F462567

General Info

Members Datasets Scaffolds Average Seq Length
551 249 1102 225

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100347327|Ga0070683_1003473273
Length 251
Sequence MPTATKTPLDEGAGRRQRLRVLDAATVGAVESVIPSVAPPASLPGPNDAESLEWLRCLRAEGTRDEAIARLHALLLRAARFEVARRGATFPHLRGNELDDIANEAADDALMSVLRRLDDFRGASRFTTWVYKFALLEAAAKVRKRAWQGREVPLEPESWRLFSSTGLEPDAEAEQHELLATLQSAIADVLTPHQRSVLVALALNGVPIDVLAERLDTNRGALYKTLHDARRKLRKHLEERGLALDDRLEDR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
148 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
149 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
150 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
151 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
152 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 8.53
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 9.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100347327 3300005329 Unclassified 1413
2 JGI25407J50210_10000051 3300003373 Bacteria 13670
3 Ga0070658_10017637 3300005327 Bacteria 5710
4 Ga0070658_10067133 3300005327 Unclassified 2930
5 Ga0070658_10090158 3300005327 Bacteria 2526
6 Ga0070658_10096535 3300005327 Bacteria 2440
7 Ga0070683_100003946 3300005329 Bacteria 12140
8 Ga0070683_100075110 3300005329 Unclassified 3158
9 Ga0070683_100113353 3300005329 Bacteria 2559
10 Ga0070683_100171133 3300005329 Bacteria 2062
11 Ga0070683_100448775 3300005329 Bacteria 1231
12 Ga0070670_100035246 3300005331 Bacteria 4309
13 Ga0070680_100029316 3300005336 Bacteria 4420
14 Ga0070682_100028671 3300005337 Bacteria 3349
15 Ga0070682_100130489 3300005337 Unclassified 1700
16 Ga0070682_100591201 3300005337 Bacteria 875
17 Ga0070660_100022411 3300005339 Bacteria 4670
18 Ga0070660_100029567 3300005339 Bacteria 4107
19 Ga0070660_100058860 3300005339 Bacteria 2979
20 Ga0070660_100118028 3300005339 Bacteria 2116
21 Ga0070689_100216867 3300005340 Bacteria 1568
22 Ga0070691_10179962 3300005341 Bacteria 1100
23 Ga0070661_100000031 3300005344 Bacteria 113816
24 Ga0070661_100039491 3300005344 Bacteria 3439
25 Ga0070661_100040824 3300005344 Bacteria 3386
26 Ga0070661_100066266 3300005344 Unclassified 2653
27 Ga0070661_100178060 3300005344 Bacteria 1617
28 Ga0070675_100075867 3300005354 Bacteria 2795
29 Ga0070671_100026115 3300005355 Bacteria 4798
30 Ga0070671_100046342 3300005355 Bacteria 3615
31 Ga0070674_100010639 3300005356 Bacteria 5572
32 Ga0070674_100068963 3300005356 Bacteria 2493
33 Ga0070674_100794211 3300005356 Bacteria 817
34 Ga0070688_100000064 3300005365 Bacteria 52662
35 Ga0070659_100003810 3300005366 Bacteria 10756
36 Ga0070659_100237295 3300005366 Bacteria 1508
37 Ga0070709_10347421 3300005434 Bacteria 1095
38 Ga0070714_100243665 3300005435 Bacteria 1660
39 Ga0070714_100615219 3300005435 Unclassified 1044
40 Ga0070713_100062930 3300005436 Unclassified 3108
41 Ga0070713_100113264 3300005436 Bacteria 2368
42 Ga0070711_100017562 3300005439 Unclassified 4558
43 Ga0070708_100009239 3300005445 Bacteria 7949
44 Ga0070708_100265595 3300005445 Bacteria 1614
45 Ga0070663_100257211 3300005455 Bacteria 1384
46 Ga0070678_100037180 3300005456 Bacteria 3416
47 Ga0070681_10000245 3300005458 Bacteria 43091
48 Ga0070681_10030560 3300005458 Bacteria 5404
49 Ga0070681_10043297 3300005458 Bacteria 4510
50 Ga0070681_10057461 3300005458 Bacteria 3871
51 Ga0070681_10087399 3300005458 Bacteria 3070
52 Ga0070681_10754778 3300005458 Unclassified 889
53 Ga0070685_10000154 3300005466 Bacteria 45505
54 Ga0070685_10571558 3300005466 Bacteria 810
55 Ga0070707_100097602 3300005468 Unclassified 2846
56 Ga0070698_100085435 3300005471 Bacteria 3142
57 Ga0070698_100216547 3300005471 Bacteria 1849
58 Ga0070699_100093297 3300005518 Bacteria 2634
59 Ga0070679_100024083 3300005530 Bacteria 5963
60 Ga0070679_100065482 3300005530 Bacteria 3622
61 Ga0070679_100075853 3300005530 Unclassified 3352
62 Ga0070679_100112578 3300005530 Bacteria 2707
63 Ga0070679_100368894 3300005530 Bacteria 1383
64 Ga0070684_100004187 3300005535 Bacteria 10926
65 Ga0070684_100037347 3300005535 Bacteria 4166
66 Ga0070684_100039570 3300005535 Bacteria 4056
67 Ga0070684_100041130 3300005535 Bacteria 3983
68 Ga0070684_100169365 3300005535 Bacteria 1984
69 Ga0070684_100332895 3300005535 Bacteria 1395
70 Ga0068853_100546600 3300005539 Bacteria 1097
71 Ga0070672_100370834 3300005543 Bacteria 1223
72 Ga0070696_100045234 3300005546 Bacteria 3050
73 Ga0070665_100077581 3300005548 Bacteria 3328
74 Ga0070704_100945555 3300005549 Unclassified 777
75 Ga0068855_100070685 3300005563 Bacteria 4060
76 Ga0068855_100080812 3300005563 Bacteria 3769
77 Ga0068855_100224272 3300005563 Bacteria 2106
78 Ga0068855_100229458 3300005563 Bacteria 2080
79 Ga0070664_100062485 3300005564 Bacteria 3175
80 Ga0070664_100414493 3300005564 Bacteria 1233
81 Ga0068857_100001170 3300005577 Bacteria 20459
82 Ga0068857_100005040 3300005577 Bacteria 11220
83 Ga0068857_100025316 3300005577 Bacteria 5225
84 Ga0068854_100000107 3300005578 Bacteria 57836
85 Ga0068856_100028336 3300005614 Bacteria 5469
86 Ga0068856_100071819 3300005614 Unclassified 3426
87 Ga0068856_101267454 3300005614 Bacteria 753
88 Ga0068852_100000131 3300005616 Bacteria 50602
89 Ga0068852_100011665 3300005616 Bacteria 6628
