032397
560 Ga0070683_100186903
561 Ga0070683_100232983
562 Ga0070683_100236366
563 Ga0070683_100732942
564 Ga0070670_100267966
565 Ga0070670_100857784
566 Ga0070677_10245743
567 Ga0070682_100051474
568 Ga0070682_100092451
569 Ga0070682_100187528
570 Ga0070660_100170838
571 Ga0070687_100074342
572 Ga0070687_100127465
573 Ga0070687_100160809
574 Ga0070692_10033937
575 Ga0070675_100193740
576 Ga0070659_100021922
577 Ga0070659_100037671
578 Ga0070659_100443870
579 Ga0070714_100007180
580 Ga0070678_100365332
581 Ga0068867_100110519
582 Ga0070685_10170117
583 Ga0070685_10399236
584 Ga0070685_10633622
585 Ga0070698_100019628
586 Ga0070679_100003923
587 Ga0070679_100583125
588 Ga0070679_100967322
589 Ga0070684_100000262
590 Ga0070684_100475254
591 Ga0070684_100527499
592 Ga0070672_100275470
593 Ga0070686_100119417
594 Ga0068855_100423594
595 Ga0068857_100023461
596 Ga0068857_100943635
597 Ga0070702_100170635
598 Ga0070702_100572846
599 Ga0068864_100079751
600 Ga0068861_100021428
601 Ga0068861_100227920
602 Ga0068861_100368685
603 Ga0068861_100840188
604 Ga0068863_101106589
605 Ga0068860_100000544
606 Ga0068860_100314961
607 Ga0075365_10017520
608 Ga0075365_10036399
609 Ga0075365_10056429
610 Ga0075365_10063915
611 Ga0075365_10077900
612 Ga0075365_10093702
613 Ga0075365_10104067
614 Ga0075365_10431421
615 Ga0075368_10013032
616 Ga0075368_10141752
617 Ga0075363_100003808
618 Ga0075363_100032580
619 Ga0075363_100077638
620 Ga0075363_100119036
621 Ga0075364_10015610
622 Ga0075364_10019192
623 Ga0075364_10029701
624 Ga0075364_10034809
625 Ga0075364_10100126
626 Ga0075364_10142360
627 Ga0075367_10001582
628 Ga0075367_10017877
629 Ga0075367_10058070
630 Ga0075370_10070178
631 Ga0075370_10109582
632 Ga0068871_100296276
633 Ga0068865_100054911
634 Ga0068865_100156717
635 Ga0111539_10142146
636 Ga0105245_10001690
637 Ga0105245_10198709
638 Ga0105245_10296487
639 Ga0105243_10180317
640 Ga0105243_10278588
641 Ga0105242_10171959
642 Ga0105242_11806880
643 Ga0105238_10330121
644 Ga0105249_10050959
645 Ga0105249_10178825
646 Ga0105249_10964438
647 Ga0105249_11134332
648 Ga0105239_10149178
649 Ga0105239_11499289
650 Ga0105246_10013087
651 Ga0157318_1003404
652 Ga0157370_10404478
653 Ga0157369_10084195
654 Ga0157374_10249195
655 Ga0157378_10577689
656 Ga0163162_10397895
657 Ga0163162_11358850
658 Ga0157375_10026202
659 Ga0157375_10141886
660 Ga0157375_10376252
661 Ga0157375_10452309
662 Ga0163163_10077134
663 Ga0163163_10109025
664 Ga0163163_10518734
665 Ga0182008_10050144
666 Ga0157377_10026414
667 Ga0157379_10138427
668 Ga0163161_10062965
669 Ga0163161_10366531
670 Ga0197907_10442695
671 Ga0206353_11314776
672 Ga0207688_10388005
673 Ga0207647_10002943
674 Ga0207647_10156398
675 Ga0207705_10067320
676 Ga0207705_10527917
677 Ga0207707_10057596
678 Ga0207662_10022882
