F462571

General Info

Members Datasets Scaffolds Average Seq Length
551 235 1102 263

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100099117|Ga0070689_1000991173
Length 282
Sequence LAPPAVENRYVPQLHSVVMVRPIIALLTDFGTRDHYSGVMKGVVLGICPDVTLVDLSHDLPPHDIVFAAHELAATYKYFPLGTIFVVVVDPAVGTARRGLAAEAADRKFVAPDNGVLTALFQEAPPKRVVELTERKYARPTVSRTFEGRDRFAPAAAFLAKGIHLEAFGRTVTDYHVLGLNPPELNGTTLRGRVIRVDRFGNIVTNLDRKSCERLTGSPAGLQLSIAGKTIDRIVSTYGDLANGEIGALFGSTDHLECSAQSANAAERLGVSVGDPVELRRI

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
151 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0
Rhizoplane 2.18
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 17.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100099117 3300005340 Bacteria 2305
2 Ga0065712_10091465 3300005290 Bacteria 2366
3 Ga0065715_10023984 3300005293 Bacteria 2453
4 Ga0065715_10178043 3300005293 Bacteria 1497
5 Ga0065707_10010978 3300005295 Bacteria 5985
6 Ga0065707_10108653 3300005295 Bacteria 2501
7 Ga0070676_10501772 3300005328 Bacteria 861
8 Ga0070670_100175899 3300005331 Bacteria 1857
9 Ga0070670_100193631 3300005331 Bacteria 1766
10 Ga0070670_100721641 3300005331 Unclassified 897
11 Ga0068869_100076971 3300005334 Unclassified 2480
12 Ga0068869_100592289 3300005334 Bacteria 936
13 Ga0068868_100048563 3300005338 Bacteria 3329
14 Ga0068868_100106354 3300005338 Bacteria 2276
15 Ga0068868_100186659 3300005338 Bacteria 1723
16 Ga0070689_100360023 3300005340 Bacteria 1222
17 Ga0070687_100244372 3300005343 Bacteria 1112
18 Ga0070668_100478219 3300005347 Bacteria 1075
19 Ga0070675_100063991 3300005354 Bacteria 3041
20 Ga0070675_100124805 3300005354 Bacteria 2190
21 Ga0070675_100207663 3300005354 Unclassified 1701
22 Ga0070671_100030267 3300005355 Bacteria 4467
23 Ga0070671_100089619 3300005355 Bacteria 2575
24 Ga0070674_100015293 3300005356 Bacteria 4788
25 Ga0070673_100002948 3300005364 Bacteria 10491
26 Ga0070673_100029864 3300005364 Unclassified 4070
27 Ga0070673_100036762 3300005364 Bacteria 3726
28 Ga0070673_100467019 3300005364 Unclassified 1137
29 Ga0070673_100577652 3300005364 Unclassified 1023
30 Ga0070673_100769876 3300005364 Bacteria 887
31 Ga0070688_100042467 3300005365 Bacteria 2797
32 Ga0070659_100128990 3300005366 Bacteria 2053
33 Ga0070667_100386493 3300005367 Unclassified 1272
34 Ga0070701_10128621 3300005438 Unclassified 1436
35 Ga0070700_100175937 3300005441 Bacteria 1485
36 Ga0070700_100315347 3300005441 Bacteria 1147
37 Ga0070694_100303812 3300005444 Unclassified 1223
38 Ga0070708_100057106 3300005445 Bacteria 3474
39 Ga0070708_100151539 3300005445 Bacteria 2157
40 Ga0070708_100297136 3300005445 Unclassified 1520
41 Ga0070708_100723721 3300005445 Unclassified 936
42 Ga0070708_100733705 3300005445 Bacteria 929
43 Ga0070663_100324344 3300005455 Unclassified 1239
44 Ga0070678_100180758 3300005456 Unclassified 1726
45 Ga0070681_10096232 3300005458 Bacteria 2909
46 Ga0070681_10102235 3300005458 Unclassified 2811
47 Ga0068867_100011803 3300005459 Bacteria 6169
48 Ga0070706_100017523 3300005467 Bacteria 6611
49 Ga0070706_100036485 3300005467 Unclassified 4540
50 Ga0070707_100027472 3300005468 Bacteria 5414
51 Ga0070707_100076354 3300005468 Bacteria 3232
52 Ga0070707_100217701 3300005468 Bacteria 1861
53 Ga0070698_100264034 3300005471 Bacteria 1654
54 Ga0070699_100454183 3300005518 Bacteria 1162
55 Ga0070679_100533961 3300005530 Unclassified 1117
56 Ga0070684_100049574 3300005535 Bacteria 3645
57 Ga0070684_100250155 3300005535 Bacteria 1620
58 Ga0070697_100013459 3300005536 Bacteria 6419
59 Ga0070697_100038312 3300005536 Bacteria 3872
60 Ga0070672_100006792 3300005543 Bacteria 7727
61 Ga0070695_100172325 3300005545 Unclassified 1527
62 Ga0070695_100223701 3300005545 Bacteria 1357
63 Ga0070696_100096346 3300005546 Bacteria 2114
64 Ga0070693_100037528 3300005547 Unclassified 2702
65 Ga0070665_100000771 3300005548 Bacteria 42242
66 Ga0070665_100949949 3300005548 Bacteria 872
67 Ga0070664_100312201 3300005564 Unclassified 1423
68 Ga0070664_100343122 3300005564 Bacteria 1357
69 Ga0068854_100144214 3300005578 Bacteria 1830
70 Ga0070702_100301239 3300005615 Unclassified 1109
71 Ga0068852_100131893 3300005616 Bacteria 2302
72 Ga0068859_100106375 3300005617 Bacteria 2865
73 Ga0068859_100225888 3300005617 Unclassified 1960
74 Ga0068859_100489149 3300005617 Bacteria 1326
75 Ga0068859_100588057 3300005617 Bacteria 1207
76 Ga0068859_100653755 3300005617 Bacteria 1143
77 Ga0068864_100176317 3300005618 Bacteria 1952
78 Ga0068861_100272991 3300005719 Bacteria 1453
79 Ga0068861_100423147 3300005719 Unclassified 1187
80 Ga0068858_100006390 3300005842 Bacteria 11484
81 Ga0068858_100015750 3300005842 Bacteria 7111
82 Ga0068858_100024839 3300005842 Bacteria 5579
83 Ga0068858_100180399 3300005842 Bacteria 1994
84 Ga0068858_100424258 3300005842 Bacteria 1279
85 Ga0068860_100153417 3300005843 Bacteria 2219
86 Ga0068860_100194664 3300005843 Unclassified 1963
87 Ga0068862_100220288 3300005844 Bacteria 1718
88 Ga0075363_100022651 3300006048 Bacteria 3177
89 Ga0075364_10051969 3300006051 Bacteria 2677
90 Ga0075364_10052568 3300006051 Bacteria 2662
91 Ga0075362_10032870 3300006177 Bacteria 2254
92 Ga0075367_10037028 3300006178 Bacteria 2832
93 Ga0075367_10065315 3300006178 Bacteria 2178
