F462573

General Info

Members Datasets Scaffolds Average Seq Length
551 241 1102 127

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_101224083|Ga0070667_1012240832
Length 150
Sequence VWSSSVSSVLLCVLVSFGCFIIPLMIRIELSLRLPNSPGALAGVCRLLSDERVNVQAMALDAAGQLRMVVDNHVHGAAVLREHHHQVTERDVVVTTIPNAPGSLAPLLKLVRDADVNVEYSYGGGSEGSHSAMIVLGVDDAQRAAAAAGI

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
91 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 3.81
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 31.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_101224083 3300005367 Unclassified 703
2 Ga0065704_10230510 3300005289 Bacteria 1044
3 Ga0065715_10043467 3300005293 Bacteria 999
4 Ga0065707_10445881 3300005295 Unclassified 805
5 Ga0070676_10002037 3300005328 Bacteria 10267
6 Ga0070676_10924177 3300005328 Bacteria 651
7 Ga0070690_100515316 3300005330 Bacteria 897
8 Ga0070690_100568160 3300005330 Bacteria 857
9 Ga0070690_101185603 3300005330 Unclassified 609
10 Ga0070690_101240184 3300005330 Bacteria 596
11 Ga0070670_100961794 3300005331 Unclassified 776
12 Ga0070670_101692876 3300005331 Unclassified 582
13 Ga0070677_10097474 3300005333 Unclassified 1290
14 Ga0068869_100230750 3300005334 Bacteria 1471
15 Ga0068869_100657716 3300005334 Bacteria 890
16 Ga0070666_10165518 3300005335 Unclassified 1547
17 Ga0070666_11440674 3300005335 Bacteria 515
18 Ga0068868_100082672 3300005338 Unclassified 2576
19 Ga0070689_100310593 3300005340 Bacteria 1314
20 Ga0070691_10003058 3300005341 Bacteria 7490
21 Ga0070692_10393601 3300005345 Bacteria 873
22 Ga0070668_100039104 3300005347 Bacteria 3628
23 Ga0070669_100018924 3300005353 Bacteria 4922
24 Ga0070669_100021126 3300005353 Unclassified 4652
25 Ga0070669_101484849 3300005353 Unclassified 589
26 Ga0070675_100071217 3300005354 Bacteria 2883
27 Ga0070671_100301853 3300005355 Bacteria 1363
28 Ga0070671_101067299 3300005355 Unclassified 709
29 Ga0070674_101451558 3300005356 Bacteria 615
30 Ga0070673_100006317 3300005364 Bacteria 7696
31 Ga0070673_100375505 3300005364 Bacteria 1267
32 Ga0070673_100476744 3300005364 Bacteria 1126
33 Ga0070673_100504371 3300005364 Bacteria 1095
34 Ga0070673_101639962 3300005364 Bacteria 608
35 Ga0070667_100117138 3300005367 Unclassified 2314
36 Ga0070667_101188039 3300005367 Bacteria 714
37 Ga0070667_101881808 3300005367 Unclassified 563
38 Ga0070709_11288674 3300005434 Bacteria 589
39 Ga0070709_11535973 3300005434 Unclassified 541
40 Ga0070714_100013834 3300005435 Bacteria 6469
41 Ga0070713_100029870 3300005436 Bacteria 4322
42 Ga0070701_10217183 3300005438 Bacteria 1138
43 Ga0070711_101085324 3300005439 Unclassified 689
44 Ga0070705_100003831 3300005440 Bacteria 7354
45 Ga0070700_100291134 3300005441 Bacteria 1188
46 Ga0070694_100255641 3300005444 Bacteria 1327
47 Ga0070694_100337596 3300005444 Bacteria 1164
48 Ga0070694_100488856 3300005444 Unclassified 978
49 Ga0070694_101069282 3300005444 Bacteria 672
50 Ga0070708_100367515 3300005445 Unclassified 1356
51 Ga0070708_100875303 3300005445 Bacteria 844
52 Ga0070678_100243004 3300005456 Unclassified 1506
53 Ga0070678_100998009 3300005456 Unclassified 769
54 Ga0070678_101159476 3300005456 Unclassified 715
55 Ga0070662_100077249 3300005457 Bacteria 2470
56 Ga0070662_100272572 3300005457 Bacteria 1367
57 Ga0070662_100803384 3300005457 Bacteria 800
58 Ga0068867_100041451 3300005459 Bacteria 3365
59 Ga0068867_100174622 3300005459 Bacteria 1704
60 Ga0068867_100424709 3300005459 Bacteria 1127
61 Ga0068867_101479713 3300005459 Bacteria 632
62 Ga0070685_10787497 3300005466 Unclassified 700
63 Ga0070706_100108519 3300005467 Bacteria 2583
64 Ga0070706_100507297 3300005467 Unclassified 1122
65 Ga0070707_100247132 3300005468 Unclassified 1736
66 Ga0070707_100423791 3300005468 Unclassified 1291
67 Ga0070707_100618256 3300005468 Unclassified 1046
68 Ga0070707_101453474 3300005468 Unclassified 652
69 Ga0070698_100025318 3300005471 Bacteria 6185
70 Ga0070698_100035459 3300005471 Bacteria 5159
71 Ga0070698_100239738 3300005471 Bacteria 1746
72 Ga0070698_100393818 3300005471 Unclassified 1318
73 Ga0070698_100401446 3300005471 Bacteria 1304
74 Ga0070698_100734832 3300005471 Unclassified 930
75 Ga0070698_100838363 3300005471 Unclassified 864
76 Ga0070699_100007487 3300005518 Bacteria 9499
77 Ga0070699_100128036 3300005518 Bacteria 2237
78 Ga0070699_100174052 3300005518 Unclassified 1908
79 Ga0070699_101361315 3300005518 Bacteria 651
80 Ga0070679_100492185 3300005530 Unclassified 1170
81 Ga0070679_101140184 3300005530 Bacteria 725
82 Ga0070684_101075512 3300005535 Bacteria 756
83 Ga0070697_100024715 3300005536 Bacteria 4784
84 Ga0070697_100806742 3300005536 Bacteria 831
85 Ga0068853_100439325 3300005539 Bacteria 1226
86 Ga0068853_101163850 3300005539 Bacteria 744
87 Ga0070672_100003555 3300005543 Bacteria 10096
88 Ga0070672_100098053 3300005543 Bacteria 2373
89 Ga0070686_100297016 3300005544 Bacteria 1197
90 Ga0070686_100672686 3300005544 Unclassified 823
91 Ga0070695_100039927 3300005545 Bacteria 2968
92 Ga0070695_100367761 3300005545 Bacteria 1082
93 Ga0070695_100711905 3300005545 Unclassified 798
94 Ga0070695_101686235 3300005545 Bacteria 530
95 Ga0070696_100199531 3300005546 Bacteria 1493
96 Ga0070696_100465707 3300005546 Unclassified 1000