90 Ga0068851_10000303 3300005834 Bacteria 22404
91 Ga0068851_10116686 3300005834 Bacteria 1431
92 Ga0068862_100008815 3300005844 Bacteria 8351
93 Ga0081455_10003318 3300005937 Bacteria 18593
94 Ga0081455_10015882 3300005937 Bacteria 7289
95 Ga0081455_10035719 3300005937 Bacteria 4437
96 Ga0081455_10038797 3300005937 Bacteria 4216
97 Ga0081455_10220790 3300005937 Bacteria 1405
98 Ga0081538_10000505 3300005981 Bacteria 43641
99 Ga0081538_10003497 3300005981 Bacteria 14811
100 Ga0081538_10005924 3300005981 Bacteria 10889
101 Ga0081538_10039742 3300005981 Bacteria 3011
102 Ga0081538_10062030 3300005981 Unclassified 2135
103 Ga0081539_10017265 3300005985 Bacteria 5078
104 Ga0070717_10272978 3300006028 Bacteria 1498
105 Ga0075365_10196528 3300006038 Unclassified 1412
106 Ga0075368_10036139 3300006042 Bacteria 1929
107 Ga0075363_100138098 3300006048 Unclassified 1371
108 Ga0075364_10139539 3300006051 Bacteria 1630
109 Ga0075364_10300770 3300006051 Unclassified 1092
110 Ga0070715_10267153 3300006163 Bacteria 901
111 Ga0070716_100095215 3300006173 Bacteria 1812
112 Ga0070712_100004685 3300006175 Bacteria 8454
113 Ga0070712_100227512 3300006175 Unclassified 1479
114 Ga0070712_100474612 3300006175 Bacteria 1045
115 Ga0075362_10010193 3300006177 Bacteria 3662
116 Ga0075428_100842508 3300006844 Bacteria 974
117 Ga0075430_100009893 3300006846 Bacteria 8065
118 Ga0075430_100380047 3300006846 Bacteria 1165
119 Ga0075431_100004744 3300006847 Bacteria 13368
120 Ga0075431_100028131 3300006847 Bacteria 5772
121 Ga0075433_10014517 3300006852 Bacteria 6439
122 Ga0075434_100001863 3300006871 Bacteria 18229
123 Ga0075434_100103671 3300006871 Bacteria 2853
124 Ga0075434_101017479 3300006871 Unclassified 842
125 Ga0075429_100014330 3300006880 Bacteria 6876
126 Ga0075429_100077652 3300006880 Bacteria 2893
127 Ga0068865_100000033 3300006881 Bacteria 84342
128 Ga0068865_100296784 3300006881 Bacteria 1292
129 Ga0075436_100160827 3300006914 Bacteria 1583
130 Ga0075435_100202487 3300007076 Bacteria 1682
131 Ga0105240_10105580 3300009093 Bacteria 3419
132 Ga0105240_10169655 3300009093 Bacteria 2585
133 Ga0105240_10185100 3300009093 Bacteria 2454
134 Ga0105240_10270077 3300009093 Bacteria 1958
135 Ga0111539_10021844 3300009094 Bacteria 7869
136 Ga0111539_10048000 3300009094 Bacteria 5099
137 Ga0111539_10058946 3300009094 Bacteria 4554
138 Ga0111539_10134678 3300009094 Bacteria 2893
139 Ga0111539_10268152 3300009094 Unclassified 1987
140 Ga0105245_10005216 3300009098 Bacteria 11414
141 Ga0105245_10029442 3300009098 Bacteria 4851
142 Ga0114129_10257255 3300009147 Unclassified 2341
143 Ga0114129_10527943 3300009147 Bacteria 1538
144 Ga0114129_10734653 3300009147 Bacteria 1265
145 Ga0114129_10806765 3300009147 Bacteria 1197
146 Ga0114129_10983327 3300009147 Bacteria 1064
147 Ga0105243_10260432 3300009148 Bacteria 1552
148 Ga0105243_10264934 3300009148 Bacteria 1540
149 Ga0105241_10412102 3300009174 Unclassified 1187
150 Ga0105242_10088824 3300009176 Bacteria 2597
151 Ga0105248_10000466 3300009177 Bacteria 46063
152 Ga0105237_10012844 3300009545 Bacteria 8805
153 Ga0105237_10029726 3300009545 Bacteria 5552
154 Ga0105238_10005537 3300009551 Bacteria 12469
155 Ga0105238_10410146 3300009551 Bacteria 1348
156 Ga0105249_10009419 3300009553 Bacteria 8547
157 Ga0105239_10069838 3300010375 Bacteria 3858
158 Ga0105239_10071496 3300010375 Unclassified 3812
159 Ga0105239_10239289 3300010375 Bacteria 2037
160 Ga0105239_10514392 3300010375 Unclassified 1362
161 Ga0157371_10002867 3300013102 Bacteria 16120
162 Ga0157371_10111292 3300013102 Bacteria 1944
163 Ga0157371_10436938 3300013102 Bacteria 961
164 Ga0157371_10439342 3300013102 Bacteria 958
165 Ga0157370_10004109 3300013104 Bacteria 16871
166 Ga0157370_10006231 3300013104 Bacteria 13214
167 Ga0157370_10158090 3300013104 Unclassified 2109
168 Ga0157369_10018403 3300013105 Bacteria 7834
169 Ga0157369_10055758 3300013105 Bacteria 4266
170 Ga0157369_10076037 3300013105 Unclassified 3600
171 Ga0157369_10159283 3300013105 Bacteria 2383
172 Ga0157369_10220188 3300013105 Bacteria 1987
173 Ga0157369_10290205 3300013105 Bacteria 1703
174 Ga0157374_10020848 3300013296 Bacteria 5822
175 Ga0157378_10267870 3300013297 Bacteria 1642
176 Ga0157372_10000121 3300013307 Bacteria 83548
177 Ga0157372_10007905 3300013307 Bacteria 11303
178 Ga0157372_10032357 3300013307 Bacteria 5734
179 Ga0157372_10354980 3300013307 Bacteria 1708
180 Ga0157375_10435756 3300013308 Bacteria 1477
181 Ga0163163_10986101 3300014325 Unclassified 906
182 Ga0157380_10045621 3300014326 Bacteria 3440
183 Ga0157377_10023752 3300014745 Bacteria 3253
184 Ga0157377_10105526 3300014745 Bacteria 1686
185 Ga0157379_10077369 3300014968 Bacteria 2979
186 Ga0157376_10017277 3300014969 Bacteria 5497
187 Ga0157376_11078518 3300014969 Bacteria 828
188 Ga0197907_10444882 3300020069 Bacteria 2299
189 Ga0206356_11336474 3300020070 Bacteria 3014
190 Ga0206354_10235254 3300020081 Bacteria 979
191 Ga0206354_10482305 3300020081 Bacteria 1113
192 Ga0206354_10978633 3300020081 Bacteria 1121
193 Ga0206353_11498348 3300020082 Bacteria 11440
194 Ga0206353_11804675 3300020082 Bacteria 1751
195 Ga0206353_11806520 3300020082 Bacteria 4115
