F462612

General Info

Members Datasets Scaffolds Average Seq Length
551 239 1102 128

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_11503484|Ga0157372_115034842
Length 143
Sequence VHEASRPASGKPPAPRPAPASFDYAILRVVPRAEREEFINAGVVVFCLEKHYLDARILLNNDRLRALWPEVDVDLVLEHLDAVPRICMGDPAAGPIAQLSQRERFHWLTSPRSTIIQPSPVHTGVCDNTEGILDRLATQFLSG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.36
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 4.72
Rhizosphere 92.74
Stem 0
Stem Tuber 0
Unclassified 15.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_11503484 3300013307 Bacteria 776
2 JGI24743J22301_10032700 3300001991 Bacteria 1028
3 rootH2_10139200 3300003320 Bacteria 2079
4 Ga0070683_100004840 3300005329 Bacteria 11148
5 Ga0070683_100084018 3300005329 Bacteria 2983
6 Ga0070683_100142503 3300005329 Bacteria 2271
7 Ga0070683_100243785 3300005329 Bacteria 1709
8 Ga0070683_100447238 3300005329 Unclassified 1233
9 Ga0070683_101021249 3300005329 Bacteria 794
10 Ga0070690_100080414 3300005330 Bacteria 2132
11 Ga0070670_100137652 3300005331 Unclassified 2110
12 Ga0070670_100183292 3300005331 Bacteria 1818
13 Ga0068869_100003876 3300005334 Bacteria 9231
14 Ga0070666_10008579 3300005335 Bacteria 6352
15 Ga0070666_10032261 3300005335 Unclassified 3459
16 Ga0070680_101202045 3300005336 Bacteria 656
17 Ga0068868_100000105 3300005338 Bacteria 52036
18 Ga0068868_100993205 3300005338 Bacteria 767
19 Ga0070689_100029701 3300005340 Bacteria 4141
20 Ga0070689_100060815 3300005340 Bacteria 2937
21 Ga0070691_10074809 3300005341 Bacteria 1649
22 Ga0070687_100186427 3300005343 Bacteria 1247
23 Ga0070661_100149845 3300005344 Bacteria 1763
24 Ga0070661_100156240 3300005344 Bacteria 1726
25 Ga0070661_100381705 3300005344 Bacteria 1111
26 Ga0070661_100416185 3300005344 Unclassified 1065
27 Ga0070661_100466974 3300005344 Unclassified 1006
28 Ga0070661_101538834 3300005344 Bacteria 561
29 Ga0070668_100077885 3300005347 Unclassified 2592
30 Ga0070671_100020864 3300005355 Bacteria 5344
31 Ga0070671_100095749 3300005355 Unclassified 2488
32 Ga0070671_100649258 3300005355 Bacteria 913
33 Ga0070688_100067322 3300005365 Bacteria 2281
34 Ga0070667_100000651 3300005367 Bacteria 33731
35 Ga0070667_100105962 3300005367 Unclassified 2433
36 Ga0070667_100546575 3300005367 Bacteria 1064
37 Ga0070667_100934796 3300005367 Bacteria 808
38 Ga0070667_101616444 3300005367 Bacteria 609
39 Ga0070709_11095537 3300005434 Bacteria 637
40 Ga0070714_100083738 3300005435 Bacteria 2782
41 Ga0070713_100002049 3300005436 Bacteria 13021
42 Ga0070713_100003436 3300005436 Bacteria 10457
43 Ga0070713_100857258 3300005436 Unclassified 872
44 Ga0070711_100271987 3300005439 Unclassified 1337
45 Ga0070700_100334281 3300005441 Bacteria 1117
46 Ga0070663_100019620 3300005455 Bacteria 4462
47 Ga0070663_100020618 3300005455 Bacteria 4365
48 Ga0070663_101001175 3300005455 Bacteria 727
49 Ga0070678_100503527 3300005456 Bacteria 1069
50 Ga0070678_101277558 3300005456 Unclassified 682
51 Ga0070662_100100654 3300005457 Unclassified 2187
52 Ga0068867_100357965 3300005459 Bacteria 1220
53 Ga0068867_100499919 3300005459 Bacteria 1045
54 Ga0068867_101401150 3300005459 Unclassified 648
55 Ga0070679_100026543 3300005530 Bacteria 5692
56 Ga0070679_100720809 3300005530 Bacteria 940
57 Ga0070684_100006547 3300005535 Bacteria 9018
58 Ga0070684_100077874 3300005535 Bacteria 2929
59 Ga0070684_100230781 3300005535 Unclassified 1690
60 Ga0070684_100949043 3300005535 Bacteria 806
61 Ga0068853_100000295 3300005539 Bacteria 34981
62 Ga0068853_100098034 3300005539 Bacteria 2588
63 Ga0068853_100260697 3300005539 Unclassified 1593
64 Ga0068853_100728595 3300005539 Unclassified 947
65 Ga0070672_100012205 3300005543 Bacteria 6020
66 Ga0070672_100346731 3300005543 Bacteria 1265
67 Ga0070693_100211650 3300005547 Bacteria 1265
68 Ga0070665_100004504 3300005548 Bacteria 14615
69 Ga0070665_100020518 3300005548 Bacteria 6638
70 Ga0070665_100105173 3300005548 Bacteria 2824
71 Ga0070665_100336275 3300005548 Bacteria 1514
72 Ga0070665_100666534 3300005548 Bacteria 1053
73 Ga0070665_100835426 3300005548 Bacteria 934
74 Ga0070665_100840657 3300005548 Bacteria 931
75 Ga0070704_100805174 3300005549 Bacteria 840
76 Ga0068855_100002658 3300005563 Bacteria 22024
77 Ga0068855_100034862 3300005563 Bacteria 5997
78 Ga0068855_100124085 3300005563 Bacteria 2954
79 Ga0068855_100190645 3300005563 Bacteria 2313
80 Ga0068855_100326817 3300005563 Bacteria 1694
81 Ga0068855_101224199 3300005563 Unclassified 780
82 Ga0070664_100076228 3300005564 Bacteria 2881
83 Ga0070664_100455803 3300005564 Bacteria 1174
84 Ga0068857_100005173 3300005577 Bacteria 11093
85 Ga0068857_100038028 3300005577 Bacteria 4262
86 Ga0068857_100042580 3300005577 Bacteria 4029
87 Ga0068857_100068844 3300005577 Bacteria 3151
88 Ga0068854_100187602 3300005578 Bacteria 1619
89 Ga0068854_100274081 3300005578 Bacteria 1356
90 Ga0068854_101831989 3300005578 Bacteria 557
91 Ga0068856_100009051 3300005614 Bacteria 9690
92 Ga0068856_100012551 3300005614 Bacteria 8202
93 Ga0068856_100039874 3300005614 Bacteria 4611
94 Ga0068856_100638248 3300005614 Bacteria 1085
95 Ga0068856_101320717 3300005614 Unclassified 736
96 Ga0068852_100000038 3300005616 Bacteria 96977