94 Ga0075366_10043502 3300006195 Bacteria 2660
95 Ga0097621_100035324 3300006237 Bacteria 3993
96 Ga0068871_100002596 3300006358 Bacteria 12325
97 Ga0075428_100000439 3300006844 Bacteria 41450
98 Ga0075428_100003506 3300006844 Bacteria 17186
99 Ga0075428_100004439 3300006844 Bacteria 15493
100 Ga0075428_100008917 3300006844 Bacteria 11131
101 Ga0075428_100158900 3300006844 Bacteria 2454
102 Ga0075428_100295486 3300006844 Unclassified 1742
103 Ga0075428_100699655 3300006844 Unclassified 1080
104 Ga0075430_100000107 3300006846 Bacteria 49582
105 Ga0075430_100002924 3300006846 Bacteria 14282
106 Ga0075430_100003427 3300006846 Bacteria 13256
107 Ga0075430_100013952 3300006846 Bacteria 6847
108 Ga0075430_100113455 3300006846 Bacteria 2259
109 Ga0075431_100006311 3300006847 Bacteria 11778
110 Ga0075431_100014360 3300006847 Bacteria 8009
111 Ga0075431_100016083 3300006847 Bacteria 7592
112 Ga0075431_100020666 3300006847 Bacteria 6727
113 Ga0075431_100154064 3300006847 Bacteria 2365
114 Ga0075431_100318238 3300006847 Bacteria 1569
115 Ga0075433_10005420 3300006852 Bacteria 10022
116 Ga0075433_10030536 3300006852 Bacteria 4599
117 Ga0075433_10616353 3300006852 Unclassified 952
118 Ga0075434_100280218 3300006871 Bacteria 1687
119 Ga0075429_100004861 3300006880 Bacteria 11576
120 Ga0075429_100025249 3300006880 Bacteria 5158
121 Ga0075429_100044617 3300006880 Bacteria 3856
122 Ga0075429_100058785 3300006880 Bacteria 3349
123 Ga0075429_100116635 3300006880 Bacteria 2334
124 Ga0068865_100000963 3300006881 Bacteria 16412
125 Ga0068865_100033568 3300006881 Bacteria 3437
126 Ga0075436_100051013 3300006914 Bacteria 2855
127 Ga0075436_100275392 3300006914 Bacteria 1202
128 Ga0097620_100106376 3300006931 Bacteria 2865
129 Ga0097620_100225878 3300006931 Unclassified 1960
130 Ga0097620_100489176 3300006931 Bacteria 1326
131 Ga0097620_100588080 3300006931 Bacteria 1207
132 Ga0097620_100653751 3300006931 Bacteria 1143
133 Ga0075435_100009027 3300007076 Bacteria 7189
134 Ga0075435_100017520 3300007076 Bacteria 5425
135 Ga0075435_100134146 3300007076 Bacteria 2073
136 Ga0075435_100333087 3300007076 Bacteria 1300
137 Ga0075435_100400178 3300007076 Bacteria 1181
138 Ga0105240_10268189 3300009093 Bacteria 1967
139 Ga0105240_10313112 3300009093 Bacteria 1792
140 Ga0111539_10000671 3300009094 Bacteria 44215
141 Ga0111539_10000799 3300009094 Bacteria 40975
142 Ga0111539_10004675 3300009094 Bacteria 17887
143 Ga0111539_10009963 3300009094 Bacteria 11982
144 Ga0111539_10061659 3300009094 Bacteria 4442
145 Ga0111539_10094410 3300009094 Bacteria 3514
146 Ga0111539_10129205 3300009094 Bacteria 2958
147 Ga0111539_10164845 3300009094 Bacteria 2591
148 Ga0111539_10295945 3300009094 Unclassified 1883
149 Ga0111539_10313266 3300009094 Bacteria 1827
150 Ga0111539_10324711 3300009094 Bacteria 1791
151 Ga0111539_10440686 3300009094 Bacteria 1517
152 Ga0111539_10648245 3300009094 Bacteria 1230
153 Ga0111539_10749938 3300009094 Bacteria 1136
154 Ga0105245_10009561 3300009098 Bacteria 8456
155 Ga0105247_10007659 3300009101 Bacteria 6608
156 Ga0114129_10000043 3300009147 Bacteria 106438
157 Ga0114129_10000076 3300009147 Bacteria 90985
158 Ga0114129_10013579 3300009147 Bacteria 11604
159 Ga0114129_10014685 3300009147 Bacteria 11158
160 Ga0114129_10024852 3300009147 Bacteria 8493
161 Ga0114129_10042636 3300009147 Bacteria 6387
162 Ga0114129_10064676 3300009147 Bacteria 5104
163 Ga0114129_10108541 3300009147 Bacteria 3831
164 Ga0114129_10143663 3300009147 Bacteria 3269
165 Ga0114129_10339531 3300009147 Unclassified 1993
166 Ga0114129_10536796 3300009147 Bacteria 1523
167 Ga0114129_10609385 3300009147 Unclassified 1414
168 Ga0105243_10819134 3300009148 Unclassified 919
169 Ga0105242_10016481 3300009176 Bacteria 5745
170 Ga0105242_10018610 3300009176 Bacteria 5432
171 Ga0105242_10028318 3300009176 Bacteria 4459
172 Ga0105242_10180003 3300009176 Bacteria 1864
173 Ga0105242_10377545 3300009176 Unclassified 1317
174 Ga0105248_10034185 3300009177 Bacteria 5683
175 Ga0105248_10115424 3300009177 Bacteria 3028
176 Ga0105248_10128710 3300009177 Bacteria 2856
177 Ga0105248_10260779 3300009177 Bacteria 1951
178 Ga0105248_10543714 3300009177 Bacteria 1310
179 Ga0105248_10884212 3300009177 Unclassified 1009
180 Ga0105249_10043272 3300009553 Bacteria 4096
181 Ga0105249_10066222 3300009553 Bacteria 3325
182 Ga0105249_10261383 3300009553 Unclassified 1720
183 Ga0157378_10606273 3300013297 Unclassified 1107
184 Ga0157378_10748374 3300013297 Bacteria 1000
185 Ga0163162_10027533 3300013306 Bacteria 5620
186 Ga0163162_10092220 3300013306 Unclassified 3112
187 Ga0157375_10627304 3300013308 Unclassified 1233
188 Ga0157375_10761936 3300013308 Unclassified 1119
189 Ga0163163_10004308 3300014325 Bacteria 12126
190 Ga0163163_10160481 3300014325 Bacteria 2294
191 Ga0163163_10313705 3300014325 Bacteria 1621
192 Ga0163163_10396780 3300014325 Unclassified 1438
193 Ga0157380_10159976 3300014326 Bacteria 1956
194 Ga0157380_10196747 3300014326 Unclassified 1785
195 Ga0157380_10268946 3300014326 Bacteria 1553
196 Ga0157379_10025540 3300014968 Bacteria 5249
197 Ga0157379_10053636 3300014968 Unclassified 3602
198 Ga0157376_10026929 3300014969 Bacteria 4550
199 Ga0157376_10132450 3300014969 Bacteria 2226
200 Ga0207697_10019008 3300025315 Bacteria 2814