196 Ga0207656_10001334 3300025321 Bacteria 8121
197 Ga0207656_10190029 3300025321 Unclassified 988
198 Ga0207685_10154257 3300025905 Bacteria 1042
199 Ga0207699_10246511 3300025906 Bacteria 1229
200 Ga0207705_10016223 3300025909 Bacteria 5342
201 Ga0207705_10054438 3300025909 Bacteria 2883
202 Ga0207705_10055804 3300025909 Bacteria 2848
203 Ga0207705_10056247 3300025909 Unclassified 2836
204 Ga0207707_10073785 3300025912 Bacteria 2976
205 Ga0207707_10118432 3300025912 Unclassified 2315
206 Ga0207707_10167272 3300025912 Bacteria 1922
207 Ga0207707_10225180 3300025912 Bacteria 1632
208 Ga0207695_10252226 3300025913 Bacteria 1664
209 Ga0207671_10034725 3300025914 Bacteria 3746
210 Ga0207693_10013113 3300025915 Bacteria 6686
211 Ga0207663_10058431 3300025916 Bacteria 2434
212 Ga0207660_10053922 3300025917 Bacteria 2868
213 Ga0207660_10069431 3300025917 Unclassified 2559
214 Ga0207657_10000871 3300025919 Bacteria 31861
215 Ga0207657_10002271 3300025919 Bacteria 20838
216 Ga0207657_10002341 3300025919 Bacteria 20536
217 Ga0207657_10012057 3300025919 Bacteria 8550
218 Ga0207657_10020097 3300025919 Bacteria 6321
219 Ga0207649_10000021 3300025920 Bacteria 209660
220 Ga0207649_10044264 3300025920 Bacteria 2725
221 Ga0207649_10079695 3300025920 Bacteria 2116
222 Ga0207652_10065461 3300025921 Bacteria 3147
223 Ga0207652_10355828 3300025921 Bacteria 1321
224 Ga0207646_10083727 3300025922 Unclassified 2853
225 Ga0207646_10293128 3300025922 Bacteria 1470
226 Ga0207694_10035943 3300025924 Unclassified 3800
227 Ga0207650_10041009 3300025925 Bacteria 3390
228 Ga0207650_10347958 3300025925 Bacteria 1219
229 Ga0207659_10084574 3300025926 Bacteria 2355
230 Ga0207687_10002658 3300025927 Bacteria 12091
231 Ga0207700_10416555 3300025928 Bacteria 1179
232 Ga0207690_10024421 3300025932 Unclassified 3786
233 Ga0207690_10125148 3300025932 Bacteria 1873
234 Ga0207686_10169338 3300025934 Bacteria 1539
235 Ga0207709_10290812 3300025935 Bacteria 1211
236 Ga0207670_10178970 3300025936 Bacteria 1596
237 Ga0207669_10257132 3300025937 Bacteria 1304
238 Ga0207704_10000029 3300025938 Bacteria 120526
239 Ga0207665_10165909 3300025939 Bacteria 1592
240 Ga0207711_10000085 3300025941 Bacteria 99467
241 Ga0207661_10008791 3300025944 Bacteria 7226
242 Ga0207661_10130319 3300025944 Bacteria 2153
243 Ga0207661_10150598 3300025944 Bacteria 2011
244 Ga0207661_10254456 3300025944 Bacteria 1562
245 Ga0207661_10271635 3300025944 Bacteria 1513
246 Ga0207661_10293458 3300025944 Bacteria 1456
247 Ga0207661_10476216 3300025944 Unclassified 1139
248 Ga0207667_10077710 3300025949 Bacteria 3442
249 Ga0207667_10481159 3300025949 Bacteria 1260
250 Ga0207712_10019910 3300025961 Bacteria 4388
251 Ga0207712_10052342 3300025961 Bacteria 2860
252 Ga0207668_10133314 3300025972 Bacteria 1900
253 Ga0207668_10616128 3300025972 Bacteria 947
254 Ga0207640_10000026 3300025981 Bacteria 142343
255 Ga0207639_10097994 3300026041 Unclassified 2362
256 Ga0207639_10235335 3300026041 Bacteria 1590
257 Ga0207702_10019944 3300026078 Bacteria 5555
258 Ga0207702_10065246 3300026078 Unclassified 3118
259 Ga0207702_10730973 3300026078 Bacteria 976
260 Ga0207702_10826367 3300026078 Unclassified 916
261 Ga0207674_10001150 3300026116 Bacteria 34275
262 Ga0207674_10007999 3300026116 Bacteria 12266
263 Ga0207674_10349326 3300026116 Bacteria 1430
264 Ga0207683_10221243 3300026121 Bacteria 1725
265 Ga0207698_10000009 3300026142 Bacteria 281300
266 Ga0207698_10330370 3300026142 Bacteria 1432
267 Ga0207698_10572937 3300026142 Unclassified 1110
268 Ga0207428_10011658 3300027907 Bacteria 7756
269 Ga0207428_10031682 3300027907 Bacteria 4359
270 Ga0207428_10044535 3300027907 Bacteria 3580
271 Ga0207428_10501118 3300027907 Bacteria 882
272 Ga0268266_10026324 3300028379 Bacteria 4949
273 Ga0268266_10763934 3300028379 Bacteria 933
274 Ga0268264_10235624 3300028381 Bacteria 1693
275 Ga0307405_10102728 3300031731 Bacteria 1921
276 Ga0307416_100153538 3300032002 Bacteria 2116
277 Ga0307416_100204015 3300032002 Bacteria 1879
278 Ga0307416_100675742 3300032002 Bacteria 1120
279 Ga0307415_100353301 3300032126 Archaea 1238
280 Ga0373959_0078866 3300034820 Bacteria 756
281 Ga0395899_0008491 3300037312 Bacteria 7913
282 Ga0395899_0012697 3300037312 Bacteria 6455
283 Ga0395899_0064946 3300037312 Bacteria 2682
284 Ga0395899_0107333 3300037312 Bacteria 2010
285 Ga0395899_0305461 3300037312 Bacteria 1075
286 Ga0395900_0012790 3300037418 Bacteria 8578
287 Ga0395900_0018964 3300037418 Bacteria 7017
288 Ga0395900_0021952 3300037418 Bacteria 6527
289 Ga0395900_0069854 3300037418 Bacteria 3610
290 Ga0395900_0075062 3300037418 Bacteria 3475
291 Ga0395900_0092120 3300037418 Bacteria 3114
292 Ga0395900_0202017 3300037418 Bacteria 2010
293 Ga0395900_0234676 3300037418 Unclassified 1843
294 Ga0395898_0014609 3300037466 Bacteria 8064
295 Ga0395898_0021795 3300037466 Bacteria 6492
296 Ga0395898_0027149 3300037466 Bacteria 5750
297 Ga0395898_0028726 3300037466 Bacteria 5573
298 Ga0395898_0041969 3300037466 Bacteria 4516
299 Ga0395898_0054694 3300037466 Bacteria 3894
300 Ga0395898_0155786 3300037466 Bacteria 2185
301 Ga0395898_0275358 3300037466 Bacteria 1605
302 Ga0395898_0391278 3300037466 Bacteria 1325