97 Ga0068852_100000126 3300005616 Bacteria 51078
98 Ga0068852_100133507 3300005616 Bacteria 2289
99 Ga0068852_100411027 3300005616 Bacteria 1333
100 Ga0068852_100534142 3300005616 Bacteria 1171
101 Ga0068852_100554823 3300005616 Bacteria 1149
102 Ga0068852_100582419 3300005616 Bacteria 1122
103 Ga0068852_100980729 3300005616 Unclassified 863
104 Ga0068859_100096403 3300005617 Bacteria 3011
105 Ga0068859_100775905 3300005617 Unclassified 1047
106 Ga0068864_100043475 3300005618 Bacteria 3847
107 Ga0068864_100050805 3300005618 Bacteria 3570
108 Ga0068864_100054792 3300005618 Unclassified 3442
109 Ga0068851_10003526 3300005834 Bacteria 6960
110 Ga0068851_10007445 3300005834 Bacteria 5027
111 Ga0068851_10010614 3300005834 Bacteria 4301
112 Ga0068851_10170317 3300005834 Bacteria 1201
113 Ga0068870_10100482 3300005840 Bacteria 1634
114 Ga0068863_100006410 3300005841 Bacteria 11538
115 Ga0068863_100139187 3300005841 Bacteria 2319
116 Ga0068863_100511974 3300005841 Bacteria 1183
117 Ga0068858_100000902 3300005842 Bacteria 30778
118 Ga0068858_100014634 3300005842 Bacteria 7388
119 Ga0068858_100579699 3300005842 Bacteria 1087
120 Ga0068860_100000496 3300005843 Bacteria 48781
121 Ga0068860_100446031 3300005843 Bacteria 1286
122 Ga0068860_100685599 3300005843 Unclassified 1034
123 Ga0068860_101572631 3300005843 Bacteria 679
124 Ga0068860_101705129 3300005843 Bacteria 652
125 Ga0081455_10061711 3300005937 Bacteria 3153
126 Ga0081539_10376363 3300005985 Bacteria 593
127 Ga0070717_10000506 3300006028 Bacteria 24729
128 Ga0070717_10000599 3300006028 Bacteria 23137
129 Ga0070717_10004080 3300006028 Bacteria 10535
130 Ga0075367_10743633 3300006178 Bacteria 624
131 Ga0097621_100019780 3300006237 Bacteria 5177
132 Ga0097621_100088678 3300006237 Unclassified 2585
133 Ga0097621_100145161 3300006237 Bacteria 2031
134 Ga0097621_101075093 3300006237 Unclassified 754
135 Ga0068871_100002256 3300006358 Bacteria 13106
136 Ga0068871_100342851 3300006358 Bacteria 1320
137 Ga0068871_100602963 3300006358 Unclassified 999
138 Ga0068871_100629455 3300006358 Unclassified 978
139 Ga0068865_100638592 3300006881 Bacteria 904
140 Ga0097620_100096406 3300006931 Bacteria 3011
141 Ga0097620_100776051 3300006931 Unclassified 1047
142 Ga0075435_100448018 3300007076 Bacteria 1113
143 Ga0105251_10092796 3300009011 Bacteria 1385
144 Ga0105250_10332249 3300009092 Bacteria 662
145 Ga0105240_10002110 3300009093 Bacteria 32523
146 Ga0105240_10004871 3300009093 Bacteria 20199
147 Ga0105240_10006074 3300009093 Bacteria 17835
148 Ga0105240_10016456 3300009093 Bacteria 10009
149 Ga0105240_10079382 3300009093 Bacteria 4038
150 Ga0105240_10308440 3300009093 Bacteria 1808
151 Ga0105240_10314669 3300009093 Bacteria 1786
152 Ga0105240_10449384 3300009093 Bacteria 1442
153 Ga0105240_11260533 3300009093 Bacteria 781
154 Ga0105240_11563993 3300009093 Bacteria 690
155 Ga0111539_10070862 3300009094 Bacteria 4114
156 Ga0105245_10002358 3300009098 Bacteria 17074
157 Ga0105245_10024501 3300009098 Bacteria 5299
158 Ga0105245_10120452 3300009098 Bacteria 2451
159 Ga0105245_10180482 3300009098 Bacteria 2016
160 Ga0105245_10366732 3300009098 Bacteria 1431
161 Ga0105247_10037345 3300009101 Bacteria 2965
162 Ga0105247_10547996 3300009101 Bacteria 850
163 Ga0114129_13439236 3300009147 Bacteria 508
164 Ga0105243_10899353 3300009148 Bacteria 880
165 Ga0105241_10000195 3300009174 Bacteria 45500
166 Ga0105241_10038105 3300009174 Unclassified 3625
167 Ga0105241_10084368 3300009174 Unclassified 2494
168 Ga0105241_10244769 3300009174 Bacteria 1518
169 Ga0105241_10751747 3300009174 Bacteria 894
170 Ga0105248_10002821 3300009177 Bacteria 19283
171 Ga0105248_10004150 3300009177 Bacteria 16023
172 Ga0105248_10015464 3300009177 Bacteria 8412
173 Ga0105248_10138611 3300009177 Unclassified 2744
174 Ga0105248_10302893 3300009177 Unclassified 1800
175 Ga0105248_10460425 3300009177 Bacteria 1434
176 Ga0105248_10657751 3300009177 Bacteria 1182
177 Ga0105248_10900690 3300009177 Bacteria 999
178 Ga0105237_10003071 3300009545 Bacteria 20131
179 Ga0105237_10099077 3300009545 Bacteria 2906
180 Ga0105237_10168409 3300009545 Bacteria 2190
181 Ga0105237_10378012 3300009545 Bacteria 1421
182 Ga0105237_10442186 3300009545 Bacteria 1306
183 Ga0105237_11842556 3300009545 Bacteria 613
184 Ga0105238_10002752 3300009551 Bacteria 17526
185 Ga0105238_10005226 3300009551 Bacteria 12825
186 Ga0105238_10232698 3300009551 Bacteria 1819
187 Ga0105238_10465126 3300009551 Bacteria 1263
188 Ga0105238_10545343 3300009551 Bacteria 1164
189 Ga0105238_10920979 3300009551 Bacteria 893
190 Ga0105249_10048005 3300009553 Bacteria 3892
191 Ga0105249_11509714 3300009553 Bacteria 744
192 Ga0105239_10015929 3300010375 Bacteria 8320
193 Ga0105239_10017289 3300010375 Bacteria 7975
194 Ga0105239_10127456 3300010375 Bacteria 2830
195 Ga0105239_10193262 3300010375 Unclassified 2278
196 Ga0105239_10407211 3300010375 Bacteria 1540
197 Ga0105239_11266963 3300010375 Unclassified 850
198 Ga0105239_11641716 3300010375 Bacteria 744
199 Ga0105246_10003602 3300011119 Bacteria 9371
200 Ga0105246_10563628 3300011119 Bacteria 978
201 Ga0157373_10137559 3300013100 Bacteria 1718
202 Ga0157373_10509006 3300013100 Bacteria 870
203 Ga0157370_10000102 3300013104 Bacteria 97420