97 Ga0070696_101694185 3300005546 Bacteria 545
98 Ga0070696_101789299 3300005546 Unclassified 531
99 Ga0070665_100002202 3300005548 Bacteria 21753
100 Ga0070665_100566183 3300005548 Bacteria 1149
101 Ga0070665_102102572 3300005548 Bacteria 569
102 Ga0070704_100098919 3300005549 Bacteria 2193
103 Ga0070704_100118633 3300005549 Unclassified 2027
104 Ga0070704_100272119 3300005549 Bacteria 1400
105 Ga0070704_101795216 3300005549 Unclassified 567
106 Ga0068855_100914905 3300005563 Bacteria 926
107 Ga0070664_100332389 3300005564 Bacteria 1379
108 Ga0070664_101089294 3300005564 Unclassified 752
109 Ga0070664_101688037 3300005564 Bacteria 600
110 Ga0068854_100070780 3300005578 Bacteria 2550
111 Ga0068854_100170937 3300005578 Bacteria 1691
112 Ga0070702_100000517 3300005615 Bacteria 13889
113 Ga0068859_100080414 3300005617 Bacteria 3300
114 Ga0068859_100131153 3300005617 Bacteria 2578
115 Ga0068859_101158142 3300005617 Unclassified 851
116 Ga0068859_101337387 3300005617 Bacteria 790
117 Ga0068859_101427169 3300005617 Bacteria 764
118 Ga0068864_100372517 3300005618 Unclassified 1352
119 Ga0068864_101328842 3300005618 Bacteria 720
120 Ga0068864_101566206 3300005618 Bacteria 663
121 Ga0068866_10045045 3300005718 Bacteria 2210
122 Ga0068866_10638056 3300005718 Unclassified 724
123 Ga0068861_100007843 3300005719 Bacteria 7341
124 Ga0068861_100418874 3300005719 Unclassified 1193
125 Ga0068861_102157675 3300005719 Unclassified 558
126 Ga0068861_102462258 3300005719 Bacteria 524
127 Ga0068851_10262149 3300005834 Bacteria 983
128 Ga0068870_10203455 3300005840 Unclassified 1202
129 Ga0068863_100002629 3300005841 Bacteria 17782
130 Ga0068858_100005384 3300005842 Bacteria 12545
131 Ga0068858_100006739 3300005842 Bacteria 11177
132 Ga0068858_100052470 3300005842 Bacteria 3773
133 Ga0068858_100324631 3300005842 Bacteria 1471
134 Ga0068858_100378651 3300005842 Bacteria 1358
135 Ga0068858_100427163 3300005842 Bacteria 1275
136 Ga0068858_100513222 3300005842 Bacteria 1159
137 Ga0068860_100042168 3300005843 Bacteria 4360
138 Ga0068860_100154939 3300005843 Unclassified 2208
139 Ga0068860_100157492 3300005843 Bacteria 2189
140 Ga0068860_100186949 3300005843 Bacteria 2004
141 Ga0068860_101616128 3300005843 Bacteria 670
142 Ga0068860_102536850 3300005843 Unclassified 532
143 Ga0068862_100055675 3300005844 Bacteria 3388
144 Ga0068862_100143021 3300005844 Bacteria 2124
145 Ga0068862_100181066 3300005844 Unclassified 1891
146 Ga0068862_100651418 3300005844 Unclassified 1016
147 Ga0068862_100782499 3300005844 Bacteria 930
148 Ga0081455_10010539 3300005937 Bacteria 9365
149 Ga0075432_10149878 3300006058 Bacteria 895
150 Ga0070715_10180488 3300006163 Bacteria 1058
151 Ga0070715_10455526 3300006163 Bacteria 723
152 Ga0070716_101122403 3300006173 Bacteria 628
153 Ga0097621_100001498 3300006237 Bacteria 16027
154 Ga0097621_100088081 3300006237 Bacteria 2594
155 Ga0097621_100094247 3300006237 Unclassified 2510
156 Ga0097621_100676966 3300006237 Unclassified 948
157 Ga0097621_101008584 3300006237 Unclassified 779
158 Ga0068871_100018975 3300006358 Bacteria 5241
159 Ga0068871_100028745 3300006358 Bacteria 4362
160 Ga0068871_100569245 3300006358 Unclassified 1028
161 Ga0068871_100607894 3300006358 Bacteria 995
162 Ga0068871_101534368 3300006358 Bacteria 630
163 Ga0075428_100184874 3300006844 Unclassified 2255
164 Ga0075433_10025532 3300006852 Bacteria 4995
165 Ga0075433_10119451 3300006852 Unclassified 2340
166 Ga0075433_10994936 3300006852 Bacteria 730
167 Ga0075433_11138635 3300006852 Unclassified 678
168 Ga0075433_11474391 3300006852 Bacteria 588
169 Ga0075433_11788627 3300006852 Unclassified 528
170 Ga0075434_100036073 3300006871 Bacteria 4890
171 Ga0075434_100042648 3300006871 Bacteria 4499
172 Ga0075434_100220132 3300006871 Bacteria 1918
173 Ga0075434_100519060 3300006871 Unclassified 1212
174 Ga0075434_100962959 3300006871 Bacteria 868
175 Ga0075434_101147532 3300006871 Unclassified 790
176 Ga0068865_100369044 3300006881 Bacteria 1167
177 Ga0075436_100001150 3300006914 Bacteria 17889
178 Ga0075436_100012286 3300006914 Bacteria 5867
179 Ga0075436_100030457 3300006914 Bacteria 3715
180 Ga0075436_100035702 3300006914 Bacteria 3428
181 Ga0075436_100108832 3300006914 Bacteria 1933
182 Ga0075436_100466767 3300006914 Unclassified 921
183 Ga0075436_101002102 3300006914 Unclassified 627
184 Ga0097620_100080414 3300006931 Bacteria 3300
185 Ga0097620_100131155 3300006931 Bacteria 2578
186 Ga0097620_101158194 3300006931 Unclassified 851
187 Ga0097620_101337554 3300006931 Bacteria 790
188 Ga0097620_101427010 3300006931 Bacteria 764
189 Ga0075435_100017089 3300007076 Bacteria 5482
190 Ga0075435_100024847 3300007076 Unclassified 4657
191 Ga0075435_100033682 3300007076 Unclassified 4053
192 Ga0075435_100199933 3300007076 Bacteria 1693
193 Ga0075435_100762705 3300007076 Unclassified 842
194 Ga0099795_10099803 3300007788 Bacteria 1137
195 Ga0105240_10547680 3300009093 Viruses 1280
196 Ga0105240_10745339 3300009093 Bacteria 1065
197 Ga0105240_12012438 3300009093 Bacteria 600
198 Ga0111539_10721875 3300009094 Unclassified 1160
199 Ga0111539_11966528 3300009094 Unclassified 678
200 Ga0105245_10125920 3300009098 Bacteria 2398
201 Ga0105245_10424967 3300009098 Unclassified 1333