303 Ga0395898_0777016 3300037466 Bacteria 898
304 Ga0395905_0018558 3300037471 Bacteria 6600
305 Ga0395905_0029399 3300037471 Bacteria 5177
306 Ga0395905_0073506 3300037471 Bacteria 3205
307 Ga0395905_0113689 3300037471 Bacteria 2543
308 Ga0395905_0129370 3300037471 Bacteria 2374
309 Ga0395905_0159763 3300037471 Bacteria 2118
310 Ga0395905_0174421 3300037471 Bacteria 2019
311 Ga0395905_0223382 3300037471 Bacteria 1763
312 Ga0395905_0602426 3300037471 Unclassified 1000
313 Ga0395905_0898404 3300037471 Bacteria 789
314 Ga0395901_0006478 3300038443 Bacteria 11853
315 Ga0395901_0009653 3300038443 Bacteria 9789
316 Ga0395901_0038018 3300038443 Bacteria 4978
317 Ga0395901_0042427 3300038443 Bacteria 4716
318 Ga0395901_0045082 3300038443 Bacteria 4575
319 Ga0395901_0057650 3300038443 Bacteria 4039
320 Ga0395901_0129153 3300038443 Bacteria 2656
321 Ga0395901_0173151 3300038443 Bacteria 2264
322 Ga0395901_0252218 3300038443 Unclassified 1838
323 Ga0395901_0287948 3300038443 Bacteria 1705
324 Ga0395901_0321267 3300038443 Unclassified 1601
325 Ga0395901_0486274 3300038443 Bacteria 1258
326 Ga0439438_032907 3300041405 Bacteria 1372
327 Ga0439439_0004574 3300041406 Bacteria 3128
328 Ga0439461_0002958 3300041410 Bacteria 2761
329 Ga0439466_0057614 3300041411 Bacteria 1258
330 Ga0451853_2486766 3300041512 Bacteria 1591
331 Ga0439448_0028929 3300042005 Bacteria 1752
332 Ga0439462_0000555 3300042015 Bacteria 7394
333 Ga0450915_001120 3300042119 Bacteria 1183
334 Ga0450920_038374 3300042122 Bacteria 952
335 Ga0450888_004429 3300042126 Bacteria 1466
336 Ga0450902_007814 3300042137 Bacteria 1662
337 Ga0450906_004386 3300042145 Bacteria 2959
338 Ga0439446_0002209 3300042156 Bacteria 4642
339 Ga0450908_006627 3300042184 Bacteria 2194
340 Ga0439434_0008078 3300042435 Bacteria 3086
341 Ga0439464_0018822 3300042439 Bacteria 1881
342 Ga0466966_0020715 3300044684 Bacteria 4321
343 Ga0466961_0015587 3300044693 Bacteria 4876
344 Ga0466963_0135717 3300044694 Bacteria 1702
345 Ga0466963_0289551 3300044694 Bacteria 1151
346 Ga0466964_0001834 3300044706 Bacteria 7397
347 Ga0466971_0024192 3300044719 Bacteria 2709
348 Ga0466957_0050484 3300044842 Bacteria 2531
349 Ga0466957_0174974 3300044842 Bacteria 1399
350 Ga0466960_0094238 3300044901 Bacteria 1531
351 Ga0466959_0043757 3300045049 Bacteria 3299
352 Ga0466958_0003897 3300045836 Bacteria 7810
353 Ga0466967_0014635 3300045976 Bacteria 6121
354 Ga0466967_0640581 3300045976 Unclassified 1050
355 Ga0495592_0019510 3300046454 Bacteria 5156
356 Ga0495651_0000060 3300046462 Bacteria 81522
357 Ga0495580_0605524 3300046472 Bacteria 724
358 Ga0495582_0229708 3300046473 Bacteria 1062
359 Ga0495596_0010775 3300046500 Bacteria 3968
360 Ga0495608_0005252 3300046511 Bacteria 9252
361 Ga0495608_0218716 3300046511 Bacteria 1196
362 Ga0495628_0015218 3300046516 Bacteria 6427
363 Ga0495652_0002160 3300046529 Bacteria 20687
364 Ga0495587_0008089 3300046536 Bacteria 6780
365 Ga0495645_0001266 3300046543 Bacteria 17205
366 Ga0495657_0006356 3300046675 Bacteria 9252
367 Ga0495599_0007194 3300046678 Bacteria 6742
368 Ga0495646_0120377 3300046680 Bacteria 1486
369 Ga0495604_0027026 3300047317 Bacteria 4567
370 Ga0495675_0003694 3300047444 Bacteria 9252
371 Ga0495675_0258654 3300047444 Bacteria 1043
372 Ga0495593_0074125 3300047673 Bacteria 1765
373 Ga0495602_0019312 3300048088 Bacteria 6771
374 Ga0496100_0003140 3300048903 Bacteria 8560
375 Ga0496100_0029469 3300048903 Bacteria 3395
376 Ga0496101_0004935 3300048904 Bacteria 8465
377 Ga0496101_0005451 3300048904 Bacteria 8111
378 Ga0496101_0010656 3300048904 Bacteria 6075
379 Ga0496102_0052646 3300048905 Unclassified 3709
380 Ga0496102_0064428 3300048905 Bacteria 3357
381 Ga0496102_0070712 3300048905 Bacteria 3204
382 Ga0496102_0252706 3300048905 Unclassified 1662
383 Ga0496102_0269509 3300048905 Bacteria 1605
384 Ga0496102_0323854 3300048905 Bacteria 1452
385 Ga0496103_0018737 3300048906 Unclassified 4154
386 Ga0496103_0040001 3300048906 Bacteria 2882
387 Ga0496104_0000278 3300048907 Bacteria 45634
388 Ga0496104_0214179 3300048907 Bacteria 1838
389 Ga0496104_0672811 3300048907 Unclassified 943
390 Ga0496105_0139318 3300048908 Bacteria 1997
391 Ga0496105_0261601 3300048908 Bacteria 1399
392 Ga0496105_0522867 3300048908 Bacteria 929
393 Ga0496105_0599472 3300048908 Unclassified 855
394 Ga0496106_0015731 3300048909 Bacteria 5597
395 Ga0496106_0020914 3300048909 Bacteria 4856
396 Ga0496106_0053207 3300048909 Bacteria 3057
397 Ga0496106_0125910 3300048909 Bacteria 2006
398 Ga0496107_0002034 3300048910 Bacteria 12918
399 Ga0496108_0002990 3300048911 Bacteria 13582
400 Ga0496108_0264804 3300048911 Bacteria 1496
401 Ga0496108_0379032 3300048911 Bacteria 1235
402 Ga0496109_0009286 3300048912 Bacteria 8379
403 Ga0496109_0440732 3300048912 Unclassified 1230
404 Ga0496110_0000004 3300048913 Bacteria 122867
405 Ga0496110_0011731 3300048913 Bacteria 7190
406 Ga0496110_0016483 3300048913 Bacteria 6171
407 Ga0496111_0000002 3300048914 Bacteria 135794
408 Ga0496111_0008333 3300048914 Bacteria 6853
409 Ga0496111_0169093 3300048914 Bacteria 1624
410 Ga0496112_0052993 3300048915 Unclassified 3983
411 Ga0496112_0076295 3300048915 Bacteria 3315
412 Ga0496112_0384654 3300048915 Bacteria 1344