201 Ga0207697_10022936 3300025315 Bacteria 2556
202 Ga0207656_10266793 3300025321 Unclassified 842
203 Ga0207642_10008916 3300025899 Bacteria 3466
204 Ga0207642_10023530 3300025899 Bacteria 2462
205 Ga0207710_10019568 3300025900 Bacteria 2888
206 Ga0207710_10028360 3300025900 Bacteria 2430
207 Ga0207688_10016272 3300025901 Bacteria 4034
208 Ga0207645_10018929 3300025907 Bacteria 4522
209 Ga0207645_10021888 3300025907 Bacteria 4164
210 Ga0207684_10012804 3300025910 Bacteria 7268
211 Ga0207684_10051361 3300025910 Unclassified 3498
212 Ga0207707_10088855 3300025912 Bacteria 2700
213 Ga0207695_10222891 3300025913 Bacteria 1792
214 Ga0207662_10045170 3300025918 Bacteria 2604
215 Ga0207646_10010625 3300025922 Bacteria 8966
216 Ga0207646_10024651 3300025922 Bacteria 5510
217 Ga0207646_10504211 3300025922 Unclassified 1090
218 Ga0207681_10063131 3300025923 Bacteria 2553
219 Ga0207650_10063737 3300025925 Bacteria 2757
220 Ga0207650_10190958 3300025925 Bacteria 1637
221 Ga0207659_10142342 3300025926 Bacteria 1863
222 Ga0207659_10252107 3300025926 Bacteria 1432
223 Ga0207659_10273598 3300025926 Bacteria 1378
224 Ga0207659_10299227 3300025926 Bacteria 1321
225 Ga0207687_10004276 3300025927 Bacteria 9551
226 Ga0207644_10062554 3300025931 Bacteria 2700
227 Ga0207690_10576564 3300025932 Bacteria 917
228 Ga0207706_10200919 3300025933 Bacteria 1748
229 Ga0207686_10011935 3300025934 Bacteria 4767
230 Ga0207686_10141924 3300025934 Bacteria 1661
231 Ga0207686_10323941 3300025934 Unclassified 1152
232 Ga0207670_10016703 3300025936 Bacteria 4419
233 Ga0207669_10377313 3300025937 Unclassified 1104
234 Ga0207704_10021671 3300025938 Bacteria 3427
235 Ga0207704_10036889 3300025938 Bacteria 2818
236 Ga0207704_10093321 3300025938 Bacteria 1984
237 Ga0207665_10255861 3300025939 Bacteria 1295
238 Ga0207691_10004842 3300025940 Bacteria 13016
239 Ga0207691_10244632 3300025940 Unclassified 1550
240 Ga0207691_10304590 3300025940 Bacteria 1368
241 Ga0207691_10649492 3300025940 Unclassified 891
242 Ga0207711_10045674 3300025941 Bacteria 3743
243 Ga0207711_10095148 3300025941 Bacteria 2627
244 Ga0207711_10110539 3300025941 Bacteria 2444
245 Ga0207711_10225318 3300025941 Unclassified 1716
246 Ga0207711_10618955 3300025941 Unclassified 1010
247 Ga0207689_10144771 3300025942 Bacteria 1958
248 Ga0207689_10198856 3300025942 Bacteria 1654
249 Ga0207689_10701793 3300025942 Bacteria 853
250 Ga0207661_10109623 3300025944 Bacteria 2332
251 Ga0207651_10005769 3300025960 Bacteria 6393
252 Ga0207651_10010656 3300025960 Bacteria 5105
253 Ga0207712_10061549 3300025961 Bacteria 2664
254 Ga0207712_10085074 3300025961 Bacteria 2313
255 Ga0207668_10036047 3300025972 Bacteria 3300
256 Ga0207668_10405511 3300025972 Bacteria 1153
257 Ga0207640_10349948 3300025981 Bacteria 1187
258 Ga0207658_10231233 3300025986 Bacteria 1561
259 Ga0207677_10113080 3300026023 Bacteria 2026
260 Ga0207677_10125064 3300026023 Unclassified 1942
261 Ga0207677_10168567 3300026023 Bacteria 1709
262 Ga0207703_10025486 3300026035 Bacteria 4651
263 Ga0207703_10080783 3300026035 Unclassified 2708
264 Ga0207703_10086970 3300026035 Unclassified 2619
265 Ga0207703_10152764 3300026035 Bacteria 2014
266 Ga0207703_10523680 3300026035 Bacteria 1115
267 Ga0207708_10036102 3300026075 Bacteria 3762
268 Ga0207708_10078294 3300026075 Bacteria 2538
269 Ga0207708_10106723 3300026075 Unclassified 2172
270 Ga0207708_10228982 3300026075 Bacteria 1492
271 Ga0207648_10006957 3300026089 Bacteria 11197
272 Ga0207676_10124008 3300026095 Bacteria 2184
273 Ga0207676_10156576 3300026095 Bacteria 1969
274 Ga0207675_100049778 3300026118 Bacteria 3909
275 Ga0207683_10037730 3300026121 Bacteria 4209
276 Ga0207683_10156436 3300026121 Bacteria 2059
277 Ga0207698_10225577 3300026142 Bacteria 1697
278 Ga0207428_10000797 3300027907 Bacteria 35667
279 Ga0207428_10002504 3300027907 Bacteria 18348
280 Ga0207428_10007851 3300027907 Bacteria 9704
281 Ga0207428_10010433 3300027907 Bacteria 8298
282 Ga0207428_10036939 3300027907 Bacteria 3979
283 Ga0207428_10043824 3300027907 Bacteria 3612
284 Ga0207428_10104429 3300027907 Bacteria 2186
285 Ga0268266_10003281 3300028379 Bacteria 16279
286 Ga0268265_10096692 3300028380 Unclassified 2374
287 Ga0268265_10176725 3300028380 Bacteria 1830
288 Ga0268264_10166015 3300028381 Unclassified 1993
289 Ga0268264_10366924 3300028381 Bacteria 1375
290 Ga0268264_10486676 3300028381 Bacteria 1201
291 Ga0265316_10158853 3300031344 Bacteria 1691
292 Ga0307408_100018447 3300031548 Bacteria 4684
293 Ga0307408_100036988 3300031548 Bacteria 3435
294 Ga0307408_100118972 3300031548 Bacteria 2043
295 Ga0307408_100360145 3300031548 Bacteria 1237
296 Ga0265314_10113918 3300031711 Bacteria 1714
297 Ga0307405_10028602 3300031731 Bacteria 3249
298 Ga0307405_10234813 3300031731 Bacteria 1354
299 Ga0307413_10085642 3300031824 Bacteria 2035
300 Ga0307410_10038036 3300031852 Bacteria 3149
301 Ga0307407_10327171 3300031903 Unclassified 1078
302 Ga0307412_10059489 3300031911 Unclassified 2561
303 Ga0307412_10105221 3300031911 Bacteria 2004
304 Ga0307412_10181135 3300031911 Bacteria 1585
305 Ga0307412_10302691 3300031911 Bacteria 1264
306 Ga0307409_100080657 3300031995 Bacteria 2627
307 Ga0307409_100155294 3300031995 Bacteria 1993
308 Ga0307409_100184588 3300031995 Bacteria 1850