204 Ga0157370_10005045 3300013104 Bacteria 14914
205 Ga0157370_10505563 3300013104 Bacteria 1110
206 Ga0157369_10000154 3300013105 Bacteria 97000
207 Ga0157369_10001433 3300013105 Bacteria 29260
208 Ga0157369_10001836 3300013105 Bacteria 25661
209 Ga0157369_10101200 3300013105 Bacteria 3071
210 Ga0157369_10108797 3300013105 Bacteria 2948
211 Ga0157369_10120387 3300013105 Bacteria 2785
212 Ga0157369_10233718 3300013105 Bacteria 1921
213 Ga0157369_10237326 3300013105 Unclassified 1905
214 Ga0157369_10330877 3300013105 Bacteria 1583
215 Ga0157374_10003587 3300013296 Bacteria 13067
216 Ga0157374_10005653 3300013296 Bacteria 10544
217 Ga0157374_10022904 3300013296 Bacteria 5578
218 Ga0157374_10236813 3300013296 Bacteria 1794
219 Ga0157374_10486708 3300013296 Unclassified 1237
220 Ga0157374_10561141 3300013296 Bacteria 1150
221 Ga0157374_10706803 3300013296 Unclassified 1021
222 Ga0157374_10998855 3300013296 Unclassified 856
223 Ga0157378_10008988 3300013297 Bacteria 8698
224 Ga0157378_10030917 3300013297 Bacteria 4727
225 Ga0157378_10063867 3300013297 Bacteria 3291
226 Ga0157378_10079342 3300013297 Bacteria 2963
227 Ga0157378_10580370 3300013297 Unclassified 1130
228 Ga0163162_10004399 3300013306 Bacteria 13558
229 Ga0163162_10155368 3300013306 Unclassified 2408
230 Ga0163162_10265151 3300013306 Bacteria 1849
231 Ga0163162_10488700 3300013306 Bacteria 1362
232 Ga0163162_11009097 3300013306 Unclassified 941
233 Ga0163162_12033434 3300013306 Bacteria 659
234 Ga0157372_10000082 3300013307 Bacteria 99224
235 Ga0157372_10018355 3300013307 Bacteria 7518
236 Ga0157372_10037858 3300013307 Bacteria 5322
237 Ga0157372_10082279 3300013307 Unclassified 3644
238 Ga0157372_10137433 3300013307 Bacteria 2815
239 Ga0157372_10243302 3300013307 Bacteria 2087
240 Ga0157372_10249860 3300013307 Bacteria 2059
241 Ga0157372_10253055 3300013307 Bacteria 2045
242 Ga0157372_10414376 3300013307 Bacteria 1570
243 Ga0157372_11166657 3300013307 Unclassified 890
244 Ga0157375_10309316 3300013308 Bacteria 1744
245 Ga0157375_10417347 3300013308 Bacteria 1508
246 Ga0157375_10786705 3300013308 Bacteria 1101
247 Ga0157375_11226053 3300013308 Bacteria 881
248 Ga0157375_11845663 3300013308 Unclassified 717
249 Ga0163163_10005405 3300014325 Bacteria 11041
250 Ga0163163_10014646 3300014325 Bacteria 7212
251 Ga0163163_10205345 3300014325 Unclassified 2019
252 Ga0163163_10384501 3300014325 Bacteria 1461
253 Ga0157377_10353722 3300014745 Bacteria 986
254 Ga0157379_10002904 3300014968 Bacteria 14462
255 Ga0157379_10300491 3300014968 Bacteria 1463
256 Ga0157376_10223468 3300014969 Bacteria 1745
257 Ga0157376_10232510 3300014969 Bacteria 1713
258 Ga0157376_10363881 3300014969 Bacteria 1388
259 Ga0157376_11597311 3300014969 Bacteria 686
260 Ga0213872_10030523 3300021361 Bacteria 2470
261 Ga0213876_10079646 3300021384 Bacteria 1731
262 Ga0207697_10203212 3300025315 Unclassified 872
263 Ga0207656_10004070 3300025321 Bacteria 5074
264 Ga0207656_10008119 3300025321 Bacteria 3852
265 Ga0207656_10045116 3300025321 Bacteria 1885
266 Ga0207656_10237476 3300025321 Bacteria 890
267 Ga0207692_10160568 3300025898 Unclassified 1295
268 Ga0207710_10029756 3300025900 Unclassified 2379
269 Ga0207680_10026445 3300025903 Bacteria 3217
270 Ga0207680_10054008 3300025903 Bacteria 2415
271 Ga0207680_11223420 3300025903 Bacteria 535
272 Ga0207699_10649436 3300025906 Bacteria 770
273 Ga0207645_10036280 3300025907 Unclassified 3165
274 Ga0207643_10016314 3300025908 Bacteria 4050
275 Ga0207705_10069414 3300025909 Unclassified 2552
276 Ga0207705_10170551 3300025909 Bacteria 1638
277 Ga0207654_10000087 3300025911 Bacteria 61321
278 Ga0207654_10000896 3300025911 Bacteria 16503
279 Ga0207654_10143295 3300025911 Bacteria 1526
280 Ga0207654_10747981 3300025911 Bacteria 704
281 Ga0207707_10029000 3300025912 Bacteria 4837
282 Ga0207695_10000030 3300025913 Bacteria 533735
283 Ga0207695_10000035 3300025913 Bacteria 486590
284 Ga0207695_10000724 3300025913 Bacteria 64098
285 Ga0207695_10001562 3300025913 Bacteria 37528
286 Ga0207695_10004329 3300025913 Bacteria 19447
287 Ga0207695_10054313 3300025913 Bacteria 4185
288 Ga0207695_10343287 3300025913 Bacteria 1381
289 Ga0207671_10000042 3300025914 Bacteria 209966
290 Ga0207671_10000399 3300025914 Bacteria 60606
291 Ga0207671_10310402 3300025914 Bacteria 1247
292 Ga0207663_10262867 3300025916 Unclassified 1275
293 Ga0207662_10178579 3300025918 Bacteria 1365
294 Ga0207657_10006298 3300025919 Bacteria 12329
295 Ga0207649_10042459 3300025920 Bacteria 2774
296 Ga0207649_10120465 3300025920 Bacteria 1768
297 Ga0207649_10145298 3300025920 Bacteria 1627
298 Ga0207649_10193340 3300025920 Bacteria 1432
299 Ga0207652_10015348 3300025921 Bacteria 6220
300 Ga0207652_10638577 3300025921 Bacteria 952
301 Ga0207694_10000040 3300025924 Bacteria 184281
302 Ga0207694_10000182 3300025924 Bacteria 64717
303 Ga0207694_10002297 3300025924 Bacteria 15633
304 Ga0207694_10022872 3300025924 Bacteria 4742
305 Ga0207650_10189840 3300025925 Bacteria 1641
306 Ga0207687_10004181 3300025927 Bacteria 9666
307 Ga0207687_10057723 3300025927 Unclassified 2728
308 Ga0207687_10165547 3300025927 Bacteria 1701
309 Ga0207687_10741192 3300025927 Bacteria 836
310 Ga0207687_10757928 3300025927 Unclassified 826