413 Ga0496113_0125684 3300048916 Bacteria 2008
414 Ga0496113_0590938 3300048916 Bacteria 889
415 Ga0496114_0022694 3300048917 Bacteria 5115
416 Ga0496114_0057872 3300048917 Bacteria 3236
417 Ga0496114_0066590 3300048917 Bacteria 3020
418 Ga0496115_0000616 3300048918 Bacteria 27043
419 Ga0496115_0062419 3300048918 Bacteria 3006
420 Ga0496115_0136760 3300048918 Bacteria 2020
421 Ga0501031_0001912 3300049568 Bacteria 13123
422 Ga0501031_0010913 3300049568 Bacteria 5916
423 Ga0501031_0332527 3300049568 Bacteria 984
424 Ga0501032_0026846 3300049569 Bacteria 3958
425 Ga0501033_0047200 3300049570 Bacteria 3202
426 Ga0501034_0014167 3300049571 Bacteria 8218
427 Ga0501036_0001080 3300049572 Bacteria 20679
428 Ga0501036_0007871 3300049572 Bacteria 8717
429 Ga0501036_0047341 3300049572 Bacteria 3642
430 Ga0501037_0020426 3300049573 Bacteria 4890
431 Ga0501037_0098688 3300049573 Bacteria 2110
432 Ga0501037_0420613 3300049573 Bacteria 914
433 Ga0501038_0001400 3300049574 Bacteria 22061
434 Ga0501038_0076709 3300049574 Bacteria 2823
435 Ga0501039_0000367 3300049575 Bacteria 32271
436 Ga0501039_0102954 3300049575 Bacteria 2228
437 Ga0501040_0005072 3300049576 Bacteria 8508
438 Ga0501040_0029984 3300049576 Bacteria 3671
439 Ga0501040_0199922 3300049576 Bacteria 1419
440 Ga0501040_0351048 3300049576 Bacteria 1057
441 Ga0501041_0001022 3300049577 Bacteria 15300
442 Ga0501041_0025444 3300049577 Bacteria 3556
443 Ga0501041_0032915 3300049577 Bacteria 3133
444 Ga0501042_0000793 3300049578 Bacteria 17322
445 Ga0501042_0011961 3300049578 Bacteria 5865
446 Ga0501042_0038626 3300049578 Bacteria 3389
447 Ga0501043_0004579 3300049579 Bacteria 11218
448 Ga0501043_0434237 3300049579 Bacteria 989
449 Ga0501046_0001452 3300049580 Bacteria 22782
450 Ga0501046_0004710 3300049580 Bacteria 12302
451 Ga0501046_0045585 3300049580 Bacteria 3483
452 Ga0501047_0210065 3300049581 Bacteria 1805
453 Ga0501048_0001360 3300049582 Bacteria 18537
454 Ga0501048_0016605 3300049582 Bacteria 5428
455 Ga0501048_0037955 3300049582 Bacteria 3458
456 Ga0501048_0451205 3300049582 Bacteria 921
457 Ga0501067_0014015 3300049583 Bacteria 4441
458 Ga0501067_0029712 3300049583 Bacteria 3029
459 Ga0501067_0090971 3300049583 Bacteria 1694
460 Ga0501067_0194405 3300049583 Bacteria 1130
461 Ga0501068_0000338 3300049584 Bacteria 23564
462 Ga0501068_0052025 3300049584 Bacteria 2478
463 Ga0501069_0011702 3300049585 Bacteria 4651
464 Ga0501069_0016586 3300049585 Bacteria 3958
465 Ga0501069_0023440 3300049585 Bacteria 3365
466 Ga0501069_0212887 3300049585 Bacteria 1122
467 Ga0501069_0243399 3300049585 Unclassified 1048
468 Ga0501070_0009695 3300049586 Bacteria 8143
469 Ga0501070_0017074 3300049586 Bacteria 6091
470 Ga0501070_0052055 3300049586 Bacteria 3398
471 Ga0501070_0090730 3300049586 Bacteria 2529
472 Ga0501071_0000079 3300049587 Bacteria 34768
473 Ga0501071_0021276 3300049587 Bacteria 4515
474 Ga0501071_0198953 3300049587 Bacteria 1505
475 Ga0501071_0776152 3300049587 Bacteria 739
476 Ga0501072_0000403 3300049588 Bacteria 30914
477 Ga0501072_0009880 3300049588 Bacteria 7257
478 Ga0501072_0573026 3300049588 Bacteria 891
479 Ga0501073_0005662 3300049589 Bacteria 9343
480 Ga0501073_0270138 3300049589 Bacteria 1173
481 Ga0501074_0000475 3300049590 Bacteria 24315
482 Ga0501074_0004627 3300049590 Bacteria 9850
483 Ga0501074_0015108 3300049590 Bacteria 5615
484 Ga0501075_0001394 3300049591 Bacteria 15720
485 Ga0501075_0024962 3300049591 Bacteria 4388
486 Ga0501075_0086806 3300049591 Bacteria 2370
487 Ga0501075_0313210 3300049591 Bacteria 1196
488 Ga0501075_0362542 3300049591 Bacteria 1105
489 Ga0501075_0748533 3300049591 Bacteria 744
490 Ga0501076_0001301 3300049592 Bacteria 16668
491 Ga0501076_0003617 3300049592 Bacteria 10853
492 Ga0501076_0024647 3300049592 Bacteria 4652
493 Ga0501076_1074872 3300049592 Bacteria 663
494 Ga0501077_0002463 3300049593 Bacteria 11091
495 Ga0501077_0003418 3300049593 Bacteria 9545
496 Ga0501077_0013154 3300049593 Bacteria 5185
497 Ga0501079_0002666 3300049741 Bacteria 12975
498 Ga0501079_0006065 3300049741 Bacteria 9056
499 Ga0501080_0002689 3300049742 Bacteria 15571
500 Ga0501080_0039151 3300049742 Bacteria 4424
501 Ga0501080_0081274 3300049742 Bacteria 3011
502 Ga0501080_0102560 3300049742 Bacteria 2654
503 Ga0501080_0191335 3300049742 Bacteria 1880
504 Ga0501081_0000852 3300049743 Bacteria 18010
505 Ga0501081_0015524 3300049743 Bacteria 5026
506 Ga0501083_0002451 3300049744 Bacteria 12699
507 Ga0501035_0004349 3300049822 Bacteria 13447
508 Ga0501044_0623518 3300049823 Bacteria 970
509 Ga0501044_0960344 3300049823 Bacteria 727
510 Ga0501045_0001941 3300049824 Bacteria 13964
511 Ga0501045_0005803 3300049824 Bacteria 8544
512 Ga0501045_0188837 3300049824 Bacteria 1536
513 nmdc:mga00v17_11892_c1 3300050491 Bacteria 4792
514 nmdc:mga00v17_84833_c1 3300050491 Bacteria 1983
515 nmdc:mga0yw44_5302_c1 3300050492 Bacteria 6061
516 nmdc:mga0yw44_73030_c1 3300050492 Bacteria 1224
517 nmdc:mga05p37_1015475_c1 3300050507 Bacteria 879
518 nmdc:mga05p37_148615_c1 3300050507 Bacteria 2868
519 nmdc:mga05p37_416513_c1 3300050507 Bacteria 1565
520 nmdc:mga05p37_511484_c1 3300050507 Bacteria 1376