309 Ga0307416_100016613 3300032002 Bacteria 5123
310 Ga0307416_100035477 3300032002 Bacteria 3809
311 Ga0307416_100141053 3300032002 Unclassified 2190
312 Ga0307416_100447929 3300032002 Unclassified 1343
313 Ga0307416_100705663 3300032002 Bacteria 1098
314 Ga0307416_100823395 3300032002 Unclassified 1025
315 Ga0307411_10561584 3300032005 Unclassified 975
316 Ga0307415_100010449 3300032126 Bacteria 5260
317 Ga0307415_100031730 3300032126 Bacteria 3408
318 Ga0373934_0026868 3300035086 Unclassified 2234
319 Ga0373941_0002267 3300035115 Bacteria 4210
320 Ga0373941_0170433 3300035115 Unclassified 811
321 Ga0373956_0006264 3300035119 Bacteria 4762
322 Ga0373957_0009280 3300035120 Bacteria 3215
323 Ga0373955_0006237 3300035172 Bacteria 5426
324 Ga0373933_0034078 3300035724 Bacteria 2965
325 Ga0373937_0000572 3300036401 Bacteria 32657
326 Ga0373937_0061185 3300036401 Bacteria 3461
327 Ga0373937_0236335 3300036401 Unclassified 1721
328 Ga0373925_0153985 3300037068 Bacteria 1807
329 Ga0436365_0101418 3300039437 Bacteria 2275
330 Ga0439453_0019810 3300041408 Unclassified 1201
331 Ga0451853_3769764 3300041512 Bacteria 1314
332 Ga0439433_0027263 3300041999 Bacteria 1295
333 Ga0439450_000527 3300042008 Bacteria 5001
334 Ga0439456_069038 3300042013 Unclassified 782
335 Ga0450923_046305 3300042125 Bacteria 925
336 Ga0439446_0002231 3300042156 Bacteria 4627
337 Ga0439435_0025697 3300042436 Unclassified 1564
338 Ga0439435_0031149 3300042436 Unclassified 1449
339 Ga0451576_0046169 3300045051 Bacteria 4587
340 Ga0495603_0009486 3300046455 Bacteria 5881
341 Ga0495629_0093336 3300046459 Bacteria 2100
342 Ga0495639_0233471 3300046475 Bacteria 907
343 Ga0495628_0086134 3300046516 Bacteria 2437
344 Ga0495628_0199256 3300046516 Unclassified 1509
345 Ga0495645_0022481 3300046543 Bacteria 4563
346 Ga0495645_0041993 3300046543 Bacteria 3335
347 Ga0495599_0076098 3300046678 Bacteria 2096
348 Ga0495599_0152138 3300046678 Unclassified 1432
349 Ga0495658_0192681 3300046683 Bacteria 1268
350 Ga0495613_0130493 3300046689 Bacteria 1800
351 Ga0495674_0405368 3300047319 Unclassified 1100
352 Ga0495680_0401626 3300047322 Unclassified 946
353 Ga0495684_0132313 3300047471 Bacteria 1873
354 Ga0496100_0363909 3300048903 Bacteria 1095
355 Ga0496101_0158323 3300048904 Bacteria 1736
356 Ga0496102_0021475 3300048905 Bacteria 5709
357 Ga0496103_0103468 3300048906 Unclassified 1804
358 Ga0496108_0556952 3300048911 Bacteria 1000
359 Ga0496109_0068647 3300048912 Bacteria 3249
360 Ga0496110_0616133 3300048913 Unclassified 984
361 Ga0496112_0081391 3300048915 Bacteria 3202
362 Ga0496112_0120807 3300048915 Unclassified 2590
363 Ga0496113_0250881 3300048916 Bacteria 1413
364 Ga0496114_0063010 3300048917 Bacteria 3104
365 Ga0496114_0269652 3300048917 Bacteria 1500
366 Ga0501031_0082504 3300049568 Unclassified 2095
367 Ga0501031_0082708 3300049568 Bacteria 2092
368 Ga0501031_0256199 3300049568 Bacteria 1137
369 Ga0501032_0017228 3300049569 Bacteria 5074
370 Ga0501032_0028657 3300049569 Bacteria 3825
371 Ga0501033_0001097 3300049570 Bacteria 24534
372 Ga0501033_0011938 3300049570 Bacteria 6637
373 Ga0501033_0263816 3300049570 Unclassified 1218
374 Ga0501034_0011867 3300049571 Bacteria 9014
375 Ga0501034_0061268 3300049571 Bacteria 3778
376 Ga0501034_0092588 3300049571 Bacteria 3019
377 Ga0501036_0000980 3300049572 Bacteria 21548
378 Ga0501036_0002779 3300049572 Bacteria 13856
379 Ga0501036_0083199 3300049572 Bacteria 2705
380 Ga0501037_0000289 3300049573 Bacteria 42700
381 Ga0501037_0002523 3300049573 Bacteria 13223
382 Ga0501037_0019331 3300049573 Bacteria 5023
383 Ga0501038_0017653 3300049574 Bacteria 6449
384 Ga0501038_0032874 3300049574 Bacteria 4571
385 Ga0501038_0170792 3300049574 Bacteria 1760
386 Ga0501038_0377184 3300049574 Archaea 1101
387 Ga0501038_0389349 3300049574 Bacteria 1080
388 Ga0501039_0008966 3300049575 Bacteria 7622
389 Ga0501039_0036968 3300049575 Bacteria 3768
390 Ga0501040_0030866 3300049576 Bacteria 3621
391 Ga0501040_0061326 3300049576 Bacteria 2586
392 Ga0501040_0279095 3300049576 Unclassified 1193
393 Ga0501041_0072433 3300049577 Bacteria 2117
394 Ga0501042_0008109 3300049578 Bacteria 6915
395 Ga0501042_0051489 3300049578 Bacteria 2937
396 Ga0501042_0133361 3300049578 Unclassified 1790
397 Ga0501042_0134112 3300049578 Bacteria 1785
398 Ga0501042_0159191 3300049578 Bacteria 1629
399 Ga0501043_0030405 3300049579 Bacteria 4244
400 Ga0501043_0078632 3300049579 Bacteria 2591
401 Ga0501043_0324068 3300049579 Archaea 1174
402 Ga0501043_0463467 3300049579 Unclassified 950
403 Ga0501046_0004680 3300049580 Bacteria 12352
404 Ga0501046_0015030 3300049580 Bacteria 6510
405 Ga0501046_0036840 3300049580 Bacteria 3934
406 Ga0501046_0464972 3300049580 Archaea 909
407 Ga0501047_0016423 3300049581 Bacteria 7066
408 Ga0501047_0032298 3300049581 Bacteria 5052
409 Ga0501047_0059454 3300049581 Bacteria 3689
410 Ga0501047_0160072 3300049581 Bacteria 2123
411 Ga0501048_0002945 3300049582 Bacteria 13010
412 Ga0501048_0007643 3300049582 Bacteria 8193
413 Ga0501048_0011832 3300049582 Bacteria 6505
414 Ga0501048_0080446 3300049582 Unclassified 2299
415 Ga0501067_0003463 3300049583 Bacteria 8674
416 Ga0501067_0012221 3300049583 Bacteria 4758
417 Ga0501067_0045039 3300049583 Bacteria 2451
418 Ga0501067_0056572 3300049583 Bacteria 2173