202 Ga0105245_11075830 3300009098 Bacteria 850
203 Ga0105245_12091739 3300009098 Bacteria 620
204 Ga0105247_10040933 3300009101 Bacteria 2834
205 Ga0105247_10845975 3300009101 Unclassified 702
206 Ga0114129_10002817 3300009147 Bacteria 24261
207 Ga0114129_10014325 3300009147 Bacteria 11303
208 Ga0114129_10405359 3300009147 Bacteria 1796
209 Ga0114129_11110177 3300009147 Unclassified 990
210 Ga0114129_12014279 3300009147 Bacteria 698
211 Ga0105243_10005144 3300009148 Bacteria 10250
212 Ga0105243_10371268 3300009148 Unclassified 1320
213 Ga0105241_10250979 3300009174 Unclassified 1500
214 Ga0105242_10012687 3300009176 Bacteria 6490
215 Ga0105242_10021480 3300009176 Bacteria 5070
216 Ga0105242_10097750 3300009176 Bacteria 2482
217 Ga0105242_10480156 3300009176 Bacteria 1178
218 Ga0105242_10940946 3300009176 Bacteria 867
219 Ga0105242_11887959 3300009176 Bacteria 637
220 Ga0105242_12557126 3300009176 Bacteria 559
221 Ga0105248_10033608 3300009177 Bacteria 5730
222 Ga0105248_10039293 3300009177 Bacteria 5299
223 Ga0105248_10091682 3300009177 Bacteria 3422
224 Ga0105248_10260330 3300009177 Bacteria 1953
225 Ga0105248_10377880 3300009177 Bacteria 1595
226 Ga0105248_10469029 3300009177 Unclassified 1419
227 Ga0105248_10680260 3300009177 Bacteria 1161
228 Ga0105248_11054019 3300009177 Bacteria 919
229 Ga0105248_11300910 3300009177 Unclassified 822
230 Ga0105248_11666444 3300009177 Unclassified 723
231 Ga0105248_12597516 3300009177 Unclassified 577
232 Ga0105237_10335872 3300009545 Unclassified 1515
233 Ga0105237_11404709 3300009545 Unclassified 704
234 Ga0105238_10286266 3300009551 Bacteria 1630
235 Ga0105238_11754491 3300009551 Unclassified 652
236 Ga0105249_10223529 3300009553 Bacteria 1854
237 Ga0105249_10318712 3300009553 Bacteria 1565
238 Ga0105239_10083264 3300010375 Unclassified 3523
239 Ga0105246_10419789 3300011119 Unclassified 1116
240 Ga0157323_1009882 3300012495 Unclassified 740
241 Ga0157313_1004481 3300012503 Bacteria 962
242 Ga0157374_10129027 3300013296 Unclassified 2446
243 Ga0157374_11844737 3300013296 Bacteria 630
244 Ga0157378_10171093 3300013297 Bacteria 2037
245 Ga0157378_10301160 3300013297 Bacteria 1552
246 Ga0157378_10395397 3300013297 Unclassified 1361
247 Ga0157378_10467595 3300013297 Bacteria 1254
248 Ga0157378_11221089 3300013297 Unclassified 792
249 Ga0157378_11753374 3300013297 Bacteria 668
250 Ga0163162_10877381 3300013306 Bacteria 1011
251 Ga0163162_11234578 3300013306 Bacteria 849
252 Ga0157375_10269584 3300013308 Unclassified 1864
253 Ga0163163_10176330 3300014325 Unclassified 2184
254 Ga0163163_11506511 3300014325 Bacteria 734
255 Ga0157380_10115724 3300014326 Bacteria 2262
256 Ga0157380_10136585 3300014326 Bacteria 2100
257 Ga0157380_10362199 3300014326 Bacteria 1361
258 Ga0157377_10450929 3300014745 Bacteria 888
259 Ga0157379_10008361 3300014968 Bacteria 8993
260 Ga0157379_10016475 3300014968 Bacteria 6501
261 Ga0157379_10040708 3300014968 Bacteria 4148
262 Ga0157379_10582550 3300014968 Bacteria 1043
263 Ga0157379_10855834 3300014968 Unclassified 861
264 Ga0157376_10008892 3300014969 Bacteria 7270
265 Ga0157376_11464378 3300014969 Unclassified 715
266 Ga0157376_11867768 3300014969 Bacteria 637
267 Ga0207682_10041752 3300025893 Bacteria 1872
268 Ga0207642_10055591 3300025899 Bacteria 1811
269 Ga0207642_10747760 3300025899 Bacteria 619
270 Ga0207642_11023414 3300025899 Unclassified 532
271 Ga0207710_10428289 3300025900 Unclassified 681
272 Ga0207688_10064766 3300025901 Bacteria 2064
273 Ga0207680_10008804 3300025903 Bacteria 4973
274 Ga0207680_10133246 3300025903 Bacteria 1640
275 Ga0207680_10904711 3300025903 Unclassified 632
276 Ga0207699_10828000 3300025906 Bacteria 681
277 Ga0207645_10004224 3300025907 Bacteria 10668
278 Ga0207645_10020315 3300025907 Bacteria 4349
279 Ga0207643_10171417 3300025908 Bacteria 1310
280 Ga0207684_10055135 3300025910 Bacteria 3372
281 Ga0207684_10221180 3300025910 Unclassified 1634
282 Ga0207707_11383687 3300025912 Unclassified 562
283 Ga0207707_11551105 3300025912 Unclassified 523
284 Ga0207695_11326148 3300025913 Bacteria 600
285 Ga0207671_11133534 3300025914 Unclassified 613
286 Ga0207663_10479277 3300025916 Unclassified 964
287 Ga0207652_10699098 3300025921 Unclassified 905
288 Ga0207652_10784969 3300025921 Bacteria 846
289 Ga0207646_10353623 3300025922 Unclassified 1328
290 Ga0207646_11049608 3300025922 Unclassified 719
291 Ga0207646_11694678 3300025922 Unclassified 543
292 Ga0207681_10015903 3300025923 Unclassified 4697
293 Ga0207659_10000623 3300025926 Bacteria 21017
294 Ga0207659_10011431 3300025926 Bacteria 5608
295 Ga0207659_10936633 3300025926 Bacteria 745
296 Ga0207687_10179252 3300025927 Bacteria 1640
297 Ga0207700_10231679 3300025928 Bacteria 1571
298 Ga0207664_10096240 3300025929 Bacteria 2436
299 Ga0207644_10298505 3300025931 Bacteria 1297
300 Ga0207644_10701425 3300025931 Unclassified 844
301 Ga0207690_11292390 3300025932 Bacteria 610
302 Ga0207706_10153671 3300025933 Bacteria 2024
303 Ga0207706_10178780 3300025933 Unclassified 1864
304 Ga0207706_10307918 3300025933 Unclassified 1380
305 Ga0207686_10007127 3300025934 Bacteria 6014
306 Ga0207686_10234879 3300025934 Bacteria 1331
307 Ga0207686_10285136 3300025934 Bacteria 1221
308 Ga0207686_10605085 3300025934 Bacteria 863