521 nmdc:mga09592_9396_c1 3300050508 Bacteria 7947
522 nmdc:mga0qj67_148855_c1 3300050509 Bacteria 1899
523 nmdc:mga0qj67_27445_c1 3300050509 Bacteria 4414
524 nmdc:mga06r32_192676_c1 3300050510 Bacteria 2026
525 nmdc:mga06r32_506982_c1 3300050510 Bacteria 1183
526 nmdc:mga06r32_70669_c1 3300050510 Bacteria 3377
527 nmdc:mga08y16_10615_c1 3300050511 Bacteria 9663
528 nmdc:mga08y16_399047_c1 3300050511 Bacteria 1408
529 nmdc:mga08y16_49469_c1 3300050511 Bacteria 4400
530 nmdc:mga08y16_97522_c1 3300050511 Bacteria 3061
531 nmdc:mga0n895_27279_c1 3300050512 Bacteria 5424
532 nmdc:mga0a205_4667_c1 3300050515 Bacteria 12288
533 Ga0495601_0055098 3300053077 Bacteria 2517
534 Ga0495595_0001450 3300053084 Bacteria 9252
535 Ga0495619_0000038 3300053085 Bacteria 121365
536 Ga0495619_0004160 3300053085 Bacteria 9249
537 Ga0501084_0001486 3300054114 Bacteria 18633
538 Ga0501084_0008866 3300054114 Bacteria 8324
539 Ga0501084_0172811 3300054114 Bacteria 1824
540 Ga0590075_025527 3300059424 Bacteria 1485
541 Ga0501082_0000977 3300060353 Bacteria 25229
542 Ga0501082_0002174 3300060353 Bacteria 17191
543 Ga0501082_0007521 3300060353 Bacteria 9401
544 Ga0466962_0000222 3300061719 Bacteria 23567
545 Ga0530510_0001984 3300061734 Bacteria 14025
546 Ga0530510_0003823 3300061734 Bacteria 10383
547 Ga0530510_0014386 3300061734 Bacteria 5579
548 Ga0530510_0090884 3300061734 Bacteria 2227
549 Ga0530510_0098694 3300061734 Bacteria 2135
550 Ga0530510_0099433 3300061734 Bacteria 2127
551 Ga0530510_0249285 3300061734 Bacteria 1323
552 Ga0070683_100347327
553 JGI25407J50210_10000051
554 Ga0070658_10017637
555 Ga0070658_10067133
556 Ga0070658_10090158
557 Ga0070658_10096535
558 Ga0070683_100003946
559 Ga0070683_100075110
560 Ga0070683_100113353
561 Ga0070683_100171133
562 Ga0070683_100448775
563 Ga0070670_100035246
564 Ga0070680_100029316
565 Ga0070682_100028671
566 Ga0070682_100130489
567 Ga0070682_100591201
568 Ga0070660_100022411
569 Ga0070660_100029567
570 Ga0070660_100058860
571 Ga0070660_100118028
572 Ga0070689_100216867
573 Ga0070691_10179962
574 Ga0070661_100000031
575 Ga0070661_100039491
576 Ga0070661_100040824
577 Ga0070661_100066266
578 Ga0070661_100178060
579 Ga0070675_100075867
580 Ga0070671_100026115
581 Ga0070671_100046342
582 Ga0070674_100010639
583 Ga0070674_100068963
584 Ga0070674_100794211
585 Ga0070688_100000064
586 Ga0070659_100003810
587 Ga0070659_100237295
588 Ga0070709_10347421
589 Ga0070714_100243665
590 Ga0070714_100615219
591 Ga0070713_100062930
592 Ga0070713_100113264
593 Ga0070711_100017562
594 Ga0070708_100009239
595 Ga0070708_100265595
596 Ga0070663_100257211
597 Ga0070678_100037180
598 Ga0070681_10000245
599 Ga0070681_10030560
600 Ga0070681_10043297
601 Ga0070681_10057461
602 Ga0070681_10087399
603 Ga0070681_10754778
604 Ga0070685_10000154
605 Ga0070685_10571558
606 Ga0070707_100097602
607 Ga0070698_100085435
608 Ga0070698_100216547
609 Ga0070699_100093297
610 Ga0070679_100024083
611 Ga0070679_100065482
612 Ga0070679_100075853
613 Ga0070679_100112578
614 Ga0070679_100368894
615 Ga0070684_100004187
616 Ga0070684_100037347
617 Ga0070684_100039570
618 Ga0070684_100041130
619 Ga0070684_100169365
620 Ga0070684_100332895
621 Ga0068853_100546600
622 Ga0070672_100370834
623 Ga0070696_100045234
624 Ga0070665_100077581
625 Ga0070704_100945555
626 Ga0068855_100070685
627 Ga0068855_100080812
628 Ga0068855_100224272
629 Ga0068855_100229458
630 Ga0070664_100062485
631 Ga0070664_100414493
632 Ga0068857_100001170
633 Ga0068857_100005040
634 Ga0068857_100025316
635 Ga0068854_100000107
636 Ga0068856_100028336
637 Ga0068856_100071819
638 Ga0068856_101267454
639 Ga0068852_100000131
640 Ga0068852_100011665
641 Ga0068851_10000303
642 Ga0068851_10116686
643 Ga0068862_100008815
644 Ga0081455_10003318
645 Ga0081455_10015882
646 Ga0081455_10035719
647 Ga0081455_10038797
648 Ga0081455_10220790
649 Ga0081538_10000505
650 Ga0081538_10003497
651 Ga0081538_10005924
652 Ga0081538_10039742
653 Ga0081538_10062030
654 Ga0081539_10017265
655 Ga0070717_10272978
656 Ga0075365_10196528
657 Ga0075368_10036139
658 Ga0075363_100138098
659 Ga0075364_10139539
660 Ga0075364_10300770
661 Ga0070715_10267153
662 Ga0070716_100095215
663 Ga0070712_100004685
664 Ga0070712_100227512
665 Ga0070712_100474612
666 Ga0075362_10010193
667 Ga0075428_100842508
668 Ga0075430_100009893
669 Ga0075430_100380047
670 Ga0075431_100004744
671 Ga0075431_100028131
672 Ga0075433_10014517
673 Ga0075434_100001863
674 Ga0075434_100103671
675 Ga0075434_101017479
676 Ga0075429_100014330
677 Ga0075429_100077652
678 Ga0068865_100000033
679 Ga0068865_100296784
680 Ga0075436_100160827
681 Ga0075435_100202487
682 Ga0105240_10105580
683 Ga0105240_10169655
684 Ga0105240_10185100
685 Ga0105240_10270077
686 Ga0111539_10021844
687 Ga0111539_10048000
688 Ga0111539_10058946
689 Ga0111539_10134678
690 Ga0111539_10268152
691 Ga0105245_10005216
692 Ga0105245_10029442
693 Ga0114129_10257255
694 Ga0114129_10527943
695 Ga0114129_10734653
696 Ga0114129_10806765
697 Ga0114129_10983327
698 Ga0105243_10260432
699 Ga0105243_10264934
700 Ga0105241_10412102
701 Ga0105242_10088824
702 Ga0105248_10000466
703 Ga0105237_10012844
704 Ga0105237_10029726
705 Ga0105238_10005537
706 Ga0105238_10410146
707 Ga0105249_10009419