679 Ga0207657_10758224
680 Ga0207657_10766747
681 Ga0207652_10210034
682 Ga0207694_10077596
683 Ga0207687_10018441
684 Ga0207687_10089740
685 Ga0207687_10312087
686 Ga0207687_10319663
687 Ga0207687_10450507
688 Ga0207664_10004815
689 Ga0207690_10013614
690 Ga0207690_10029359
691 Ga0207709_10011212
692 Ga0207709_10214502
693 Ga0207709_10309072
694 Ga0207669_10149956
695 Ga0207669_10540374
696 Ga0207704_10021668
697 Ga0207691_10065935
698 Ga0207661_10063131
699 Ga0207661_10080119
700 Ga0207661_10135657
701 Ga0207661_10271623
702 Ga0207661_10724890
703 Ga0207661_10836147
704 Ga0207679_10632521
705 Ga0207667_10354659
706 Ga0207712_10097177
707 Ga0207712_10356507
708 Ga0207712_10468784
709 Ga0207668_10044849
710 Ga0207668_10750797
711 Ga0207639_10507116
712 Ga0207639_10869900
713 Ga0207678_10100326
714 Ga0207678_10171886
715 Ga0207708_10075367
716 Ga0207708_10103863
717 Ga0207702_10231509
718 Ga0207648_10090625
719 Ga0207676_10056377
720 Ga0207674_10010432
721 Ga0207674_10236685
722 Ga0207674_10336480
723 Ga0207675_100077205
724 Ga0207675_100115031
725 Ga0207675_100171483
726 Ga0207675_100257212
727 Ga0207675_100412246
728 Ga0207675_100679763
729 Ga0207683_10144481
730 Ga0207683_10352537
731 Ga0207683_10457464
732 Ga0209813_10008386
733 Ga0209813_10023695
734 Ga0207428_10311215
735 Ga0268266_10002310
736 Ga0268264_10000343
737 Ga0316176_1202969
738 Ga0314311_1229792
739 Ga0316181_1175264
740 Ga0316181_1269571
741 Ga0307405_10094258
742 Ga0307405_10129800
743 Ga0307405_10292964
744 Ga0307413_10437647
745 Ga0307413_10673160
746 Ga0307410_10003277
747 Ga0307410_10021431
748 Ga0307410_10142437
749 Ga0307410_10210891
750 Ga0307410_10230717
751 Ga0307410_10504172
752 Ga0307406_10026262
753 Ga0307406_10759502
754 Ga0307407_10182075
755 Ga0307407_10268780
756 Ga0307407_10317016
757 Ga0307407_10373419
758 Ga0307407_10403328
759 Ga0307412_10311290
760 Ga0307409_100082229
761 Ga0307409_100125031
762 Ga0307409_100125381
763 Ga0307409_100174733
764 Ga0307409_100206444
765 Ga0307409_100336745
766 Ga0307409_100340676
767 Ga0307409_100463501
768 Ga0307409_100577603
769 Ga0307409_100590113
770 Ga0307409_100672191
771 Ga0307409_101056696
772 Ga0307409_101076170
773 Ga0307416_100042695
774 Ga0307416_100042956
775 Ga0307416_100072030
776 Ga0307416_100109418
777 Ga0307416_100120535
778 Ga0307416_100249313
779 Ga0307416_100315547
780 Ga0307416_101773402
781 Ga0307414_10746698
782 Ga0307411_10011403
783 Ga0307411_10057247
784 Ga0307411_10205508
785 Ga0307411_10363163
786 Ga0307411_10741407
787 Ga0307411_11302177
788 Ga0307415_100047035
789 Ga0307415_100067585
790 Ga0307415_100413361
791 Ga0307415_100496208
792 Ga0395900_0234535
793 Ga0395900_0615010
794 Ga0395898_0324364
795 Ga0395905_0006364
796 Ga0395905_0107981
797 Ga0395901_0025580
798 Ga0451789_0246594
799 Ga0451791_0150779