309 Ga0207686_11062230 3300025934 Bacteria 659
310 Ga0207709_10007465 3300025935 Bacteria 6086
311 Ga0207670_10047050 3300025936 Unclassified 2870
312 Ga0207669_10145914 3300025937 Bacteria 1650
313 Ga0207704_10045042 3300025938 Bacteria 2618
314 Ga0207704_10174692 3300025938 Bacteria 1545
315 Ga0207704_11652134 3300025938 Unclassified 550
316 Ga0207665_11196105 3300025939 Unclassified 606
317 Ga0207691_10047266 3300025940 Bacteria 3950
318 Ga0207691_10080834 3300025940 Bacteria 2922
319 Ga0207691_10267558 3300025940 Bacteria 1472
320 Ga0207711_10042913 3300025941 Bacteria 3856
321 Ga0207711_10159761 3300025941 Bacteria 2039
322 Ga0207711_10277682 3300025941 Bacteria 1542
323 Ga0207711_10401104 3300025941 Bacteria 1274
324 Ga0207711_10470018 3300025941 Unclassified 1171
325 Ga0207711_10579316 3300025941 Bacteria 1047
326 Ga0207711_10762626 3300025941 Bacteria 902
327 Ga0207689_10080795 3300025942 Bacteria 2672
328 Ga0207689_10245176 3300025942 Bacteria 1481
329 Ga0207689_10733963 3300025942 Bacteria 833
330 Ga0207679_10166051 3300025945 Unclassified 1812
331 Ga0207679_11107392 3300025945 Bacteria 726
332 Ga0207667_10778885 3300025949 Bacteria 954
333 Ga0207667_11597121 3300025949 Bacteria 621
334 Ga0207651_10128476 3300025960 Bacteria 1935
335 Ga0207651_10418139 3300025960 Bacteria 1144
336 Ga0207651_10553809 3300025960 Bacteria 1000
337 Ga0207712_10169333 3300025961 Bacteria 1706
338 Ga0207668_10381528 3300025972 Bacteria 1186
339 Ga0207640_10207102 3300025981 Unclassified 1491
340 Ga0207640_10567230 3300025981 Bacteria 956
341 Ga0207658_10020065 3300025986 Bacteria 4627
342 Ga0207677_10033700 3300026023 Unclassified 3308
343 Ga0207677_10043073 3300026023 Bacteria 2999
344 Ga0207677_10253508 3300026023 Unclassified 1430
345 Ga0207703_10021790 3300026035 Bacteria 5016
346 Ga0207703_10038158 3300026035 Bacteria 3832
347 Ga0207703_10038934 3300026035 Bacteria 3797
348 Ga0207703_10041746 3300026035 Bacteria 3678
349 Ga0207703_10051454 3300026035 Unclassified 3338
350 Ga0207703_10295539 3300026035 Unclassified 1475
351 Ga0207703_10394156 3300026035 Bacteria 1283
352 Ga0207703_10608830 3300026035 Bacteria 1034
353 Ga0207639_11373845 3300026041 Unclassified 663
354 Ga0207708_10002596 3300026075 Bacteria 13296
355 Ga0207708_10081203 3300026075 Bacteria 2492
356 Ga0207708_10231224 3300026075 Bacteria 1484
357 Ga0207708_11914445 3300026075 Bacteria 520
358 Ga0207641_10000811 3300026088 Bacteria 33300
359 Ga0207641_10382676 3300026088 Bacteria 1348
360 Ga0207648_10018676 3300026089 Bacteria 6272
361 Ga0207648_10177549 3300026089 Bacteria 1884
362 Ga0207648_10851751 3300026089 Bacteria 850
363 Ga0207676_10051889 3300026095 Bacteria 3204
364 Ga0207675_100001444 3300026118 Bacteria 23801
365 Ga0207675_100125772 3300026118 Bacteria 2428
366 Ga0207675_100203398 3300026118 Bacteria 1902
367 Ga0207675_101388737 3300026118 Bacteria 723
368 Ga0207675_101819217 3300026118 Bacteria 628
369 Ga0207683_10319362 3300026121 Unclassified 1422
370 Ga0207683_10980190 3300026121 Bacteria 785
371 Ga0207698_10892741 3300026142 Bacteria 896
372 Ga0207428_10053007 3300027907 Bacteria 3236
373 Ga0207428_10244487 3300027907 Unclassified 1340
374 Ga0207428_10757642 3300027907 Bacteria 692
375 Ga0268266_10935363 3300028379 Bacteria 838
376 Ga0268265_10037532 3300028380 Unclassified 3557
377 Ga0268265_10086832 3300028380 Bacteria 2487
378 Ga0268265_10581922 3300028380 Bacteria 1067
379 Ga0268265_10971699 3300028380 Bacteria 838
380 Ga0268265_11633506 3300028380 Bacteria 650
381 Ga0268264_10021773 3300028381 Bacteria 5232
382 Ga0268264_10057300 3300028381 Bacteria 3259
383 Ga0268264_10123310 3300028381 Unclassified 2287
384 Ga0268264_10123528 3300028381 Unclassified 2285
385 Ga0268264_10127766 3300028381 Bacteria 2249
386 Ga0268264_10550923 3300028381 Unclassified 1131
387 Ga0268264_11405301 3300028381 Unclassified 708
388 Ga0268264_11617299 3300028381 Bacteria 658
389 Ga0265332_10038862 3300031238 Bacteria 2062
390 Ga0265314_10033185 3300031711 Bacteria 3789
391 Ga0307416_103690796 3300032002 Bacteria 512
392 Ga0373958_0017948 3300034819 Bacteria 1278
393 Ga0373938_0140685 3300034957 Unclassified 636
394 Ga0373934_0090386 3300035086 Bacteria 1234
395 Ga0373934_0442130 3300035086 Bacteria 545
396 Ga0373944_0248695 3300035089 Bacteria 656
397 Ga0373952_0046941 3300035092 Bacteria 1017
398 Ga0373932_0186629 3300035112 Unclassified 730
399 Ga0373939_0068385 3300035114 Bacteria 1150
400 Ga0373941_0021560 3300035115 Bacteria 1820
401 Ga0373945_0099200 3300035116 Bacteria 1138
402 Ga0373953_0238625 3300035117 Bacteria 789
403 Ga0373953_0253028 3300035117 Bacteria 766
404 Ga0373956_0339784 3300035119 Unclassified 716
405 Ga0373943_0601031 3300035170 Bacteria 648
406 Ga0373946_0539822 3300035171 Bacteria 601
407 Ga0373955_0391417 3300035172 Bacteria 844
408 Ga0373955_0737376 3300035172 Bacteria 605
409 Ga0373961_0184497 3300035241 Unclassified 728
410 Ga0373924_0042784 3300035410 Bacteria 1859
411 Ga0373935_0174700 3300035692 Bacteria 1471
412 Ga0373935_0830869 3300035692 Unclassified 683
413 Ga0373935_1253942 3300035692 Unclassified 553
414 Ga0373933_0120982 3300035724 Bacteria 1640
415 Ga0373933_0373598 3300035724 Bacteria 928
416 Ga0373947_0320724 3300035725 Bacteria 1036
417 Ga0373947_0356479 3300035725 Bacteria 982