708 Ga0105239_10069838
709 Ga0105239_10071496
710 Ga0105239_10239289
711 Ga0105239_10514392
712 Ga0157371_10002867
713 Ga0157371_10111292
714 Ga0157371_10436938
715 Ga0157371_10439342
716 Ga0157370_10004109
717 Ga0157370_10006231
718 Ga0157370_10158090
719 Ga0157369_10018403
720 Ga0157369_10055758
721 Ga0157369_10076037
722 Ga0157369_10159283
723 Ga0157369_10220188
724 Ga0157369_10290205
725 Ga0157374_10020848
726 Ga0157378_10267870
727 Ga0157372_10000121
728 Ga0157372_10007905
729 Ga0157372_10032357
730 Ga0157372_10354980
731 Ga0157375_10435756
732 Ga0163163_10986101
733 Ga0157380_10045621
734 Ga0157377_10023752
735 Ga0157377_10105526
736 Ga0157379_10077369
737 Ga0157376_10017277
738 Ga0157376_11078518
739 Ga0197907_10444882
740 Ga0206356_11336474
741 Ga0206354_10235254
742 Ga0206354_10482305
743 Ga0206354_10978633
744 Ga0206353_11498348
745 Ga0206353_11804675
746 Ga0206353_11806520
747 Ga0207656_10001334
748 Ga0207656_10190029
749 Ga0207685_10154257
750 Ga0207699_10246511
751 Ga0207705_10016223
752 Ga0207705_10054438
753 Ga0207705_10055804
754 Ga0207705_10056247
755 Ga0207707_10073785
756 Ga0207707_10118432
757 Ga0207707_10167272
758 Ga0207707_10225180
759 Ga0207695_10252226
760 Ga0207671_10034725
761 Ga0207693_10013113
762 Ga0207663_10058431
763 Ga0207660_10053922
764 Ga0207660_10069431
765 Ga0207657_10000871
766 Ga0207657_10002271
767 Ga0207657_10002341
768 Ga0207657_10012057
769 Ga0207657_10020097
770 Ga0207649_10000021
771 Ga0207649_10044264
772 Ga0207649_10079695
773 Ga0207652_10065461
774 Ga0207652_10355828
775 Ga0207646_10083727
776 Ga0207646_10293128
777 Ga0207694_10035943
778 Ga0207650_10041009
779 Ga0207650_10347958
780 Ga0207659_10084574
781 Ga0207687_10002658
782 Ga0207700_10416555
783 Ga0207690_10024421
784 Ga0207690_10125148
785 Ga0207686_10169338
786 Ga0207709_10290812
787 Ga0207670_10178970
788 Ga0207669_10257132
789 Ga0207704_10000029
790 Ga0207665_10165909
791 Ga0207711_10000085
792 Ga0207661_10008791
793 Ga0207661_10130319
794 Ga0207661_10150598
795 Ga0207661_10254456
796 Ga0207661_10271635
797 Ga0207661_10293458
798 Ga0207661_10476216
799 Ga0207667_10077710
800 Ga0207667_10481159
801 Ga0207712_10019910
802 Ga0207712_10052342
803 Ga0207668_10133314
804 Ga0207668_10616128
805 Ga0207640_10000026
806 Ga0207639_10097994
807 Ga0207639_10235335
808 Ga0207702_10019944
809 Ga0207702_10065246
810 Ga0207702_10730973
811 Ga0207702_10826367
812 Ga0207674_10001150
813 Ga0207674_10007999
814 Ga0207674_10349326
815 Ga0207683_10221243
816 Ga0207698_10000009
817 Ga0207698_10330370
818 Ga0207698_10572937
819 Ga0207428_10011658
820 Ga0207428_10031682
821 Ga0207428_10044535
822 Ga0207428_10501118
823 Ga0268266_10026324
824 Ga0268266_10763934
825 Ga0268264_10235624
826 Ga0307405_10102728
827 Ga0307416_100153538
828 Ga0307416_100204015
829 Ga0307416_100675742
830 Ga0307415_100353301
831 Ga0373959_0078866
832 Ga0395899_0008491
833 Ga0395899_0012697
834 Ga0395899_0064946
835 Ga0395899_0107333
836 Ga0395899_0305461
837 Ga0395900_0012790
838 Ga0395900_0018964
839 Ga0395900_0021952
840 Ga0395900_0069854
841 Ga0395900_0075062
842 Ga0395900_0092120
843 Ga0395900_0202017
844 Ga0395900_0234676
845 Ga0395898_0014609
846 Ga0395898_0021795
847 Ga0395898_0027149
848 Ga0395898_0028726
849 Ga0395898_0041969
850 Ga0395898_0054694
851 Ga0395898_0155786
852 Ga0395898_0275358
853 Ga0395898_0391278
854 Ga0395898_0777016
855 Ga0395905_0018558
856 Ga0395905_0029399
857 Ga0395905_0073506
858 Ga0395905_0113689
859 Ga0395905_0129370
860 Ga0395905_0159763
861 Ga0395905_0174421
862 Ga0395905_0223382
863 Ga0395905_0602426
864 Ga0395905_0898404
865 Ga0395901_0006478
866 Ga0395901_0009653
867 Ga0395901_0038018
868 Ga0395901_0042427
869 Ga0395901_0045082
870 Ga0395901_0057650
871 Ga0395901_0129153
872 Ga0395901_0173151
873 Ga0395901_0252218
874 Ga0395901_0287948
875 Ga0395901_0321267
876 Ga0395901_0486274
877 Ga0439438_032907
878 Ga0439439_0004574
879 Ga0439461_0002958
880 Ga0439466_0057614
881 Ga0451853_2486766
882 Ga0439448_0028929
883 Ga0439462_0000555
884 Ga0450915_001120
885 Ga0450920_038374
886 Ga0450888_004429
887 Ga0450902_007814
888 Ga0450906_004386
889 Ga0439446_0002209
890 Ga0450908_006627
891 Ga0439434_0008078
892 Ga0439464_0018822
893 Ga0466966_0020715
894 Ga0466961_0015587
895 Ga0466963_0135717
896 Ga0466963_0289551
897 Ga0466964_0001834
898 Ga0466971_0024192
899 Ga0466957_0050484
900 Ga0466957_0174974
901 Ga0466960_0094238
902 Ga0466959_0043757
903 Ga0466958_0003897
904 Ga0466967_0014635
905 Ga0466967_0640581
906 Ga0495592_0019510
907 Ga0495651_0000060
908 Ga0495580_0605524
909 Ga0495582_0229708
910 Ga0495596_0010775
911 Ga0495608_0005252
912 Ga0495608_0218716
913 Ga0495628_0015218
914 Ga0495652_0002160
915 Ga0495587_0008089
916 Ga0495645_0001266
917 Ga0495657_0006356
918 Ga0495599_0007194
919 Ga0495646_0120377
920 Ga0495604_0027026
921 Ga0495675_0003694
922 Ga0495675_0258654
923 Ga0495593_0074125
924 Ga0495602_0019312
925 Ga0496100_0003140
926 Ga0496100_0029469
927 Ga0496101_0004935
928 Ga0496101_0005451
929 Ga0496101_0010656
930 Ga0496102_0052646
931 Ga0496102_0064428
932 Ga0496102_0070712
933 Ga0496102_0252706
934 Ga0496102_0269509
935 Ga0496102_0323854
936 Ga0496103_0018737
937 Ga0496103_0040001