311 Ga0207700_10002575 3300025928 Bacteria 10415
312 Ga0207700_10013509 3300025928 Bacteria 5317
313 Ga0207664_10075508 3300025929 Bacteria 2725
314 Ga0207644_10022052 3300025931 Bacteria 4346
315 Ga0207644_10030973 3300025931 Unclassified 3725
316 Ga0207644_10100977 3300025931 Bacteria 2167
317 Ga0207644_10101772 3300025931 Bacteria 2160
318 Ga0207644_10417738 3300025931 Bacteria 1098
319 Ga0207690_11306937 3300025932 Bacteria 606
320 Ga0207706_10015754 3300025933 Bacteria 6833
321 Ga0207686_10158371 3300025934 Bacteria 1584
322 Ga0207709_10248443 3300025935 Bacteria 1298
323 Ga0207670_10012503 3300025936 Bacteria 4969
324 Ga0207670_10156754 3300025936 Bacteria 1696
325 Ga0207669_10033351 3300025937 Bacteria 2905
326 Ga0207704_10556694 3300025938 Bacteria 933
327 Ga0207665_11693785 3300025939 Bacteria 500
328 Ga0207691_10006485 3300025940 Bacteria 11296
329 Ga0207711_10001725 3300025941 Bacteria 20060
330 Ga0207711_10068928 3300025941 Bacteria 3065
331 Ga0207711_10138925 3300025941 Bacteria 2184
332 Ga0207711_10251543 3300025941 Unclassified 1623
333 Ga0207711_10762192 3300025941 Bacteria 902
334 Ga0207711_11067039 3300025941 Bacteria 748
335 Ga0207689_10000252 3300025942 Bacteria 47997
336 Ga0207689_10008741 3300025942 Bacteria 8810
337 Ga0207689_10043078 3300025942 Bacteria 3732
338 Ga0207661_10065380 3300025944 Bacteria 2952
339 Ga0207661_10108306 3300025944 Bacteria 2345
340 Ga0207661_10120980 3300025944 Bacteria 2229
341 Ga0207661_10186614 3300025944 Unclassified 1815
342 Ga0207661_10310959 3300025944 Bacteria 1414
343 Ga0207661_10551279 3300025944 Bacteria 1056
344 Ga0207679_10272462 3300025945 Bacteria 1448
345 Ga0207679_10661528 3300025945 Bacteria 945
346 Ga0207667_10001757 3300025949 Bacteria 27270
347 Ga0207667_10010077 3300025949 Bacteria 11080
348 Ga0207667_10015320 3300025949 Bacteria 8717
349 Ga0207667_10273645 3300025949 Bacteria 1726
350 Ga0207667_10351253 3300025949 Bacteria 1504
351 Ga0207667_10423204 3300025949 Bacteria 1355
352 Ga0207667_10498606 3300025949 Bacteria 1235
353 Ga0207667_10819374 3300025949 Unclassified 926
354 Ga0207667_11303121 3300025949 Unclassified 703
355 Ga0207712_10110632 3300025961 Bacteria 2060
356 Ga0207712_11276787 3300025961 Bacteria 656
357 Ga0207712_11613237 3300025961 Unclassified 581
358 Ga0207668_10131127 3300025972 Unclassified 1914
359 Ga0207640_10056414 3300025981 Bacteria 2578
360 Ga0207640_10132104 3300025981 Bacteria 1806
361 Ga0207658_10003248 3300025986 Bacteria 11557
362 Ga0207658_10031703 3300025986 Unclassified 3756
363 Ga0207658_10730903 3300025986 Bacteria 896
364 Ga0207677_10000182 3300026023 Bacteria 50275
365 Ga0207677_10095467 3300026023 Bacteria 2173
366 Ga0207677_10267113 3300026023 Bacteria 1398
367 Ga0207703_10004176 3300026035 Bacteria 11908
368 Ga0207703_10192373 3300026035 Unclassified 1808
369 Ga0207639_10000156 3300026041 Bacteria 51907
370 Ga0207639_10012331 3300026041 Bacteria 5952
371 Ga0207639_10396083 3300026041 Unclassified 1243
372 Ga0207639_10757196 3300026041 Unclassified 903
373 Ga0207678_10000652 3300026067 Bacteria 31871
374 Ga0207678_10088717 3300026067 Bacteria 2643
375 Ga0207678_10195949 3300026067 Bacteria 1727
376 Ga0207678_10532760 3300026067 Bacteria 1026
377 Ga0207708_10099869 3300026075 Bacteria 2245
378 Ga0207702_10000879 3300026078 Bacteria 31279
379 Ga0207702_10001552 3300026078 Bacteria 22724
380 Ga0207702_10042401 3300026078 Bacteria 3817
381 Ga0207702_10408567 3300026078 Bacteria 1310
382 Ga0207641_10035842 3300026088 Unclassified 4137
383 Ga0207641_10123817 3300026088 Bacteria 2311
384 Ga0207641_10512324 3300026088 Bacteria 1166
385 Ga0207641_11416980 3300026088 Bacteria 696
386 Ga0207648_10170167 3300026089 Bacteria 1926
387 Ga0207676_10052395 3300026095 Bacteria 3189
388 Ga0207674_10000760 3300026116 Bacteria 42101
389 Ga0207674_10000847 3300026116 Bacteria 39909
390 Ga0207674_10016470 3300026116 Bacteria 8090
391 Ga0207674_10425426 3300026116 Unclassified 1283
392 Ga0207683_10014450 3300026121 Bacteria 6723
393 Ga0207683_10157791 3300026121 Bacteria 2050
394 Ga0207683_10241419 3300026121 Unclassified 1648
395 Ga0207683_10334250 3300026121 Bacteria 1389
396 Ga0207698_10000032 3300026142 Bacteria 112742
397 Ga0207698_10000088 3300026142 Bacteria 60215
398 Ga0207698_10315440 3300026142 Bacteria 1462
399 Ga0207698_10481910 3300026142 Unclassified 1203
400 Ga0207698_10563990 3300026142 Unclassified 1118
401 Ga0207698_11049329 3300026142 Bacteria 827
402 Ga0207698_12531135 3300026142 Bacteria 523
403 Ga0207428_10609979 3300027907 Bacteria 786
404 Ga0268266_10001149 3300028379 Bacteria 32866
405 Ga0268266_10003798 3300028379 Bacteria 14770
406 Ga0268266_10120302 3300028379 Bacteria 2336
407 Ga0268266_10133264 3300028379 Bacteria 2224
408 Ga0268266_10196630 3300028379 Bacteria 1844
409 Ga0268266_10311733 3300028379 Bacteria 1470
410 Ga0268266_10485559 3300028379 Bacteria 1178
411 Ga0268264_10000806 3300028381 Bacteria 33786
412 Ga0268264_10265060 3300028381 Bacteria 1603
413 Ga0268264_10773363 3300028381 Bacteria 958
414 Ga0268264_10879440 3300028381 Unclassified 898
415 Ga0265324_10144727 3300029957 Bacteria 807
416 Ga0265770_1005575 3300030878 Bacteria 1739
417 Ga0265760_10237547 3300031090 Bacteria 627