418 Ga0373947_0615351 3300035725 Bacteria 740
419 Ga0373937_0017244 3300036401 Bacteria 6429
420 Ga0373937_0230768 3300036401 Unclassified 1743
421 Ga0373937_0954100 3300036401 Unclassified 806
422 Ga0373937_1326834 3300036401 Bacteria 667
423 Ga0373937_1532349 3300036401 Unclassified 614
424 Ga0373925_0044331 3300037068 Unclassified 3303
425 Ga0373925_0156808 3300037068 Bacteria 1791
426 Ga0373925_1066461 3300037068 Bacteria 665
427 Ga0395900_0704507 3300037418 Bacteria 943
428 Ga0395898_1657561 3300037466 Bacteria 563
429 Ga0453683_0405691 3300044673 Bacteria 879
430 Ga0451576_0104467 3300045051 Bacteria 2947
431 Ga0451576_2181894 3300045051 Unclassified 569
432 Ga0495592_0163460 3300046454 Bacteria 1530
433 Ga0495592_0552277 3300046454 Bacteria 708
434 Ga0495603_0359596 3300046455 Bacteria 835
435 Ga0495629_0451897 3300046459 Bacteria 870
436 Ga0495651_0624738 3300046462 Bacteria 677
437 Ga0495580_0618164 3300046472 Unclassified 715
438 Ga0495580_0892053 3300046472 Bacteria 572
439 Ga0495582_0554055 3300046473 Unclassified 665
440 Ga0495639_0447023 3300046475 Bacteria 656
441 Ga0495662_0311806 3300046476 Bacteria 774
442 Ga0495662_0408193 3300046476 Bacteria 667
443 Ga0495664_0485842 3300046477 Bacteria 738
444 Ga0495610_0381092 3300046512 Bacteria 524
445 Ga0495618_0574555 3300046514 Bacteria 673
446 Ga0495628_0320700 3300046516 Bacteria 1143
447 Ga0495628_0330772 3300046516 Bacteria 1123
448 Ga0495628_0340107 3300046516 Bacteria 1105
449 Ga0495630_0196341 3300046517 Unclassified 1540
450 Ga0495663_0290000 3300046525 Unclassified 588
451 Ga0495642_0297895 3300046528 Bacteria 706
452 Ga0495652_0230443 3300046529 Bacteria 1386
453 Ga0495652_0997422 3300046529 Unclassified 548
454 Ga0495640_0084189 3300046533 Bacteria 2110
455 Ga0495640_0185587 3300046533 Bacteria 1324
456 Ga0495640_0525675 3300046533 Unclassified 718
457 Ga0495586_0752471 3300046535 Bacteria 562
458 Ga0495587_0081435 3300046536 Bacteria 1876
459 Ga0495587_0165358 3300046536 Bacteria 1258
460 Ga0495645_0002239 3300046543 Bacteria 13162
461 Ga0495667_0317505 3300046559 Bacteria 986
462 Ga0495667_0967711 3300046559 Bacteria 520
463 Ga0495656_0344836 3300046615 Unclassified 771
464 Ga0495656_0429527 3300046615 Unclassified 694
465 Ga0495668_0601876 3300046616 Unclassified 607
466 Ga0495634_0275681 3300046642 Bacteria 1023
467 Ga0495634_0639459 3300046642 Bacteria 615
468 Ga0495635_0124786 3300046663 Bacteria 1756
469 Ga0495635_0325000 3300046663 Bacteria 1029
470 Ga0495659_0069174 3300046664 Unclassified 1320
471 Ga0495659_0078808 3300046664 Unclassified 1247
472 Ga0495657_0356325 3300046675 Bacteria 865
473 Ga0495647_0040061 3300046681 Unclassified 1779
474 Ga0495647_0056502 3300046681 Bacteria 1539
475 Ga0495658_0008993 3300046683 Bacteria 4966
476 Ga0495658_0029211 3300046683 Bacteria 2982
477 Ga0495658_0065651 3300046683 Bacteria 2094
478 Ga0495658_0229317 3300046683 Bacteria 1164
479 Ga0495658_0612104 3300046683 Bacteria 698
480 Ga0495658_0701479 3300046683 Unclassified 648
481 Ga0495669_0559120 3300046684 Bacteria 557
482 Ga0495613_0432677 3300046689 Unclassified 894
483 Ga0495670_0410135 3300046691 Unclassified 732
484 Ga0495600_0722635 3300046809 Unclassified 598
485 Ga0495674_0115320 3300047319 Bacteria 2274
486 Ga0495674_1468252 3300047319 Bacteria 506
487 Ga0495676_0473632 3300047321 Bacteria 824
488 Ga0495680_0446545 3300047322 Bacteria 886
489 Ga0495684_0601018 3300047471 Bacteria 742
490 Ga0496102_0893456 3300048905 Bacteria 810
491 Ga0496104_0704130 3300048907 Bacteria 918
492 Ga0496104_1280506 3300048907 Unclassified 636
493 Ga0496105_0369043 3300048908 Unclassified 1144
494 Ga0496107_0090472 3300048910 Bacteria 2236
495 Ga0496107_0316315 3300048910 Bacteria 1162
496 Ga0496107_1186860 3300048910 Bacteria 549
497 Ga0496108_1166667 3300048911 Bacteria 652
498 Ga0496109_1132696 3300048912 Bacteria 719
499 Ga0496109_2012017 3300048912 Unclassified 510
500 Ga0496110_1167105 3300048913 Unclassified 679
501 Ga0496110_1360654 3300048913 Unclassified 619
502 Ga0496112_0068317 3300048915 Bacteria 3509
503 Ga0496112_0151304 3300048915 Bacteria 2288
504 Ga0496112_0203919 3300048915 Unclassified 1936
505 Ga0496112_0367117 3300048915 Bacteria 1381
506 Ga0496114_0183627 3300048917 Unclassified 1827
507 Ga0496114_0482257 3300048917 Viruses 1097
508 Ga0496114_0858147 3300048917 Unclassified 788
509 Ga0496114_1582289 3300048917 Bacteria 543
510 Ga0496115_0150429 3300048918 Unclassified 1922
511 Ga0501047_1008514 3300049581 Bacteria 646
512 Ga0501069_0687269 3300049585 Bacteria 617
513 Ga0501075_1041492 3300049591 Bacteria 622
514 nmdc:mga0k408_537836_c1 3300050493 Unclassified 691
515 nmdc:mga05p37_11308_c1 3300050507 Bacteria 10618
516 nmdc:mga05p37_1974_c1 3300050507 Bacteria 23914
517 nmdc:mga05p37_33273_c1 3300050507 Bacteria 6313
518 nmdc:mga05p37_40240_c1 3300050507 Bacteria 5740
519 nmdc:mga08y16_1217989_c1 3300050511 Unclassified 723
520 nmdc:mga08y16_465410_c1 3300050511 Unclassified 1288
521 nmdc:mga0n895_1137471_c1 3300050512 Bacteria 757
522 nmdc:mga0n895_1187931_c1 3300050512 Bacteria 737
523 nmdc:mga0n895_156399_c1 3300050512 Bacteria 2310
524 nmdc:mga0n895_1747382_c1 3300050512 Unclassified 584
525 nmdc:mga0n895_41592_c1 3300050512 Bacteria 4469