419 Ga0501068_0130020 3300049584 Unclassified 1574
420 Ga0501069_0002749 3300049585 Bacteria 8985
421 Ga0501069_0052237 3300049585 Bacteria 2275
422 Ga0501069_0057490 3300049585 Bacteria 2169
423 Ga0501070_0005941 3300049586 Bacteria 10404
424 Ga0501070_0074826 3300049586 Bacteria 2803
425 Ga0501071_0007036 3300049587 Bacteria 7350
426 Ga0501071_0081833 3300049587 Bacteria 2363
427 Ga0501071_0179763 3300049587 Bacteria 1585
428 Ga0501071_0183826 3300049587 Bacteria 1567
429 Ga0501071_0326044 3300049587 Unclassified 1166
430 Ga0501072_0019207 3300049588 Bacteria 5280
431 Ga0501072_0144719 3300049588 Bacteria 1895
432 Ga0501072_0177700 3300049588 Bacteria 1698
433 Ga0501072_0358017 3300049588 Unclassified 1158
434 Ga0501073_0009294 3300049589 Bacteria 7251
435 Ga0501073_0019732 3300049589 Bacteria 4865
436 Ga0501073_0028370 3300049589 Bacteria 3999
437 Ga0501073_0278849 3300049589 Bacteria 1153
438 Ga0501074_0001627 3300049590 Bacteria 15234
439 Ga0501074_0068953 3300049590 Bacteria 2542
440 Ga0501074_0200409 3300049590 Unclassified 1422
441 Ga0501074_0269122 3300049590 Bacteria 1211
442 Ga0501074_0490128 3300049590 Bacteria 871
443 Ga0501075_0030210 3300049591 Bacteria 4013
444 Ga0501075_0071478 3300049591 Bacteria 2623
445 Ga0501075_0334239 3300049591 Unclassified 1154
446 Ga0501075_0410693 3300049591 Bacteria 1032
447 Ga0501076_0013866 3300049592 Bacteria 6052
448 Ga0501076_0030414 3300049592 Bacteria 4206
449 Ga0501076_0310140 3300049592 Archaea 1294
450 Ga0501077_0245314 3300049593 Unclassified 1139
451 Ga0501079_0002818 3300049741 Bacteria 12678
452 Ga0501079_0019970 3300049741 Bacteria 5119
453 Ga0501079_0059817 3300049741 Bacteria 2939
454 Ga0501079_0100196 3300049741 Bacteria 2246
455 Ga0501079_0105973 3300049741 Bacteria 2181
456 Ga0501080_0009699 3300049742 Bacteria 8791
457 Ga0501080_0030601 3300049742 Bacteria 5016
458 Ga0501080_0063347 3300049742 Bacteria 3441
459 Ga0501080_0687727 3300049742 Bacteria 903
460 Ga0501081_0014274 3300049743 Bacteria 5238
461 Ga0501081_0021352 3300049743 Bacteria 4320
462 Ga0501081_0187735 3300049743 Bacteria 1496
463 Ga0501081_0205471 3300049743 Bacteria 1429
464 Ga0501083_0018614 3300049744 Bacteria 4839
465 Ga0501083_0074344 3300049744 Bacteria 2258
466 Ga0501035_0001348 3300049822 Bacteria 25287
467 Ga0501035_0028656 3300049822 Bacteria 5082
468 Ga0501044_0042488 3300049823 Bacteria 4727
469 Ga0501044_0143359 3300049823 Unclassified 2376
470 Ga0501044_0182061 3300049823 Unclassified 2067
471 Ga0501045_0010008 3300049824 Bacteria 6632
472 Ga0501045_0012586 3300049824 Bacteria 5957
473 Ga0501045_0042070 3300049824 Bacteria 3326
474 Ga0501045_0134493 3300049824 Unclassified 1838
475 Ga0501045_0191294 3300049824 Bacteria 1525
476 nmdc:mga00v17_29165_c1 3300050491 Bacteria 3237
477 nmdc:mga00v17_57026_c1 3300050491 Unclassified 2389
478 nmdc:mga00v17_84406_c1 3300050491 Bacteria 1988
479 nmdc:mga0yw44_14015_c1 3300050492 Bacteria 4241
480 nmdc:mga0k408_36646_c1 3300050493 Bacteria 2815
481 nmdc:mga06z11_81743_c1 3300050494 Bacteria 1735
482 nmdc:mga07m45_12898_c1 3300050496 Bacteria 4422
483 nmdc:mga05p37_10480_c1 3300050507 Bacteria 10999
484 nmdc:mga05p37_123139_c1 3300050507 Bacteria 3185
485 nmdc:mga05p37_124152_c1 3300050507 Bacteria 3171
486 nmdc:mga05p37_167944_c1 3300050507 Bacteria 2677
487 nmdc:mga05p37_22077_c1 3300050507 Bacteria 7714
488 nmdc:mga05p37_41842_c1 3300050507 Bacteria 5627
489 nmdc:mga05p37_45046_c1 3300050507 Bacteria 5427
490 nmdc:mga05p37_485177_c1 3300050507 Unclassified 1422
491 nmdc:mga05p37_59692_c1 3300050507 Bacteria 4697
492 nmdc:mga05p37_75255_c1 3300050507 Bacteria 4156
493 nmdc:mga05p37_84507_c1 3300050507 Bacteria 3910
494 nmdc:mga05p37_91_c1 3300050507 Bacteria 80826
495 nmdc:mga09592_10595_c1 3300050508 Bacteria 7505
496 nmdc:mga09592_206063_c1 3300050508 Unclassified 1703
497 nmdc:mga09592_3165_c1 3300050508 Bacteria 13371
498 nmdc:mga09592_5762_c2 3300050508 Bacteria 2276
499 nmdc:mga09592_60416_c1 3300050508 Bacteria 3204
500 nmdc:mga09592_837409_c1 3300050508 Unclassified 776
501 nmdc:mga0qj67_14161_c1 3300050509 Bacteria 6025
502 nmdc:mga0qj67_152027_c1 3300050509 Bacteria 1878
503 nmdc:mga0qj67_17016_c1 3300050509 Bacteria 5523
504 nmdc:mga0qj67_45426_c1 3300050509 Bacteria 3466
505 nmdc:mga0qj67_519_c1 3300050509 Bacteria 26189
506 nmdc:mga06r32_118104_c1 3300050510 Bacteria 2614
507 nmdc:mga06r32_13481_c1 3300050510 Bacteria 7407
508 nmdc:mga06r32_20877_c1 3300050510 Bacteria 6037
509 nmdc:mga06r32_45315_c1 3300050510 Bacteria 4192
510 nmdc:mga06r32_5175_c1 3300050510 Bacteria 11719
511 nmdc:mga06r32_679032_c1 3300050510 Unclassified 997
512 nmdc:mga08y16_113381_c1 3300050511 Bacteria 2822
513 nmdc:mga08y16_13397_c1 3300050511 Bacteria 8624
514 nmdc:mga08y16_1590_c1 3300050511 Bacteria 22933
515 nmdc:mga08y16_215533_c1 3300050511 Bacteria 1988
516 nmdc:mga08y16_219794_c1 3300050511 Bacteria 1967
517 nmdc:mga08y16_2407_c1 3300050511 Bacteria 19212
518 nmdc:mga08y16_261473_c1 3300050511 Bacteria 1787
519 nmdc:mga08y16_3764_c1 3300050511 Bacteria 15790
520 nmdc:mga08y16_391243_c1 3300050511 Bacteria 1424
521 nmdc:mga08y16_59535_c1 3300050511 Bacteria 3989
522 nmdc:mga0n895_11276_c1 3300050512 Bacteria 7965
523 nmdc:mga0n895_228892_c1 3300050512 Bacteria 1887