418 Ga0265330_10068123 3300031235 Bacteria 1542
419 Ga0265332_10182452 3300031238 Bacteria 874
420 Ga0265328_10008482 3300031239 Bacteria 4233
421 Ga0265328_10040372 3300031239 Unclassified 1720
422 Ga0265328_10155449 3300031239 Unclassified 861
423 Ga0265325_10214987 3300031241 Bacteria 882
424 Ga0265339_10000104 3300031249 Bacteria 68615
425 Ga0265339_10005077 3300031249 Bacteria 8841
426 Ga0265316_10006567 3300031344 Bacteria 11094
427 Ga0265316_10063425 3300031344 Unclassified 2865
428 Ga0265316_10067174 3300031344 Unclassified 2773
429 Ga0265316_10554132 3300031344 Bacteria 818
430 Ga0265314_10008597 3300031711 Bacteria 8732
431 Ga0265314_10120994 3300031711 Bacteria 1648
432 Ga0265314_10197123 3300031711 Unclassified 1193
433 Ga0265342_10018393 3300031712 Bacteria 4528
434 Ga0265342_10019214 3300031712 Bacteria 4408
435 Ga0265342_10041486 3300031712 Bacteria 2786
436 Ga0265342_10070602 3300031712 Unclassified 2037
437 Ga0307405_11288445 3300031731 Bacteria 635
438 Ga0307510_10178835 3300033180 Bacteria 1687
439 Ga0373954_0511768 3300035118 Bacteria 595
440 Ga0373957_0293906 3300035120 Bacteria 688
441 Ga0373924_0318731 3300035410 Bacteria 691
442 Ga0373933_0137546 3300035724 Bacteria 1540
443 Ga0373933_0725621 3300035724 Unclassified 654
444 Ga0373937_0001732 3300036401 Bacteria 18338
445 Ga0373937_0584658 3300036401 Bacteria 1060
446 Ga0373937_0622092 3300036401 Bacteria 1025
447 Ga0395900_1638397 3300037418 Bacteria 555
448 Ga0395905_1141566 3300037471 Unclassified 683
449 Ga0436365_0753779 3300039437 Bacteria 4918
450 Ga0436361_0637343 3300039447 Bacteria 20338
451 Ga0466961_0024763 3300044693 Bacteria 3861
452 Ga0466961_0074472 3300044693 Bacteria 2153
453 Ga0466963_0159377 3300044694 Bacteria 1570
454 Ga0466957_1157029 3300044842 Bacteria 559
455 Ga0466967_0116646 3300045976 Bacteria 2460
456 Ga0495629_0161580 3300046459 Bacteria 1556
457 Ga0495629_0388979 3300046459 Bacteria 948
458 Ga0495650_0000006 3300046471 Bacteria 721347
459 Ga0495650_0280631 3300046471 Bacteria 561
460 Ga0495583_0354099 3300046506 Bacteria 579
461 Ga0495642_0037135 3300046528 Bacteria 1970
462 Ga0495587_0249135 3300046536 Unclassified 999
463 Ga0495609_0006525 3300046538 Bacteria 5944
464 Ga0495645_0640904 3300046543 Unclassified 650
465 Ga0495668_0064845 3300046616 Bacteria 2010
466 Ga0495634_0226372 3300046642 Unclassified 1152
467 Ga0495625_0000087 3300046660 Bacteria 151648
468 Ga0495625_0824883 3300046660 Bacteria 537
469 Ga0495659_0074025 3300046664 Bacteria 1281
470 Ga0495661_0077902 3300046665 Bacteria 1919
471 Ga0495623_0195033 3300046679 Bacteria 1168
472 Ga0495623_0363991 3300046679 Unclassified 785
473 Ga0495613_0846837 3300046689 Unclassified 594
474 Ga0495636_0022750 3300047318 Bacteria 2536
475 Ga0495674_0112558 3300047319 Bacteria 2306
476 Ga0495673_0060037 3300047469 Bacteria 1632
477 Ga0495686_0131513 3300047472 Bacteria 1483
478 Ga0495602_0297669 3300048088 Bacteria 1182
479 Ga0496100_0043376 3300048903 Bacteria 2876
480 Ga0496101_0323506 3300048904 Unclassified 1210
481 Ga0496102_0281867 3300048905 Bacteria 1566
482 Ga0496102_0739596 3300048905 Bacteria 906
483 Ga0496103_0444851 3300048906 Bacteria 831
484 Ga0496103_0977057 3300048906 Bacteria 528
485 Ga0496104_0019217 3300048907 Bacteria 6247
486 Ga0496104_0089020 3300048907 Bacteria 2949
487 Ga0496105_0100069 3300048908 Bacteria 2394
488 Ga0496105_0102538 3300048908 Bacteria 2363
489 Ga0496105_0404834 3300048908 Bacteria 1083
490 Ga0496106_0133964 3300048909 Bacteria 1944
491 Ga0496107_0014218 3300048910 Bacteria 5573
492 Ga0496107_0056513 3300048910 Bacteria 2836
493 Ga0496108_0328229 3300048911 Bacteria 1334
494 Ga0496109_0023766 3300048912 Bacteria 5440
495 Ga0496109_0792791 3300048912 Bacteria 885
496 Ga0496110_0338641 3300048913 Bacteria 1370
497 Ga0496112_0285593 3300048915 Bacteria 1596
498 Ga0496112_1407244 3300048915 Bacteria 612
499 Ga0496113_0062725 3300048916 Bacteria 2807
500 Ga0496113_0822257 3300048916 Bacteria 737
501 Ga0496114_0054273 3300048917 Bacteria 3342
502 Ga0496115_0141841 3300048918 Bacteria 1982
503 Ga0496115_0237552 3300048918 Bacteria 1502
504 Ga0496115_1053497 3300048918 Bacteria 619
505 Ga0496119_0207897 3300048922 Bacteria 1009
506 Ga0496126_0001081 3300048929 Bacteria 45843
507 Ga0496126_0037747 3300048929 Bacteria 4504
508 Ga0495682_0075779 3300049460 Bacteria 1210
509 Ga0501031_0098356 3300049568 Bacteria 1909
510 Ga0501033_0007229 3300049570 Bacteria 8662
511 Ga0501033_0071622 3300049570 Bacteria 2546
512 Ga0501034_0033854 3300049571 Bacteria 5180
513 Ga0501034_1089838 3300049571 Unclassified 680
514 Ga0501036_0001846 3300049572 Bacteria 16433
515 Ga0501037_0045913 3300049573 Bacteria 3205
516 Ga0501037_0113465 3300049573 Bacteria 1951
517 Ga0501038_0067389 3300049574 Bacteria 3045
518 Ga0501039_0072167 3300049575 Bacteria 2683
519 Ga0501040_0807468 3300049576 Bacteria 679
520 Ga0501043_0015045 3300049579 Bacteria 6059
521 Ga0501046_0000386 3300049580 Bacteria 44282
522 Ga0501047_0004467 3300049581 Bacteria 13163
523 Ga0501047_0093407 3300049581 Bacteria 2887
524 Ga0501047_0734053 3300049581 Bacteria 804
525 Ga0501048_0100645 3300049582 Bacteria 2039
526 Ga0501067_0076559 3300049583 Bacteria 1854
527 Ga0501069_0655785 3300049585 Bacteria 632