526 nmdc:mga0n895_43425_c1 3300050512 Bacteria 4380
527 nmdc:mga0n895_4548_c1 3300050512 Bacteria 11419
528 nmdc:mga0n895_657785_c1 3300050512 Unclassified 1046
529 nmdc:mga0rr50_13966_c1 3300050513 Bacteria 5248
530 nmdc:mga0rr50_1521771_c1 3300050513 Unclassified 565
531 nmdc:mga0rr50_21_c1 3300050513 Bacteria 125964
532 nmdc:mga0rr50_296644_c1 3300050513 Bacteria 1351
533 nmdc:mga0rr50_376399_c1 3300050513 Unclassified 1197
534 nmdc:mga0rr50_57688_c1 3300050513 Unclassified 2906
535 nmdc:mga08x19_248604_c1 3300050514 Unclassified 1227
536 nmdc:mga08x19_26071_c1 3300050514 Bacteria 3646
537 nmdc:mga08x19_2651_c1 3300050514 Bacteria 10823
538 nmdc:mga08x19_32467_c1 3300050514 Bacteria 3291
539 nmdc:mga08x19_62973_c1 3300050514 Bacteria 2406
540 nmdc:mga08x19_818_c1 3300050514 Bacteria 19749
541 nmdc:mga0a205_1103612_c1 3300050515 Bacteria 641
542 nmdc:mga0a205_141977_c1 3300050515 Unclassified 2301
543 nmdc:mga0a205_267233_c1 3300050515 Bacteria 1588
544 nmdc:mga0a205_647687_c1 3300050515 Unclassified 908
545 nmdc:mga0a205_70602_c1 3300050515 Bacteria 3372
546 Ga0495601_0080411 3300053077 Bacteria 2091
547 Ga0495601_0100680 3300053077 Unclassified 1866
548 Ga0495601_0103880 3300053077 Unclassified 1837
549 Ga0495601_0982460 3300053077 Bacteria 531
550 Ga0495595_0475402 3300053084 Bacteria 636
551 Ga0466962_0696085 3300061719 Unclassified 521
552 Ga0070667_101224083
553 Ga0065704_10230510
554 Ga0065715_10043467
555 Ga0065707_10445881
556 Ga0070676_10002037
557 Ga0070676_10924177
558 Ga0070690_100515316
559 Ga0070690_100568160
560 Ga0070690_101185603
561 Ga0070690_101240184
562 Ga0070670_100961794
563 Ga0070670_101692876
564 Ga0070677_10097474
565 Ga0068869_100230750
566 Ga0068869_100657716
567 Ga0070666_10165518
568 Ga0070666_11440674
569 Ga0068868_100082672
570 Ga0070689_100310593
571 Ga0070691_10003058
572 Ga0070692_10393601
573 Ga0070668_100039104
574 Ga0070669_100018924
575 Ga0070669_100021126
576 Ga0070669_101484849
577 Ga0070675_100071217
578 Ga0070671_100301853
579 Ga0070671_101067299
580 Ga0070674_101451558
581 Ga0070673_100006317
582 Ga0070673_100375505
583 Ga0070673_100476744
584 Ga0070673_100504371
585 Ga0070673_101639962
586 Ga0070667_100117138
587 Ga0070667_101188039
588 Ga0070667_101881808
589 Ga0070709_11288674
590 Ga0070709_11535973
591 Ga0070714_100013834
592 Ga0070713_100029870
593 Ga0070701_10217183
594 Ga0070711_101085324
595 Ga0070705_100003831
596 Ga0070700_100291134
597 Ga0070694_100255641
598 Ga0070694_100337596
599 Ga0070694_100488856
600 Ga0070694_101069282
601 Ga0070708_100367515
602 Ga0070708_100875303
603 Ga0070678_100243004
604 Ga0070678_100998009
605 Ga0070678_101159476
606 Ga0070662_100077249
607 Ga0070662_100272572
608 Ga0070662_100803384
609 Ga0068867_100041451
610 Ga0068867_100174622
611 Ga0068867_100424709
612 Ga0068867_101479713
613 Ga0070685_10787497
614 Ga0070706_100108519
615 Ga0070706_100507297
616 Ga0070707_100247132
617 Ga0070707_100423791
618 Ga0070707_100618256
619 Ga0070707_101453474
620 Ga0070698_100025318
621 Ga0070698_100035459
622 Ga0070698_100239738
623 Ga0070698_100393818
624 Ga0070698_100401446
625 Ga0070698_100734832
626 Ga0070698_100838363
627 Ga0070699_100007487
628 Ga0070699_100128036
629 Ga0070699_100174052
630 Ga0070699_101361315
631 Ga0070679_100492185
632 Ga0070679_101140184
633 Ga0070684_101075512
634 Ga0070697_100024715
635 Ga0070697_100806742
636 Ga0068853_100439325
637 Ga0068853_101163850
638 Ga0070672_100003555
639 Ga0070672_100098053
640 Ga0070686_100297016
641 Ga0070686_100672686
642 Ga0070695_100039927
643 Ga0070695_100367761
644 Ga0070695_100711905
645 Ga0070695_101686235
646 Ga0070696_100199531
647 Ga0070696_100465707
648 Ga0070696_101694185
649 Ga0070696_101789299
650 Ga0070665_100002202
651 Ga0070665_100566183
652 Ga0070665_102102572
653 Ga0070704_100098919
654 Ga0070704_100118633
655 Ga0070704_100272119
656 Ga0070704_101795216
657 Ga0068855_100914905
658 Ga0070664_100332389
659 Ga0070664_101089294
660 Ga0070664_101688037
661 Ga0068854_100070780
662 Ga0068854_100170937
663 Ga0070702_100000517
664 Ga0068859_100080414
665 Ga0068859_100131153
666 Ga0068859_101158142
667 Ga0068859_101337387
668 Ga0068859_101427169
669 Ga0068864_100372517
670 Ga0068864_101328842
671 Ga0068864_101566206
672 Ga0068866_10045045
673 Ga0068866_10638056
674 Ga0068861_100007843
675 Ga0068861_100418874
676 Ga0068861_102157675
677 Ga0068861_102462258
678 Ga0068851_10262149
679 Ga0068870_10203455
680 Ga0068863_100002629
681 Ga0068858_100005384
682 Ga0068858_100006739
683 Ga0068858_100052470
684 Ga0068858_100324631
685 Ga0068858_100378651
686 Ga0068858_100427163
687 Ga0068858_100513222
688 Ga0068860_100042168
689 Ga0068860_100154939
690 Ga0068860_100157492
691 Ga0068860_100186949
692 Ga0068860_101616128
693 Ga0068860_102536850
694 Ga0068862_100055675
695 Ga0068862_100143021
696 Ga0068862_100181066
697 Ga0068862_100651418
698 Ga0068862_100782499
699 Ga0081455_10010539
700 Ga0075432_10149878
701 Ga0070715_10180488
702 Ga0070715_10455526
703 Ga0070716_101122403
704 Ga0097621_100001498
705 Ga0097621_100088081
706 Ga0097621_100094247
707 Ga0097621_100676966
708 Ga0097621_101008584
709 Ga0068871_100018975
710 Ga0068871_100028745
711 Ga0068871_100569245
712 Ga0068871_100607894
713 Ga0068871_101534368