800 Ga0451791_1358030
801 Ga0451798_0158997
802 Ga0451800_1332833
803 Ga0451837_1225009
804 Ga0451845_0268253
805 Ga0451843_0180449
806 Ga0451843_0464138
807 Ga0466969_0080831
808 Ga0466972_0060856
809 Ga0466965_0047750
810 Ga0466965_0047949
811 Ga0466965_0167882
812 Ga0466965_0452951
813 Ga0466966_0163200
814 Ga0466966_0169151
815 Ga0466966_0214644
816 Ga0466961_0063316
817 Ga0466961_0133698
818 Ga0466961_0399671
819 Ga0466961_0404991
820 Ga0466963_0020012
821 Ga0466963_0044994
822 Ga0466963_0133400
823 Ga0466964_0008348
824 Ga0466964_0012447
825 Ga0466964_0077278
826 Ga0466971_0029453
827 Ga0466970_0013826
828 Ga0466970_0045611
829 Ga0466970_0082943
830 Ga0466970_0085102
831 Ga0466970_0156977
832 Ga0466970_0246597
833 Ga0466970_0262366
834 Ga0466957_0012740
835 Ga0466957_0146991
836 Ga0466957_0174664
837 Ga0466957_0240740
838 Ga0466957_0350943
839 Ga0466960_0018339
840 Ga0466960_0066661
841 Ga0466960_0096934
842 Ga0466960_0129244
843 Ga0466960_0189944
844 Ga0466960_0199084
845 Ga0466960_0327441
846 Ga0466959_0161782
847 Ga0466959_0211581
848 Ga0451576_0033822
849 Ga0466958_0253839
850 Ga0466967_0014020
851 Ga0466967_0046909
852 Ga0466967_0059623
853 Ga0466967_0085164
854 Ga0466967_0099369
855 Ga0466967_0103995
856 Ga0466967_0222989
857 Ga0466967_0223890
858 Ga0466967_0453172
859 Ga0466967_0655729
860 Ga0495641_0114300
861 Ga0495664_0285523
862 Ga0495630_0642381
863 Ga0495665_0170881
864 Ga0495657_0058020
865 Ga0495658_0172346
866 Ga0496100_0011077
867 Ga0496100_0089094
868 Ga0496100_0153537
869 Ga0496100_0834377
870 Ga0496101_0087943
871 Ga0496101_0144721
872 Ga0496101_0151918
873 Ga0496101_0247766
874 Ga0496102_0016389
875 Ga0496102_0074212
876 Ga0496102_0080391
877 Ga0496102_0159069
878 Ga0496103_0027597
879 Ga0496103_0053466
880 Ga0496103_0136264
881 Ga0496103_0153488
882 Ga0496104_0001682
883 Ga0496104_0319280
884 Ga0496105_0014737
885 Ga0496105_0041488
886 Ga0496105_0595320
887 Ga0496106_0031984
888 Ga0496106_0148078
889 Ga0496106_0301161
890 Ga0496106_0320346
891 Ga0496106_0555235
892 Ga0496107_0086749
893 Ga0496107_0151327
894 Ga0496107_0264365
895 Ga0496108_0166802
896 Ga0496108_0274550
897 Ga0496108_0337224
898 Ga0496108_0351716
899 Ga0496108_0394640
900 Ga0496109_0011176
901 Ga0496109_0024192
902 Ga0496109_0047644
903 Ga0496109_0075850
904 Ga0496109_0128903
905 Ga0496109_0242086
906 Ga0496109_0249389
907 Ga0496109_0514495
908 Ga0496110_0038344
909 Ga0496111_0138030
910 Ga0496111_0155637
911 Ga0496111_0338283
912 Ga0496111_0380400
913 Ga0496111_0413479
914 Ga0496112_0529627
915 Ga0496113_0064020
916 Ga0496113_0577696
917 Ga0496114_0019195
918 Ga0496114_0020655
919 Ga0496114_0040166
920 Ga0496114_0055888
921 Ga0496114_0099061
922 Ga0496114_0170040
923 Ga0496114_0176382
924 Ga0496115_0028756
925 Ga0496115_0036113
926 Ga0496115_0174669