524 nmdc:mga0n895_28037_c1 3300050512 Bacteria 5354
525 nmdc:mga0rr50_117394_c1 3300050513 Bacteria 2113
526 nmdc:mga0rr50_8988_c1 3300050513 Bacteria 6251
527 nmdc:mga08x19_8481_c1 3300050514 Bacteria 6121
528 nmdc:mga0a205_113341_c1 3300050515 Bacteria 2611
529 nmdc:mga0a205_33076_c1 3300050515 Bacteria 4959
530 nmdc:mga0a205_43117_c1 3300050515 Bacteria 4350
531 nmdc:mga0sz30_68141_c1 3300050516 Unclassified 1528
532 Ga0495601_0513542 3300053077 Bacteria 772
533 Ga0495619_0113737 3300053085 Bacteria 1851
534 Ga0495619_0282177 3300053085 Bacteria 1151
535 Ga0500555_000364 3300053103 Bacteria 19172
536 Ga0500592_009523 3300053116 Unclassified 1545
537 Ga0500616_0000056 3300053153 Bacteria 281579
538 Ga0500645_000010 3300053730 Bacteria 186517
539 Ga0501084_0082333 3300054114 Bacteria 2700
540 Ga0501084_0289603 3300054114 Bacteria 1383
541 Ga0501084_0725976 3300054114 Unclassified 837
542 Ga0590071_000111 3300059421 Bacteria 23043
543 Ga0590074_001594 3300059423 Bacteria 3678
544 Ga0590075_001284 3300059424 Bacteria 6301
545 Ga0590077_000874 3300059426 Bacteria 7720
546 Ga0501082_0013181 3300060353 Bacteria 7107
547 Ga0501082_0013682 3300060353 Bacteria 6974
548 Ga0501082_0109909 3300060353 Bacteria 2386
549 Ga0501082_0110616 3300060353 Bacteria 2378
550 Ga0501082_0171374 3300060353 Bacteria 1887
551 Ga0501082_0298016 3300060353 Bacteria 1404
552 Ga0070689_100099117
553 Ga0065712_10091465
554 Ga0065715_10023984
555 Ga0065715_10178043
556 Ga0065707_10010978
557 Ga0065707_10108653
558 Ga0070676_10501772
559 Ga0070670_100175899
560 Ga0070670_100193631
561 Ga0070670_100721641
562 Ga0068869_100076971
563 Ga0068869_100592289
564 Ga0068868_100048563
565 Ga0068868_100106354
566 Ga0068868_100186659
567 Ga0070689_100360023
568 Ga0070687_100244372
569 Ga0070668_100478219
570 Ga0070675_100063991
571 Ga0070675_100124805
572 Ga0070675_100207663
573 Ga0070671_100030267
574 Ga0070671_100089619
575 Ga0070674_100015293
576 Ga0070673_100002948
577 Ga0070673_100029864
578 Ga0070673_100036762
579 Ga0070673_100467019
580 Ga0070673_100577652
581 Ga0070673_100769876
582 Ga0070688_100042467
583 Ga0070659_100128990
584 Ga0070667_100386493
585 Ga0070701_10128621
586 Ga0070700_100175937
587 Ga0070700_100315347
588 Ga0070694_100303812
589 Ga0070708_100057106
590 Ga0070708_100151539
591 Ga0070708_100297136
592 Ga0070708_100723721
593 Ga0070708_100733705
594 Ga0070663_100324344
595 Ga0070678_100180758
596 Ga0070681_10096232
597 Ga0070681_10102235
598 Ga0068867_100011803
599 Ga0070706_100017523
600 Ga0070706_100036485
601 Ga0070707_100027472
602 Ga0070707_100076354
603 Ga0070707_100217701
604 Ga0070698_100264034
605 Ga0070699_100454183
606 Ga0070679_100533961
607 Ga0070684_100049574
608 Ga0070684_100250155
609 Ga0070697_100013459
610 Ga0070697_100038312
611 Ga0070672_100006792
612 Ga0070695_100172325
613 Ga0070695_100223701
614 Ga0070696_100096346
615 Ga0070693_100037528
616 Ga0070665_100000771
617 Ga0070665_100949949
618 Ga0070664_100312201
619 Ga0070664_100343122
620 Ga0068854_100144214
621 Ga0070702_100301239
622 Ga0068852_100131893
623 Ga0068859_100106375
624 Ga0068859_100225888
625 Ga0068859_100489149
626 Ga0068859_100588057
627 Ga0068859_100653755
628 Ga0068864_100176317
629 Ga0068861_100272991
630 Ga0068861_100423147
631 Ga0068858_100006390
632 Ga0068858_100015750
633 Ga0068858_100024839
634 Ga0068858_100180399
635 Ga0068858_100424258
636 Ga0068860_100153417
637 Ga0068860_100194664
638 Ga0068862_100220288
639 Ga0075363_100022651
640 Ga0075364_10051969
641 Ga0075364_10052568
642 Ga0075362_10032870
643 Ga0075367_10037028
644 Ga0075367_10065315
645 Ga0075366_10043502
646 Ga0097621_100035324
647 Ga0068871_100002596
648 Ga0075428_100000439
649 Ga0075428_100003506
650 Ga0075428_100004439
651 Ga0075428_100008917
652 Ga0075428_100158900
653 Ga0075428_100295486
654 Ga0075428_100699655
655 Ga0075430_100000107
656 Ga0075430_100002924
657 Ga0075430_100003427
658 Ga0075430_100013952
659 Ga0075430_100113455
660 Ga0075431_100006311
661 Ga0075431_100014360
662 Ga0075431_100016083
663 Ga0075431_100020666
664 Ga0075431_100154064
665 Ga0075431_100318238
666 Ga0075433_10005420
667 Ga0075433_10030536
668 Ga0075433_10616353
669 Ga0075434_100280218
670 Ga0075429_100004861
671 Ga0075429_100025249
672 Ga0075429_100044617
673 Ga0075429_100058785
674 Ga0075429_100116635
675 Ga0068865_100000963
676 Ga0068865_100033568
677 Ga0075436_100051013
678 Ga0075436_100275392
679 Ga0097620_100106376
680 Ga0097620_100225878
681 Ga0097620_100489176
682 Ga0097620_100588080
683 Ga0097620_100653751
684 Ga0075435_100009027
685 Ga0075435_100017520
686 Ga0075435_100134146
687 Ga0075435_100333087
688 Ga0075435_100400178
689 Ga0105240_10268189
690 Ga0105240_10313112
691 Ga0111539_10000671
692 Ga0111539_10000799
693 Ga0111539_10004675
694 Ga0111539_10009963
695 Ga0111539_10061659
696 Ga0111539_10094410
697 Ga0111539_10129205
698 Ga0111539_10164845
699 Ga0111539_10295945
700 Ga0111539_10313266
701 Ga0111539_10324711
702 Ga0111539_10440686
703 Ga0111539_10648245
704 Ga0111539_10749938
705 Ga0105245_10009561
706 Ga0105247_10007659
707 Ga0114129_10000043
708 Ga0114129_10000076
709 Ga0114129_10013579
710 Ga0114129_10014685
711 Ga0114129_10024852
712 Ga0114129_10042636
713 Ga0114129_10064676
714 Ga0114129_10108541
715 Ga0114129_10143663