714 Ga0075428_100184874
715 Ga0075433_10025532
716 Ga0075433_10119451
717 Ga0075433_10994936
718 Ga0075433_11138635
719 Ga0075433_11474391
720 Ga0075433_11788627
721 Ga0075434_100036073
722 Ga0075434_100042648
723 Ga0075434_100220132
724 Ga0075434_100519060
725 Ga0075434_100962959
726 Ga0075434_101147532
727 Ga0068865_100369044
728 Ga0075436_100001150
729 Ga0075436_100012286
730 Ga0075436_100030457
731 Ga0075436_100035702
732 Ga0075436_100108832
733 Ga0075436_100466767
734 Ga0075436_101002102
735 Ga0097620_100080414
736 Ga0097620_100131155
737 Ga0097620_101158194
738 Ga0097620_101337554
739 Ga0097620_101427010
740 Ga0075435_100017089
741 Ga0075435_100024847
742 Ga0075435_100033682
743 Ga0075435_100199933
744 Ga0075435_100762705
745 Ga0099795_10099803
746 Ga0105240_10547680
747 Ga0105240_10745339
748 Ga0105240_12012438
749 Ga0111539_10721875
750 Ga0111539_11966528
751 Ga0105245_10125920
752 Ga0105245_10424967
753 Ga0105245_11075830
754 Ga0105245_12091739
755 Ga0105247_10040933
756 Ga0105247_10845975
757 Ga0114129_10002817
758 Ga0114129_10014325
759 Ga0114129_10405359
760 Ga0114129_11110177
761 Ga0114129_12014279
762 Ga0105243_10005144
763 Ga0105243_10371268
764 Ga0105241_10250979
765 Ga0105242_10012687
766 Ga0105242_10021480
767 Ga0105242_10097750
768 Ga0105242_10480156
769 Ga0105242_10940946
770 Ga0105242_11887959
771 Ga0105242_12557126
772 Ga0105248_10033608
773 Ga0105248_10039293
774 Ga0105248_10091682
775 Ga0105248_10260330
776 Ga0105248_10377880
777 Ga0105248_10469029
778 Ga0105248_10680260
779 Ga0105248_11054019
780 Ga0105248_11300910
781 Ga0105248_11666444
782 Ga0105248_12597516
783 Ga0105237_10335872
784 Ga0105237_11404709
785 Ga0105238_10286266
786 Ga0105238_11754491
787 Ga0105249_10223529
788 Ga0105249_10318712
789 Ga0105239_10083264
790 Ga0105246_10419789
791 Ga0157323_1009882
792 Ga0157313_1004481
793 Ga0157374_10129027
794 Ga0157374_11844737
795 Ga0157378_10171093
796 Ga0157378_10301160
797 Ga0157378_10395397
798 Ga0157378_10467595
799 Ga0157378_11221089
800 Ga0157378_11753374
801 Ga0163162_10877381
802 Ga0163162_11234578
803 Ga0157375_10269584
804 Ga0163163_10176330
805 Ga0163163_11506511
806 Ga0157380_10115724
807 Ga0157380_10136585
808 Ga0157380_10362199
809 Ga0157377_10450929
810 Ga0157379_10008361
811 Ga0157379_10016475
812 Ga0157379_10040708
813 Ga0157379_10582550
814 Ga0157379_10855834
815 Ga0157376_10008892
816 Ga0157376_11464378
817 Ga0157376_11867768
818 Ga0207682_10041752
819 Ga0207642_10055591
820 Ga0207642_10747760
821 Ga0207642_11023414
822 Ga0207710_10428289
823 Ga0207688_10064766
824 Ga0207680_10008804
825 Ga0207680_10133246
826 Ga0207680_10904711
827 Ga0207699_10828000
828 Ga0207645_10004224
829 Ga0207645_10020315
830 Ga0207643_10171417
831 Ga0207684_10055135
832 Ga0207684_10221180
833 Ga0207707_11383687
834 Ga0207707_11551105
835 Ga0207695_11326148
836 Ga0207671_11133534
837 Ga0207663_10479277
838 Ga0207652_10699098
839 Ga0207652_10784969
840 Ga0207646_10353623
841 Ga0207646_11049608
842 Ga0207646_11694678
843 Ga0207681_10015903
844 Ga0207659_10000623
845 Ga0207659_10011431
846 Ga0207659_10936633
847 Ga0207687_10179252
848 Ga0207700_10231679
849 Ga0207664_10096240
850 Ga0207644_10298505
851 Ga0207644_10701425
852 Ga0207690_11292390
853 Ga0207706_10153671
854 Ga0207706_10178780
855 Ga0207706_10307918
856 Ga0207686_10007127
857 Ga0207686_10234879
858 Ga0207686_10285136
859 Ga0207686_10605085
860 Ga0207686_11062230
861 Ga0207709_10007465
862 Ga0207670_10047050
863 Ga0207669_10145914
864 Ga0207704_10045042
865 Ga0207704_10174692
866 Ga0207704_11652134
867 Ga0207665_11196105
868 Ga0207691_10047266
869 Ga0207691_10080834
870 Ga0207691_10267558
871 Ga0207711_10042913
872 Ga0207711_10159761
873 Ga0207711_10277682
874 Ga0207711_10401104
875 Ga0207711_10470018
876 Ga0207711_10579316
877 Ga0207711_10762626
878 Ga0207689_10080795
879 Ga0207689_10245176
880 Ga0207689_10733963
881 Ga0207679_10166051
882 Ga0207679_11107392
883 Ga0207667_10778885
884 Ga0207667_11597121
885 Ga0207651_10128476
886 Ga0207651_10418139
887 Ga0207651_10553809
888 Ga0207712_10169333
889 Ga0207668_10381528
890 Ga0207640_10207102
891 Ga0207640_10567230
892 Ga0207658_10020065
893 Ga0207677_10033700
894 Ga0207677_10043073
895 Ga0207677_10253508
896 Ga0207703_10021790
897 Ga0207703_10038158
898 Ga0207703_10038934
899 Ga0207703_10041746
900 Ga0207703_10051454
901 Ga0207703_10295539
902 Ga0207703_10394156
903 Ga0207703_10608830
904 Ga0207639_11373845
905 Ga0207708_10002596
906 Ga0207708_10081203
907 Ga0207708_10231224
908 Ga0207708_11914445
909 Ga0207641_10000811
910 Ga0207641_10382676
911 Ga0207648_10018676
912 Ga0207648_10177549
913 Ga0207648_10851751
914 Ga0207676_10051889
915 Ga0207675_100001444
916 Ga0207675_100125772
917 Ga0207675_100203398
918 Ga0207675_101388737
919 Ga0207675_101819217
920 Ga0207683_10319362
921 Ga0207683_10980190
922 Ga0207698_10892741
923 Ga0207428_10053007
924 Ga0207428_10244487
925 Ga0207428_10757642
926 Ga0268266_10935363
927 Ga0268265_10037532
928 Ga0268265_10086832
929 Ga0268265_10581922
930 Ga0268265_10971699
931 Ga0268265_11633506
932 Ga0268264_10021773
933 Ga0268264_10057300
934 Ga0268264_10123310
935 Ga0268264_10123528
936 Ga0268264_10127766
937 Ga0268264_10550923
938 Ga0268264_11405301
939 Ga0268264_11617299
940 Ga0265332_10038862