927 Ga0496115_0190329
928 Ga0496124_0278387
929 Ga0501311_018967
930 Ga0501031_0026527
931 Ga0501031_0039926
932 Ga0501031_0045554
933 Ga0501031_0085046
934 Ga0501031_0118539
935 Ga0501031_0283672
936 Ga0501033_0116073
937 Ga0501033_0167934
938 Ga0501034_0201831
939 Ga0501034_0255212
940 Ga0501034_0356802
941 Ga0501034_0670116
942 Ga0501036_0072073
943 Ga0501036_0079913
944 Ga0501036_0118277
945 Ga0501036_0246309
946 Ga0501036_0281785
947 Ga0501037_0031352
948 Ga0501037_0195456
949 Ga0501037_0513857
950 Ga0501038_0017369
951 Ga0501038_0106877
952 Ga0501038_0313817
953 Ga0501038_0433287
954 Ga0501039_0018443
955 Ga0501039_0073471
956 Ga0501039_0141519
957 Ga0501040_0011089
958 Ga0501040_0023657
959 Ga0501040_0064335
960 Ga0501040_0179239
961 Ga0501040_0313196
962 Ga0501040_0317359
963 Ga0501042_0008549
964 Ga0501042_0261557
965 Ga0501042_0275610
966 Ga0501043_0232973
967 Ga0501043_0496425
968 Ga0501046_0002442
969 Ga0501046_0158092
970 Ga0501046_0486539
971 Ga0501048_0021253
972 Ga0501048_0039807
973 Ga0501048_0193583
974 Ga0501048_0198571
975 Ga0501048_0231990
976 Ga0501048_0503370
977 Ga0501048_0664205
978 Ga0501067_0015381
979 Ga0501067_0019936
980 Ga0501067_0030766
981 Ga0501067_0043364
982 Ga0501067_0070776
983 Ga0501067_0092088
984 Ga0501068_0008758
985 Ga0501068_0035749
986 Ga0501068_0096659
987 Ga0501068_0151484
988 Ga0501069_0052876
989 Ga0501069_0065223
990 Ga0501069_0072810
991 Ga0501069_0088223
992 Ga0501069_0090290
993 Ga0501069_0285877
994 Ga0501069_0427277
995 Ga0501070_0003141
996 Ga0501070_0061272
997 Ga0501070_0069265
998 Ga0501070_0105357
999 Ga0501070_0122033
1000 Ga0501070_0153256
1001 Ga0501070_0675695
1002 Ga0501070_0687974
1003 Ga0501070_0913232
1004 Ga0501071_0019623
1005 Ga0501071_0030588
1006 Ga0501071_0074441
1007 Ga0501071_0091801
1008 Ga0501071_0199488
1009 Ga0501071_0208559
1010 Ga0501071_0223950
1011 Ga0501072_0022923
1012 Ga0501072_0066636
1013 Ga0501072_0080470
1014 Ga0501072_0128404
1015 Ga0501072_0217531
1016 Ga0501072_0232732
1017 Ga0501073_0034147
1018 Ga0501073_0134633
1019 Ga0501074_0029635
1020 Ga0501074_0030609
1021 Ga0501074_0258177
1022 Ga0501075_0045373
1023 Ga0501075_0128778
1024 Ga0501076_0006326
1025 Ga0501076_0054789
1026 Ga0501076_0200056
1027 Ga0501076_0233070
1028 Ga0501077_0107424
1029 Ga0501079_0188383
1030 Ga0501079_0313280
1031 Ga0501079_0434564
1032 Ga0501079_0554206
1033 Ga0501080_0256113
1034 Ga0501080_0279324
1035 Ga0501080_0305794
1036 Ga0501035_0254971
1037 Ga0501035_0396253
1038 Ga0501045_0090806
1039 Ga0501045_0167639
1040 Ga0501045_0238918
1041 nmdc:mga03n38_34099_c1
1042 nmdc:mga03n38_5964_c1
1043 nmdc:mga00v17_12221_c1
1044 nmdc:mga00v17_62629_c1
1045 nmdc:mga00v17_6384_c1
1046 nmdc:mga0yw44_14720_c1
1047 nmdc:mga0yw44_14746_c1
1048 nmdc:mga0yw44_245310_c1
1049 nmdc:mga0yw44_28346_c1