716 Ga0114129_10339531
717 Ga0114129_10536796
718 Ga0114129_10609385
719 Ga0105243_10819134
720 Ga0105242_10016481
721 Ga0105242_10018610
722 Ga0105242_10028318
723 Ga0105242_10180003
724 Ga0105242_10377545
725 Ga0105248_10034185
726 Ga0105248_10115424
727 Ga0105248_10128710
728 Ga0105248_10260779
729 Ga0105248_10543714
730 Ga0105248_10884212
731 Ga0105249_10043272
732 Ga0105249_10066222
733 Ga0105249_10261383
734 Ga0157378_10606273
735 Ga0157378_10748374
736 Ga0163162_10027533
737 Ga0163162_10092220
738 Ga0157375_10627304
739 Ga0157375_10761936
740 Ga0163163_10004308
741 Ga0163163_10160481
742 Ga0163163_10313705
743 Ga0163163_10396780
744 Ga0157380_10159976
745 Ga0157380_10196747
746 Ga0157380_10268946
747 Ga0157379_10025540
748 Ga0157379_10053636
749 Ga0157376_10026929
750 Ga0157376_10132450
751 Ga0207697_10019008
752 Ga0207697_10022936
753 Ga0207656_10266793
754 Ga0207642_10008916
755 Ga0207642_10023530
756 Ga0207710_10019568
757 Ga0207710_10028360
758 Ga0207688_10016272
759 Ga0207645_10018929
760 Ga0207645_10021888
761 Ga0207684_10012804
762 Ga0207684_10051361
763 Ga0207707_10088855
764 Ga0207695_10222891
765 Ga0207662_10045170
766 Ga0207646_10010625
767 Ga0207646_10024651
768 Ga0207646_10504211
769 Ga0207681_10063131
770 Ga0207650_10063737
771 Ga0207650_10190958
772 Ga0207659_10142342
773 Ga0207659_10252107
774 Ga0207659_10273598
775 Ga0207659_10299227
776 Ga0207687_10004276
777 Ga0207644_10062554
778 Ga0207690_10576564
779 Ga0207706_10200919
780 Ga0207686_10011935
781 Ga0207686_10141924
782 Ga0207686_10323941
783 Ga0207670_10016703
784 Ga0207669_10377313
785 Ga0207704_10021671
786 Ga0207704_10036889
787 Ga0207704_10093321
788 Ga0207665_10255861
789 Ga0207691_10004842
790 Ga0207691_10244632
791 Ga0207691_10304590
792 Ga0207691_10649492
793 Ga0207711_10045674
794 Ga0207711_10095148
795 Ga0207711_10110539
796 Ga0207711_10225318
797 Ga0207711_10618955
798 Ga0207689_10144771
799 Ga0207689_10198856
800 Ga0207689_10701793
801 Ga0207661_10109623
802 Ga0207651_10005769
803 Ga0207651_10010656
804 Ga0207712_10061549
805 Ga0207712_10085074
806 Ga0207668_10036047
807 Ga0207668_10405511
808 Ga0207640_10349948
809 Ga0207658_10231233
810 Ga0207677_10113080
811 Ga0207677_10125064
812 Ga0207677_10168567
813 Ga0207703_10025486
814 Ga0207703_10080783
815 Ga0207703_10086970
816 Ga0207703_10152764
817 Ga0207703_10523680
818 Ga0207708_10036102
819 Ga0207708_10078294
820 Ga0207708_10106723
821 Ga0207708_10228982
822 Ga0207648_10006957
823 Ga0207676_10124008
824 Ga0207676_10156576
825 Ga0207675_100049778
826 Ga0207683_10037730
827 Ga0207683_10156436
828 Ga0207698_10225577
829 Ga0207428_10000797
830 Ga0207428_10002504
831 Ga0207428_10007851
832 Ga0207428_10010433
833 Ga0207428_10036939
834 Ga0207428_10043824
835 Ga0207428_10104429
836 Ga0268266_10003281
837 Ga0268265_10096692
838 Ga0268265_10176725
839 Ga0268264_10166015
840 Ga0268264_10366924
841 Ga0268264_10486676
842 Ga0265316_10158853
843 Ga0307408_100018447
844 Ga0307408_100036988
845 Ga0307408_100118972
846 Ga0307408_100360145
847 Ga0265314_10113918
848 Ga0307405_10028602
849 Ga0307405_10234813
850 Ga0307413_10085642
851 Ga0307410_10038036
852 Ga0307407_10327171
853 Ga0307412_10059489
854 Ga0307412_10105221
855 Ga0307412_10181135
856 Ga0307412_10302691
857 Ga0307409_100080657
858 Ga0307409_100155294
859 Ga0307409_100184588
860 Ga0307416_100016613
861 Ga0307416_100035477
862 Ga0307416_100141053
863 Ga0307416_100447929
864 Ga0307416_100705663
865 Ga0307416_100823395
866 Ga0307411_10561584
867 Ga0307415_100010449
868 Ga0307415_100031730
869 Ga0373934_0026868
870 Ga0373941_0002267
871 Ga0373941_0170433
872 Ga0373956_0006264
873 Ga0373957_0009280
874 Ga0373955_0006237
875 Ga0373933_0034078
876 Ga0373937_0000572
877 Ga0373937_0061185
878 Ga0373937_0236335
879 Ga0373925_0153985
880 Ga0436365_0101418
881 Ga0439453_0019810
882 Ga0451853_3769764
883 Ga0439433_0027263
884 Ga0439450_000527
885 Ga0439456_069038
886 Ga0450923_046305
887 Ga0439446_0002231
888 Ga0439435_0025697
889 Ga0439435_0031149
890 Ga0451576_0046169
891 Ga0495603_0009486
892 Ga0495629_0093336
893 Ga0495639_0233471
894 Ga0495628_0086134
895 Ga0495628_0199256
896 Ga0495645_0022481
897 Ga0495645_0041993
898 Ga0495599_0076098
899 Ga0495599_0152138
900 Ga0495658_0192681
901 Ga0495613_0130493
902 Ga0495674_0405368
903 Ga0495680_0401626
904 Ga0495684_0132313
905 Ga0496100_0363909
906 Ga0496101_0158323
907 Ga0496102_0021475
908 Ga0496103_0103468
909 Ga0496108_0556952
910 Ga0496109_0068647
911 Ga0496110_0616133
912 Ga0496112_0081391
913 Ga0496112_0120807
914 Ga0496113_0250881
915 Ga0496114_0063010
916 Ga0496114_0269652
917 Ga0501031_0082504
918 Ga0501031_0082708
919 Ga0501031_0256199
920 Ga0501032_0017228
921 Ga0501032_0028657
922 Ga0501033_0001097
923 Ga0501033_0011938
924 Ga0501033_0263816
925 Ga0501034_0011867
926 Ga0501034_0061268
927 Ga0501034_0092588
928 Ga0501036_0000980
929 Ga0501036_0002779
930 Ga0501036_0083199
931 Ga0501037_0000289
932 Ga0501037_0002523
933 Ga0501037_0019331
934 Ga0501038_0017653
935 Ga0501038_0032874
936 Ga0501038_0170792
937 Ga0501038_0377184
938 Ga0501038_0389349
939 Ga0501039_0008966
940 Ga0501039_0036968
941 Ga0501040_0030866
942 Ga0501040_0061326
943 Ga0501040_0279095
944 Ga0501041_0072433
945 Ga0501042_0008109
946 Ga0501042_0051489