938 Ga0496104_0000278
939 Ga0496104_0214179
940 Ga0496104_0672811
941 Ga0496105_0139318
942 Ga0496105_0261601
943 Ga0496105_0522867
944 Ga0496105_0599472
945 Ga0496106_0015731
946 Ga0496106_0020914
947 Ga0496106_0053207
948 Ga0496106_0125910
949 Ga0496107_0002034
950 Ga0496108_0002990
951 Ga0496108_0264804
952 Ga0496108_0379032
953 Ga0496109_0009286
954 Ga0496109_0440732
955 Ga0496110_0000004
956 Ga0496110_0011731
957 Ga0496110_0016483
958 Ga0496111_0000002
959 Ga0496111_0008333
960 Ga0496111_0169093
961 Ga0496112_0052993
962 Ga0496112_0076295
963 Ga0496112_0384654
964 Ga0496113_0125684
965 Ga0496113_0590938
966 Ga0496114_0022694
967 Ga0496114_0057872
968 Ga0496114_0066590
969 Ga0496115_0000616
970 Ga0496115_0062419
971 Ga0496115_0136760
972 Ga0501031_0001912
973 Ga0501031_0010913
974 Ga0501031_0332527
975 Ga0501032_0026846
976 Ga0501033_0047200
977 Ga0501034_0014167
978 Ga0501036_0001080
979 Ga0501036_0007871
980 Ga0501036_0047341
981 Ga0501037_0020426
982 Ga0501037_0098688
983 Ga0501037_0420613
984 Ga0501038_0001400
985 Ga0501038_0076709
986 Ga0501039_0000367
987 Ga0501039_0102954
988 Ga0501040_0005072
989 Ga0501040_0029984
990 Ga0501040_0199922
991 Ga0501040_0351048
992 Ga0501041_0001022
993 Ga0501041_0025444
994 Ga0501041_0032915
995 Ga0501042_0000793
996 Ga0501042_0011961
997 Ga0501042_0038626
998 Ga0501043_0004579
999 Ga0501043_0434237
1000 Ga0501046_0001452
1001 Ga0501046_0004710
1002 Ga0501046_0045585
1003 Ga0501047_0210065
1004 Ga0501048_0001360
1005 Ga0501048_0016605
1006 Ga0501048_0037955
1007 Ga0501048_0451205
1008 Ga0501067_0014015
1009 Ga0501067_0029712
1010 Ga0501067_0090971
1011 Ga0501067_0194405
1012 Ga0501068_0000338
1013 Ga0501068_0052025
1014 Ga0501069_0011702
1015 Ga0501069_0016586
1016 Ga0501069_0023440
1017 Ga0501069_0212887
1018 Ga0501069_0243399
1019 Ga0501070_0009695
1020 Ga0501070_0017074
1021 Ga0501070_0052055
1022 Ga0501070_0090730
1023 Ga0501071_0000079
1024 Ga0501071_0021276
1025 Ga0501071_0198953
1026 Ga0501071_0776152
1027 Ga0501072_0000403
1028 Ga0501072_0009880
1029 Ga0501072_0573026
1030 Ga0501073_0005662
1031 Ga0501073_0270138
1032 Ga0501074_0000475
1033 Ga0501074_0004627
1034 Ga0501074_0015108
1035 Ga0501075_0001394
1036 Ga0501075_0024962
1037 Ga0501075_0086806
1038 Ga0501075_0313210
1039 Ga0501075_0362542
1040 Ga0501075_0748533
1041 Ga0501076_0001301
1042 Ga0501076_0003617
1043 Ga0501076_0024647
1044 Ga0501076_1074872
1045 Ga0501077_0002463
1046 Ga0501077_0003418
1047 Ga0501077_0013154
1048 Ga0501079_0002666
1049 Ga0501079_0006065
1050 Ga0501080_0002689
1051 Ga0501080_0039151
1052 Ga0501080_0081274
1053 Ga0501080_0102560
1054 Ga0501080_0191335
1055 Ga0501081_0000852
1056 Ga0501081_0015524
1057 Ga0501083_0002451
1058 Ga0501035_0004349
1059 Ga0501044_0623518
1060 Ga0501044_0960344
1061 Ga0501045_0001941
1062 Ga0501045_0005803
1063 Ga0501045_0188837
1064 nmdc:mga00v17_11892_c1
1065 nmdc:mga00v17_84833_c1
1066 nmdc:mga0yw44_5302_c1
1067 nmdc:mga0yw44_73030_c1
1068 nmdc:mga05p37_1015475_c1
1069 nmdc:mga05p37_148615_c1
1070 nmdc:mga05p37_416513_c1
1071 nmdc:mga05p37_511484_c1
1072 nmdc:mga09592_9396_c1
1073 nmdc:mga0qj67_148855_c1
1074 nmdc:mga0qj67_27445_c1
1075 nmdc:mga06r32_192676_c1
1076 nmdc:mga06r32_506982_c1
1077 nmdc:mga06r32_70669_c1
1078 nmdc:mga08y16_10615_c1
1079 nmdc:mga08y16_399047_c1
1080 nmdc:mga08y16_49469_c1
1081 nmdc:mga08y16_97522_c1
1082 nmdc:mga0n895_27279_c1
1083 nmdc:mga0a205_4667_c1
1084 Ga0495601_0055098
1085 Ga0495595_0001450
1086 Ga0495619_0000038
1087 Ga0495619_0004160
1088 Ga0501084_0001486
1089 Ga0501084_0008866
1090 Ga0501084_0172811
1091 Ga0590075_025527
1092 Ga0501082_0000977
1093 Ga0501082_0002174
1094 Ga0501082_0007521
1095 Ga0466962_0000222
1096 Ga0530510_0001984
1097 Ga0530510_0003823
1098 Ga0530510_0014386
1099 Ga0530510_0090884
1100 Ga0530510_0098694
1101 Ga0530510_0099433
1102 Ga0530510_0249285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9102 161 208
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.903 146 204
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9017 146 210
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8768 143 214
3hug-assembly6.cif.gz_A crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8614 138 214
ID Description Score Start End Superfamily
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9299 146 209 1.10.10.10
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9285 165 202 1.10.10.10
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9254 146 211 1.10.10.10
af_P0AGB6_121_191_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9044 144 210 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.903 146 204 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538C2L2-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9502 20 222 GO:0003677
GO:0006352
GO:0016987
AF-A0A3M1EEW3-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9367 21 122 GO:0003700
GO:0006352
AF-A0A1F8SGU2-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9065 17 222 GO:0006352
GO:0016987
AF-A0A0Q9KI24-F1-model_v4 RNA polymerase subunit sigma-24 0.8989 24 221 GO:0006352
GO:0016987
AF-A0A535HMV5-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8982 9 222 GO:0006352
GO:0016987

Map