1050 nmdc:mga0yw44_292165_c1
1051 nmdc:mga0yw44_46907_c1
1052 nmdc:mga0yw44_517105_c1
1053 nmdc:mga0yw44_61114_c1
1054 nmdc:mga06z11_222492_c1
1055 nmdc:mga06z11_28159_c1
1056 nmdc:mga06z11_53951_c1
1057 nmdc:mga04h51_28328_c1
1058 nmdc:mga04h51_9970_c1
1059 nmdc:mga07m45_16576_c1
1060 nmdc:mga07m45_172453_c1
1061 nmdc:mga07m45_21281_c1
1062 nmdc:mga07m45_56491_c1
1063 nmdc:mga07m45_8828_c1
1064 nmdc:mga0sz30_11971_c1
1065 Ga0495601_0062145
1066 Ga0495595_0032008
1067 Ga0500644_0000352
1068 Ga0500644_0045431
1069 Ga0500554_034778
1070 Ga0500556_0003157
1071 Ga0500593_004364
1072 Ga0501084_0078479
1073 Ga0501084_0110050
1074 Ga0501084_0168186
1075 Ga0501084_0524235
1076 Ga0501082_0017286
1077 Ga0501082_0042593
1078 Ga0501082_0140317
1079 Ga0501082_0254939
1080 Ga0501082_0361195
1081 Ga0501082_0477570
1082 Ga0501082_0798439
1083 Ga0466962_0005875
1084 Ga0530510_0110569
1085 Ga0530510_0159571
1086 Ga0530510_0213652
1087 Ga0530510_0288002
1088 Ga0530510_0532427
1089 Ga0530510_0722334
1090 Ga0530510_0756623
1091 2643892712
1092 2643962161
1093 2644090573
1094 2644232055
1095 2644320330
1096 2740168572
1097 2774395082
1098 2809194087
1099 2812348816
1100 2857485316
1101 2891973420
1102 8054611498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16702

DUF5063

Domain of unknown function (DUF5063)

17

180

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrh-assembly1.cif.gz_A crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.8449 21 169
3nrh-assembly1.cif.gz_B-2 crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.8092 20 169
3nrh-assembly1.cif.gz_A crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.7508 21 169
3nrh-assembly1.cif.gz_B-2 crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309 0.7454 20 169
8c5v-assembly1.cif.gz_D chemotaxis core signalling unit from e protein lysed e. coli cells 0.4755 10 162
ID Description Score Start End Superfamily
af_Q9ZW24_89_225_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.6523 11 65 1.20.1050.10
af_P9WH41_1_86_1.20.58.110 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.5456 1 97 1.20.58.110
af_P9WH41_1_86_1.20.58.110 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.5201 1 97 1.20.58.110
af_I1JR84_1_102_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5029 9 97 1.20.140.40
af_Q8LMI9_88_237_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.4912 11 64 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A4V1VJL6-F1-model_v4 DUF5063 domain-containing protein 0.9509 10 145
AF-A0A429X8L7-F1-model_v4 DUF5063 domain-containing protein 0.9455 96 175
AF-A0A7J9VNY6-F1-model_v4 DUF5063 domain-containing protein 0.9412 10 180
AF-A0A5C4MK62-F1-model_v4 DUF5063 domain-containing protein 0.9369 10 174
AF-A0A3A3Z404-F1-model_v4 DUF5063 domain-containing protein 0.9353 10 182

Map