947 Ga0501042_0133361
948 Ga0501042_0134112
949 Ga0501042_0159191
950 Ga0501043_0030405
951 Ga0501043_0078632
952 Ga0501043_0324068
953 Ga0501043_0463467
954 Ga0501046_0004680
955 Ga0501046_0015030
956 Ga0501046_0036840
957 Ga0501046_0464972
958 Ga0501047_0016423
959 Ga0501047_0032298
960 Ga0501047_0059454
961 Ga0501047_0160072
962 Ga0501048_0002945
963 Ga0501048_0007643
964 Ga0501048_0011832
965 Ga0501048_0080446
966 Ga0501067_0003463
967 Ga0501067_0012221
968 Ga0501067_0045039
969 Ga0501067_0056572
970 Ga0501068_0130020
971 Ga0501069_0002749
972 Ga0501069_0052237
973 Ga0501069_0057490
974 Ga0501070_0005941
975 Ga0501070_0074826
976 Ga0501071_0007036
977 Ga0501071_0081833
978 Ga0501071_0179763
979 Ga0501071_0183826
980 Ga0501071_0326044
981 Ga0501072_0019207
982 Ga0501072_0144719
983 Ga0501072_0177700
984 Ga0501072_0358017
985 Ga0501073_0009294
986 Ga0501073_0019732
987 Ga0501073_0028370
988 Ga0501073_0278849
989 Ga0501074_0001627
990 Ga0501074_0068953
991 Ga0501074_0200409
992 Ga0501074_0269122
993 Ga0501074_0490128
994 Ga0501075_0030210
995 Ga0501075_0071478
996 Ga0501075_0334239
997 Ga0501075_0410693
998 Ga0501076_0013866
999 Ga0501076_0030414
1000 Ga0501076_0310140
1001 Ga0501077_0245314
1002 Ga0501079_0002818
1003 Ga0501079_0019970
1004 Ga0501079_0059817
1005 Ga0501079_0100196
1006 Ga0501079_0105973
1007 Ga0501080_0009699
1008 Ga0501080_0030601
1009 Ga0501080_0063347
1010 Ga0501080_0687727
1011 Ga0501081_0014274
1012 Ga0501081_0021352
1013 Ga0501081_0187735
1014 Ga0501081_0205471
1015 Ga0501083_0018614
1016 Ga0501083_0074344
1017 Ga0501035_0001348
1018 Ga0501035_0028656
1019 Ga0501044_0042488
1020 Ga0501044_0143359
1021 Ga0501044_0182061
1022 Ga0501045_0010008
1023 Ga0501045_0012586
1024 Ga0501045_0042070
1025 Ga0501045_0134493
1026 Ga0501045_0191294
1027 nmdc:mga00v17_29165_c1
1028 nmdc:mga00v17_57026_c1
1029 nmdc:mga00v17_84406_c1
1030 nmdc:mga0yw44_14015_c1
1031 nmdc:mga0k408_36646_c1
1032 nmdc:mga06z11_81743_c1
1033 nmdc:mga07m45_12898_c1
1034 nmdc:mga05p37_10480_c1
1035 nmdc:mga05p37_123139_c1
1036 nmdc:mga05p37_124152_c1
1037 nmdc:mga05p37_167944_c1
1038 nmdc:mga05p37_22077_c1
1039 nmdc:mga05p37_41842_c1
1040 nmdc:mga05p37_45046_c1
1041 nmdc:mga05p37_485177_c1
1042 nmdc:mga05p37_59692_c1
1043 nmdc:mga05p37_75255_c1
1044 nmdc:mga05p37_84507_c1
1045 nmdc:mga05p37_91_c1
1046 nmdc:mga09592_10595_c1
1047 nmdc:mga09592_206063_c1
1048 nmdc:mga09592_3165_c1
1049 nmdc:mga09592_5762_c2
1050 nmdc:mga09592_60416_c1
1051 nmdc:mga09592_837409_c1
1052 nmdc:mga0qj67_14161_c1
1053 nmdc:mga0qj67_152027_c1
1054 nmdc:mga0qj67_17016_c1
1055 nmdc:mga0qj67_45426_c1
1056 nmdc:mga0qj67_519_c1
1057 nmdc:mga06r32_118104_c1
1058 nmdc:mga06r32_13481_c1
1059 nmdc:mga06r32_20877_c1
1060 nmdc:mga06r32_45315_c1
1061 nmdc:mga06r32_5175_c1
1062 nmdc:mga06r32_679032_c1
1063 nmdc:mga08y16_113381_c1
1064 nmdc:mga08y16_13397_c1
1065 nmdc:mga08y16_1590_c1
1066 nmdc:mga08y16_215533_c1
1067 nmdc:mga08y16_219794_c1
1068 nmdc:mga08y16_2407_c1
1069 nmdc:mga08y16_261473_c1
1070 nmdc:mga08y16_3764_c1
1071 nmdc:mga08y16_391243_c1
1072 nmdc:mga08y16_59535_c1
1073 nmdc:mga0n895_11276_c1
1074 nmdc:mga0n895_228892_c1
1075 nmdc:mga0n895_28037_c1
1076 nmdc:mga0rr50_117394_c1
1077 nmdc:mga0rr50_8988_c1
1078 nmdc:mga08x19_8481_c1
1079 nmdc:mga0a205_113341_c1
1080 nmdc:mga0a205_33076_c1
1081 nmdc:mga0a205_43117_c1
1082 nmdc:mga0sz30_68141_c1
1083 Ga0495601_0513542
1084 Ga0495619_0113737
1085 Ga0495619_0282177
1086 Ga0500555_000364
1087 Ga0500592_009523
1088 Ga0500616_0000056
1089 Ga0500645_000010
1090 Ga0501084_0082333
1091 Ga0501084_0289603
1092 Ga0501084_0725976
1093 Ga0590071_000111
1094 Ga0590074_001594
1095 Ga0590075_001284
1096 Ga0590077_000874
1097 Ga0501082_0013181
1098 Ga0501082_0013682
1099 Ga0501082_0109909
1100 Ga0501082_0110616
1101 Ga0501082_0171374
1102 Ga0501082_0298016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01887

SAM_HAT_N

SAM hydroxide adenosyltransferase N-terminal domain

24

169

0.97

PF20257

SAM_HAT_C

SAM hydroxide adenosyltransferase C-terminal domain

192

278

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9375 6 263
2zbv-assembly1.cif.gz_C crystal structure of uncharacterized conserved protein from thermotoga maritima 0.929 6 261
6ryz-assembly1.cif.gz_A sall with s-adenosyl methionine 0.9189 3 262
2q6o-assembly1.cif.gz_A sall-y70t with sam and cl 0.9189 5 262
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9172 6 263
ID Description Score Start End Superfamily
2q6oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9672 5 160 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9649 7 160 3.40.50.10790
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9556 5 161 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9527 7 160 3.40.50.10790
2q6oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9322 5 160 3.40.50.10790
ID Description Score Start End GO Terms
AF-A0A3M1SHE6-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9779 3 119
AF-A0A2V8FP58-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9772 7 118
AF-A0A7J2LKT3-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9761 2 144
AF-A0A7C4JQ49-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9759 6 101
AF-A0A2E4W278-F1-model_v4 SAM-dependent chlorinase/fluorinase 0.9756 1 264

Map