941 Ga0265314_10033185
942 Ga0307416_103690796
943 Ga0373958_0017948
944 Ga0373938_0140685
945 Ga0373934_0090386
946 Ga0373934_0442130
947 Ga0373944_0248695
948 Ga0373952_0046941
949 Ga0373932_0186629
950 Ga0373939_0068385
951 Ga0373941_0021560
952 Ga0373945_0099200
953 Ga0373953_0238625
954 Ga0373953_0253028
955 Ga0373956_0339784
956 Ga0373943_0601031
957 Ga0373946_0539822
958 Ga0373955_0391417
959 Ga0373955_0737376
960 Ga0373961_0184497
961 Ga0373924_0042784
962 Ga0373935_0174700
963 Ga0373935_0830869
964 Ga0373935_1253942
965 Ga0373933_0120982
966 Ga0373933_0373598
967 Ga0373947_0320724
968 Ga0373947_0356479
969 Ga0373947_0615351
970 Ga0373937_0017244
971 Ga0373937_0230768
972 Ga0373937_0954100
973 Ga0373937_1326834
974 Ga0373937_1532349
975 Ga0373925_0044331
976 Ga0373925_0156808
977 Ga0373925_1066461
978 Ga0395900_0704507
979 Ga0395898_1657561
980 Ga0453683_0405691
981 Ga0451576_0104467
982 Ga0451576_2181894
983 Ga0495592_0163460
984 Ga0495592_0552277
985 Ga0495603_0359596
986 Ga0495629_0451897
987 Ga0495651_0624738
988 Ga0495580_0618164
989 Ga0495580_0892053
990 Ga0495582_0554055
991 Ga0495639_0447023
992 Ga0495662_0311806
993 Ga0495662_0408193
994 Ga0495664_0485842
995 Ga0495610_0381092
996 Ga0495618_0574555
997 Ga0495628_0320700
998 Ga0495628_0330772
999 Ga0495628_0340107
1000 Ga0495630_0196341
1001 Ga0495663_0290000
1002 Ga0495642_0297895
1003 Ga0495652_0230443
1004 Ga0495652_0997422
1005 Ga0495640_0084189
1006 Ga0495640_0185587
1007 Ga0495640_0525675
1008 Ga0495586_0752471
1009 Ga0495587_0081435
1010 Ga0495587_0165358
1011 Ga0495645_0002239
1012 Ga0495667_0317505
1013 Ga0495667_0967711
1014 Ga0495656_0344836
1015 Ga0495656_0429527
1016 Ga0495668_0601876
1017 Ga0495634_0275681
1018 Ga0495634_0639459
1019 Ga0495635_0124786
1020 Ga0495635_0325000
1021 Ga0495659_0069174
1022 Ga0495659_0078808
1023 Ga0495657_0356325
1024 Ga0495647_0040061
1025 Ga0495647_0056502
1026 Ga0495658_0008993
1027 Ga0495658_0029211
1028 Ga0495658_0065651
1029 Ga0495658_0229317
1030 Ga0495658_0612104
1031 Ga0495658_0701479
1032 Ga0495669_0559120
1033 Ga0495613_0432677
1034 Ga0495670_0410135
1035 Ga0495600_0722635
1036 Ga0495674_0115320
1037 Ga0495674_1468252
1038 Ga0495676_0473632
1039 Ga0495680_0446545
1040 Ga0495684_0601018
1041 Ga0496102_0893456
1042 Ga0496104_0704130
1043 Ga0496104_1280506
1044 Ga0496105_0369043
1045 Ga0496107_0090472
1046 Ga0496107_0316315
1047 Ga0496107_1186860
1048 Ga0496108_1166667
1049 Ga0496109_1132696
1050 Ga0496109_2012017
1051 Ga0496110_1167105
1052 Ga0496110_1360654
1053 Ga0496112_0068317
1054 Ga0496112_0151304
1055 Ga0496112_0203919
1056 Ga0496112_0367117
1057 Ga0496114_0183627
1058 Ga0496114_0482257
1059 Ga0496114_0858147
1060 Ga0496114_1582289
1061 Ga0496115_0150429
1062 Ga0501047_1008514
1063 Ga0501069_0687269
1064 Ga0501075_1041492
1065 nmdc:mga0k408_537836_c1
1066 nmdc:mga05p37_11308_c1
1067 nmdc:mga05p37_1974_c1
1068 nmdc:mga05p37_33273_c1
1069 nmdc:mga05p37_40240_c1
1070 nmdc:mga08y16_1217989_c1
1071 nmdc:mga08y16_465410_c1
1072 nmdc:mga0n895_1137471_c1
1073 nmdc:mga0n895_1187931_c1
1074 nmdc:mga0n895_156399_c1
1075 nmdc:mga0n895_1747382_c1
1076 nmdc:mga0n895_41592_c1
1077 nmdc:mga0n895_43425_c1
1078 nmdc:mga0n895_4548_c1
1079 nmdc:mga0n895_657785_c1
1080 nmdc:mga0rr50_13966_c1
1081 nmdc:mga0rr50_1521771_c1
1082 nmdc:mga0rr50_21_c1
1083 nmdc:mga0rr50_296644_c1
1084 nmdc:mga0rr50_376399_c1
1085 nmdc:mga0rr50_57688_c1
1086 nmdc:mga08x19_248604_c1
1087 nmdc:mga08x19_26071_c1
1088 nmdc:mga08x19_2651_c1
1089 nmdc:mga08x19_32467_c1
1090 nmdc:mga08x19_62973_c1
1091 nmdc:mga08x19_818_c1
1092 nmdc:mga0a205_1103612_c1
1093 nmdc:mga0a205_141977_c1
1094 nmdc:mga0a205_267233_c1
1095 nmdc:mga0a205_647687_c1
1096 nmdc:mga0a205_70602_c1
1097 Ga0495601_0080411
1098 Ga0495601_0100680
1099 Ga0495601_0103880
1100 Ga0495601_0982460
1101 Ga0495595_0475402
1102 Ga0466962_0696085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v0s-assembly1.cif.gz_B crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis 0.8798 5 64
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.8445 1 123
7qri-assembly1.cif.gz_B regulatory domain dimer of tryptophan hydroxylase 2 in complex with l-phe 0.8402 68 124
2f06-assembly1.cif.gz_A crystal structure of protein bt0572 from bacteroides thetaiotaomicron 0.8204 1 123
1sc6-assembly1.cif.gz_B crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+ 0.7895 68 124
ID Description Score Start End Superfamily
2zhoB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8429 3 66 3.30.70.260
2f06B00 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.8373 2 123 3.30.2130.10
af_A0A1D6F177_170_222_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8318 68 115 3.30.70.260
5yeiF02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8243 3 66 3.30.70.260
af_Q57991_302_384_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8226 3 60 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A2E6ZRT6-F1-model_v4 ACT domain-containing protein 0.9531 1 126
AF-A0A2E6ZRT6-F1-model_v4 ACT domain-containing protein 0.9458 1 126
AF-A0A2V8BH84-F1-model_v4 Amino acid-binding protein 0.9448 1 126
AF-A0A523DKH9-F1-model_v4 ACT domain-containing protein 0.9418 1 126
AF-A0A7X9HLT1-F1-model_v4 Amino acid-binding protein 0.9395 1 123

Map