528 Ga0501070_0354816 3300049586 Bacteria 1190
529 Ga0501073_0093368 3300049589 Bacteria 2091
530 Ga0501074_0036509 3300049590 Bacteria 3560
531 Ga0501235_062735 3300049669 Bacteria 872
532 Ga0501238_005496 3300049671 Bacteria 1609
533 Ga0501079_0370473 3300049741 Bacteria 1123
534 Ga0501080_0016760 3300049742 Bacteria 6767
535 Ga0501035_0010324 3300049822 Bacteria 8662
536 Ga0501035_0448358 3300049822 Bacteria 1068
537 Ga0501044_0023053 3300049823 Bacteria 6626
538 Ga0501044_0217532 3300049823 Bacteria 1862
539 nmdc:mga08y16_220476_c1 3300050511 Bacteria 1964
540 nmdc:mga0rr50_577229_c1 3300050513 Bacteria 958
541 Ga0495601_0131376 3300053077 Bacteria 1631
542 Ga0495601_0650259 3300053077 Unclassified 675
543 Ga0495619_0217692 3300053085 Bacteria 1323
544 Ga0500643_057527 3300053087 Bacteria 1097
545 Ga0500651_0000039 3300053093 Bacteria 96498
546 Ga0500595_029241 3300053119 Bacteria 1871
547 Ga0500614_205459 3300053123 Bacteria 608
548 Ga0500620_158492 3300053155 Bacteria 786
549 Ga0500661_001793 3300055283 Bacteria 4048
550 Ga0501082_0324522 3300060353 Bacteria 1341
551 2884218553 2884215851 Bacteria 4554841
552 Ga0157372_11503484
553 JGI24743J22301_10032700
554 rootH2_10139200
555 Ga0070683_100004840
556 Ga0070683_100084018
557 Ga0070683_100142503
558 Ga0070683_100243785
559 Ga0070683_100447238
560 Ga0070683_101021249
561 Ga0070690_100080414
562 Ga0070670_100137652
563 Ga0070670_100183292
564 Ga0068869_100003876
565 Ga0070666_10008579
566 Ga0070666_10032261
567 Ga0070680_101202045
568 Ga0068868_100000105
569 Ga0068868_100993205
570 Ga0070689_100029701
571 Ga0070689_100060815
572 Ga0070691_10074809
573 Ga0070687_100186427
574 Ga0070661_100149845
575 Ga0070661_100156240
576 Ga0070661_100381705
577 Ga0070661_100416185
578 Ga0070661_100466974
579 Ga0070661_101538834
580 Ga0070668_100077885
581 Ga0070671_100020864
582 Ga0070671_100095749
583 Ga0070671_100649258
584 Ga0070688_100067322
585 Ga0070667_100000651
586 Ga0070667_100105962
587 Ga0070667_100546575
588 Ga0070667_100934796
589 Ga0070667_101616444
590 Ga0070709_11095537
591 Ga0070714_100083738
592 Ga0070713_100002049
593 Ga0070713_100003436
594 Ga0070713_100857258
595 Ga0070711_100271987
596 Ga0070700_100334281
597 Ga0070663_100019620
598 Ga0070663_100020618
599 Ga0070663_101001175
600 Ga0070678_100503527
601 Ga0070678_101277558
602 Ga0070662_100100654
603 Ga0068867_100357965
604 Ga0068867_100499919
605 Ga0068867_101401150
606 Ga0070679_100026543
607 Ga0070679_100720809
608 Ga0070684_100006547
609 Ga0070684_100077874
610 Ga0070684_100230781
611 Ga0070684_100949043
612 Ga0068853_100000295
613 Ga0068853_100098034
614 Ga0068853_100260697
615 Ga0068853_100728595
616 Ga0070672_100012205
617 Ga0070672_100346731
618 Ga0070693_100211650
619 Ga0070665_100004504
620 Ga0070665_100020518
621 Ga0070665_100105173
622 Ga0070665_100336275
623 Ga0070665_100666534
624 Ga0070665_100835426
625 Ga0070665_100840657
626 Ga0070704_100805174
627 Ga0068855_100002658
628 Ga0068855_100034862
629 Ga0068855_100124085
630 Ga0068855_100190645
631 Ga0068855_100326817
632 Ga0068855_101224199
633 Ga0070664_100076228
634 Ga0070664_100455803
635 Ga0068857_100005173
636 Ga0068857_100038028
637 Ga0068857_100042580
638 Ga0068857_100068844
639 Ga0068854_100187602
640 Ga0068854_100274081
641 Ga0068854_101831989
642 Ga0068856_100009051
643 Ga0068856_100012551
644 Ga0068856_100039874
645 Ga0068856_100638248
646 Ga0068856_101320717
647 Ga0068852_100000038
648 Ga0068852_100000126
649 Ga0068852_100133507
650 Ga0068852_100411027
651 Ga0068852_100534142
652 Ga0068852_100554823
653 Ga0068852_100582419
654 Ga0068852_100980729
655 Ga0068859_100096403
656 Ga0068859_100775905
657 Ga0068864_100043475
658 Ga0068864_100050805
659 Ga0068864_100054792
660 Ga0068851_10003526
661 Ga0068851_10007445
662 Ga0068851_10010614
663 Ga0068851_10170317
664 Ga0068870_10100482
665 Ga0068863_100006410
666 Ga0068863_100139187
667 Ga0068863_100511974
668 Ga0068858_100000902
669 Ga0068858_100014634
670 Ga0068858_100579699
671 Ga0068860_100000496
672 Ga0068860_100446031
673 Ga0068860_100685599
674 Ga0068860_101572631
675 Ga0068860_101705129
676 Ga0081455_10061711
677 Ga0081539_10376363
678 Ga0070717_10000506
679 Ga0070717_10000599
680 Ga0070717_10004080
681 Ga0075367_10743633
682 Ga0097621_100019780
683 Ga0097621_100088678
684 Ga0097621_100145161
685 Ga0097621_101075093
686 Ga0068871_100002256
687 Ga0068871_100342851
688 Ga0068871_100602963
689 Ga0068871_100629455
690 Ga0068865_100638592
691 Ga0097620_100096406
692 Ga0097620_100776051
693 Ga0075435_100448018
694 Ga0105251_10092796
695 Ga0105250_10332249
696 Ga0105240_10002110
697 Ga0105240_10004871
698 Ga0105240_10006074
699 Ga0105240_10016456
700 Ga0105240_10079382
701 Ga0105240_10308440
702 Ga0105240_10314669
703 Ga0105240_10449384
704 Ga0105240_11260533
705 Ga0105240_11563993
706 Ga0111539_10070862
707 Ga0105245_10002358
708 Ga0105245_10024501
709 Ga0105245_10120452
710 Ga0105245_10180482
711 Ga0105245_10366732
712 Ga0105247_10037345
713 Ga0105247_10547996
714 Ga0114129_13439236
715 Ga0105243_10899353
716 Ga0105241_10000195
717 Ga0105241_10038105
718 Ga0105241_10084368
719 Ga0105241_10244769
720 Ga0105241_10751747
721 Ga0105248_10002821
722 Ga0105248_10004150
723 Ga0105248_10015464
724 Ga0105248_10138611
725 Ga0105248_10302893
726 Ga0105248_10460425
727 Ga0105248_10657751
728 Ga0105248_10900690
729 Ga0105237_10003071
730 Ga0105237_10099077
731 Ga0105237_10168409
732 Ga0105237_10378012
733 Ga0105237_10442186
734 Ga0105237_11842556
735 Ga0105238_10002752
736 Ga0105238_10005226
737 Ga0105238_10232698
738 Ga0105238_10465126
739 Ga0105238_10545343
740 Ga0105238_10920979
741 Ga0105249_10048005
742 Ga0105249_11509714
743 Ga0105239_10015929
744 Ga0105239_10017289
745 Ga0105239_10127456
746 Ga0105239_10193262
747 Ga0105239_10407211
748 Ga0105239_11266963
749 Ga0105239_11641716
750 Ga0105246_10003602
751 Ga0105246_10563628
752 Ga0157373_10137559
753 Ga0157373_10509006
754 Ga0157370_10000102
755 Ga0157370_10005045
756 Ga0157370_10505563
757 Ga0157369_10000154
758 Ga0157369_10001433
759 Ga0157369_10001836
760 Ga0157369_10101200
761 Ga0157369_10108797
762 Ga0157369_10120387
763 Ga0157369_10233718
764 Ga0157369_10237326
765 Ga0157369_10330877
766 Ga0157374_10003587
767 Ga0157374_10005653
768 Ga0157374_10022904
769 Ga0157374_10236813
770 Ga0157374_10486708
771 Ga0157374_10561141
772 Ga0157374_10706803
773 Ga0157374_10998855
774 Ga0157378_10008988
775 Ga0157378_10030917
776 Ga0157378_10063867
777 Ga0157378_10079342
778 Ga0157378_10580370
779 Ga0163162_10004399
780 Ga0163162_10155368
781 Ga0163162_10265151
782 Ga0163162_10488700
783 Ga0163162_11009097
784 Ga0163162_12033434
785 Ga0157372_10000082
786 Ga0157372_10018355
787 Ga0157372_10037858
788 Ga0157372_10082279
789 Ga0157372_10137433
790 Ga0157372_10243302
791 Ga0157372_10249860
792 Ga0157372_10253055
793 Ga0157372_10414376
794 Ga0157372_11166657
795 Ga0157375_10309316
796 Ga0157375_10417347
797 Ga0157375_10786705
798 Ga0157375_11226053
799 Ga0157375_11845663
800 Ga0163163_10005405
801 Ga0163163_10014646
802 Ga0163163_10205345
803 Ga0163163_10384501
804 Ga0157377_10353722
805 Ga0157379_10002904
806 Ga0157379_10300491
807 Ga0157376_10223468
808 Ga0157376_10232510
809 Ga0157376_10363881
810 Ga0157376_11597311
811 Ga0213872_10030523
812 Ga0213876_10079646
813 Ga0207697_10203212
814 Ga0207656_10004070
815 Ga0207656_10008119
816 Ga0207656_10045116
817 Ga0207656_10237476
818 Ga0207692_10160568
819 Ga0207710_10029756
820 Ga0207680_10026445
821 Ga0207680_10054008
822 Ga0207680_11223420
823 Ga0207699_10649436
824 Ga0207645_10036280
825 Ga0207643_10016314
826 Ga0207705_10069414
827 Ga0207705_10170551
828 Ga0207654_10000087
829 Ga0207654_10000896
830 Ga0207654_10143295
831 Ga0207654_10747981
832 Ga0207707_10029000
833 Ga0207695_10000030
834 Ga0207695_10000035
835 Ga0207695_10000724
836 Ga0207695_10001562
837 Ga0207695_10004329
838 Ga0207695_10054313
839 Ga0207695_10343287
840 Ga0207671_10000042
841 Ga0207671_10000399
842 Ga0207671_10310402
843 Ga0207663_10262867
844 Ga0207662_10178579
845 Ga0207657_10006298
846 Ga0207649_10042459
847 Ga0207649_10120465
848 Ga0207649_10145298
849 Ga0207649_10193340
850 Ga0207652_10015348
851 Ga0207652_10638577
852 Ga0207694_10000040
853 Ga0207694_10000182
854 Ga0207694_10002297
855 Ga0207694_10022872
856 Ga0207650_10189840
857 Ga0207687_10004181
858 Ga0207687_10057723
859 Ga0207687_10165547
860 Ga0207687_10741192
861 Ga0207687_10757928
862 Ga0207700_10002575
863 Ga0207700_10013509
864 Ga0207664_10075508
865 Ga0207644_10022052
866 Ga0207644_10030973
867 Ga0207644_10100977
868 Ga0207644_10101772
869 Ga0207644_10417738
870 Ga0207690_11306937
871 Ga0207706_10015754
872 Ga0207686_10158371
873 Ga0207709_10248443
874 Ga0207670_10012503
875 Ga0207670_10156754
876 Ga0207669_10033351
877 Ga0207704_10556694
878 Ga0207665_11693785
879 Ga0207691_10006485
880 Ga0207711_10001725
881 Ga0207711_10068928
882 Ga0207711_10138925
883 Ga0207711_10251543
884 Ga0207711_10762192
885 Ga0207711_11067039
886 Ga0207689_10000252
887 Ga0207689_10008741
888 Ga0207689_10043078
889 Ga0207661_10065380
890 Ga0207661_10108306
891 Ga0207661_10120980
892 Ga0207661_10186614
893 Ga0207661_10310959
894 Ga0207661_10551279
895 Ga0207679_10272462
896 Ga0207679_10661528
897 Ga0207667_10001757
898 Ga0207667_10010077
899 Ga0207667_10015320
900 Ga0207667_10273645
901 Ga0207667_10351253
902 Ga0207667_10423204
903 Ga0207667_10498606
904 Ga0207667_10819374
905 Ga0207667_11303121
906 Ga0207712_10110632
907 Ga0207712_11276787
908 Ga0207712_11613237
909 Ga0207668_10131127
910 Ga0207640_10056414
911 Ga0207640_10132104
912 Ga0207658_10003248
913 Ga0207658_10031703
914 Ga0207658_10730903
915 Ga0207677_10000182
916 Ga0207677_10095467
917 Ga0207677_10267113
918 Ga0207703_10004176
919 Ga0207703_10192373
920 Ga0207639_10000156
921 Ga0207639_10012331
922 Ga0207639_10396083
923 Ga0207639_10757196
924 Ga0207678_10000652
925 Ga0207678_10088717
926 Ga0207678_10195949
927 Ga0207678_10532760
928 Ga0207708_10099869
929 Ga0207702_10000879
930 Ga0207702_10001552
931 Ga0207702_10042401
932 Ga0207702_10408567
933 Ga0207641_10035842
934 Ga0207641_10123817
935 Ga0207641_10512324
936 Ga0207641_11416980
937 Ga0207648_10170167
938 Ga0207676_10052395
939 Ga0207674_10000760
940 Ga0207674_10000847
941 Ga0207674_10016470
942 Ga0207674_10425426
943 Ga0207683_10014450
944 Ga0207683_10157791
945 Ga0207683_10241419
946 Ga0207683_10334250
947 Ga0207698_10000032
948 Ga0207698_10000088
949 Ga0207698_10315440
950 Ga0207698_10481910
951 Ga0207698_10563990
952 Ga0207698_11049329
953 Ga0207698_12531135
954 Ga0207428_10609979
955 Ga0268266_10001149
956 Ga0268266_10003798
957 Ga0268266_10120302
958 Ga0268266_10133264
959 Ga0268266_10196630
960 Ga0268266_10311733
961 Ga0268266_10485559
962 Ga0268264_10000806
963 Ga0268264_10265060
964 Ga0268264_10773363
965 Ga0268264_10879440
966 Ga0265324_10144727
967 Ga0265770_1005575
968 Ga0265760_10237547
969 Ga0265330_10068123
970 Ga0265332_10182452
971 Ga0265328_10008482
972 Ga0265328_10040372
973 Ga0265328_10155449
974 Ga0265325_10214987
975 Ga0265339_10000104
976 Ga0265339_10005077
977 Ga0265316_10006567
978 Ga0265316_10063425
979 Ga0265316_10067174
980 Ga0265316_10554132
981 Ga0265314_10008597
982 Ga0265314_10120994
983 Ga0265314_10197123
984 Ga0265342_10018393
985 Ga0265342_10019214
986 Ga0265342_10041486
987 Ga0265342_10070602
988 Ga0307405_11288445
989 Ga0307510_10178835
990 Ga0373954_0511768
991 Ga0373957_0293906
992 Ga0373924_0318731
993 Ga0373933_0137546
994 Ga0373933_0725621
995 Ga0373937_0001732
996 Ga0373937_0584658
997 Ga0373937_0622092
998 Ga0395900_1638397
999 Ga0395905_1141566
1000 Ga0436365_0753779
1001 Ga0436361_0637343
1002 Ga0466961_0024763
1003 Ga0466961_0074472
1004 Ga0466963_0159377
1005 Ga0466957_1157029
1006 Ga0466967_0116646
1007 Ga0495629_0161580
1008 Ga0495629_0388979
1009 Ga0495650_0000006
1010 Ga0495650_0280631
1011 Ga0495583_0354099
1012 Ga0495642_0037135
1013 Ga0495587_0249135
1014 Ga0495609_0006525
1015 Ga0495645_0640904
1016 Ga0495668_0064845
1017 Ga0495634_0226372
1018 Ga0495625_0000087
1019 Ga0495625_0824883
1020 Ga0495659_0074025
1021 Ga0495661_0077902
1022 Ga0495623_0195033
1023 Ga0495623_0363991
1024 Ga0495613_0846837
1025 Ga0495636_0022750
1026 Ga0495674_0112558
1027 Ga0495673_0060037
1028 Ga0495686_0131513
1029 Ga0495602_0297669
1030 Ga0496100_0043376
1031 Ga0496101_0323506
1032 Ga0496102_0281867
1033 Ga0496102_0739596
1034 Ga0496103_0444851
1035 Ga0496103_0977057
1036 Ga0496104_0019217
1037 Ga0496104_0089020
1038 Ga0496105_0100069
1039 Ga0496105_0102538
1040 Ga0496105_0404834
1041 Ga0496106_0133964
1042 Ga0496107_0014218
1043 Ga0496107_0056513
1044 Ga0496108_0328229
1045 Ga0496109_0023766
1046 Ga0496109_0792791
1047 Ga0496110_0338641
1048 Ga0496112_0285593
1049 Ga0496112_1407244
1050 Ga0496113_0062725
1051 Ga0496113_0822257
1052 Ga0496114_0054273
1053 Ga0496115_0141841
1054 Ga0496115_0237552
1055 Ga0496115_1053497
1056 Ga0496119_0207897
1057 Ga0496126_0001081
1058 Ga0496126_0037747
1059 Ga0495682_0075779
1060 Ga0501031_0098356
1061 Ga0501033_0007229
1062 Ga0501033_0071622
1063 Ga0501034_0033854
1064 Ga0501034_1089838
1065 Ga0501036_0001846
1066 Ga0501037_0045913
1067 Ga0501037_0113465
1068 Ga0501038_0067389
1069 Ga0501039_0072167
1070 Ga0501040_0807468
1071 Ga0501043_0015045
1072 Ga0501046_0000386
1073 Ga0501047_0004467
1074 Ga0501047_0093407
1075 Ga0501047_0734053
1076 Ga0501048_0100645
1077 Ga0501067_0076559
1078 Ga0501069_0655785
1079 Ga0501070_0354816
1080 Ga0501073_0093368
1081 Ga0501074_0036509
1082 Ga0501235_062735
1083 Ga0501238_005496
1084 Ga0501079_0370473
1085 Ga0501080_0016760
1086 Ga0501035_0010324
1087 Ga0501035_0448358
1088 Ga0501044_0023053
1089 Ga0501044_0217532
1090 nmdc:mga08y16_220476_c1
1091 nmdc:mga0rr50_577229_c1
1092 Ga0495601_0131376
1093 Ga0495601_0650259
1094 Ga0495619_0217692
1095 Ga0500643_057527
1096 Ga0500651_0000039
1097 Ga0500595_029241
1098 Ga0500614_205459
1099 Ga0500620_158492
1100 Ga0500661_001793
1101 Ga0501082_0324522
1102 2884218553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11236

DUF3037

Protein of unknown function (DUF3037)

24

141

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pf6-assembly2.cif.gz_B lutheran glycoprotein, n-terminal domains 1 and 2 0.6404 7 47
5unb-assembly1.cif.gz_B crystal structure of putative putative deoxyribonuclease-2 from burkholderia thailandensis in complex with copper 0.6045 7 55
5tzn-assembly2.cif.gz_G structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6) 0.5426 5 57
4k7e-assembly1.cif.gz_A crystal structure of junin virus nucleoprotein 0.5329 25 42
6mlt-assembly1.cif.gz_A crystal structure of the v. cholerae biofilm matrix protein bap1 0.5313 5 47
ID Description Score Start End Superfamily
af_Q9XX41_18_196_2.100.10.20 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Vitelline membrane outer layer protein I (VOMI) 0.5969 4 32 2.100.10.20
af_A0A1D8PR64_243_461_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5931 5 40 3.30.420.10
af_Q9U2I7_31_168_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.5851 5 44 2.60.120.200
af_Q9XWI4_16_197_2.100.10.20 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Vitelline membrane outer layer protein I (VOMI) 0.578 4 46 2.100.10.20
af_G5EDE5_128_278_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.5691 3 46 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A538QC50-F1-model_v4 DUF3037 domain-containing protein 0.9885 4 126
AF-A0A838KZ68-F1-model_v4 DUF3037 domain-containing protein 0.988 7 52
AF-A0A7Y6UF40-F1-model_v4 DUF3037 domain-containing protein 0.9866 3 126
AF-A0A3A3ZB18-F1-model_v4 DUF3037 domain-containing protein 0.9855 7 126
AF-A0A538KH56-F1-model_v4 DUF3037 domain-containing protein 0.9846 1 126

Map