F462552

General Info

Members Datasets Scaffolds Average Seq Length
550 433 1100 116

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237087|2513590168
Length 133
Sequence AEIPSRGVPAVRCRGMGRWRRGLCLLALALAPVAAGAADAPANDYPTTARLDYAVGCMAANGQTREAMERCACSVDTLASILPYDRYVEAETILSMRQGVGQAASLFRNTPMYDDVIADLRRAQAEAEVRCFK

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
65 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
68 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
108 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
109 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
217 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
218 2509276019 Ensifer aridi TW10 Isolate Nodule
219 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
220 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
221 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
222 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
223 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
224 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
225 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
226 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
227 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
228 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
229 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
230 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
231 2516143018 Ensifer sp. BR816 Isolate Nodule
232 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
233 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
234 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
235 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
236 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
237 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
238 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
239 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
240 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
241 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
242 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
243 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
244 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
245 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
246 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
247 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
248 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
249 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
250 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
251 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
252 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
253 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
254 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
255 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
256 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
257 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
258 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
259 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
260 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
261 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
262 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
263 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
264 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
265 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
266 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
267 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
268 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
269 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
270 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
271 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
272 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
273 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
274 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
275 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
276 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
277 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
278 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
279 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
280 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
281 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
282 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
283 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
284 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
285 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
286 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
287 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
288 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
289 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
290 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
291 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
292 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
293 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
294 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
295 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
296 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
297 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
298 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
299 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
300 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
301 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
302 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
303 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
304 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
305 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
306 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
307 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
308 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
309 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
310 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
311 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
312 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
313 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
314 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
315 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
316 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
317 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
318 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
319 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
320 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
321 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
322 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
323 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
324 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
325 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
326 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
327 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
328 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
329 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
330 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
331 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
332 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
333 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
334 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
335 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
336 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
337 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
338 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
339 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
340 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
341 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
342 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
343 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
344 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
345 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
346 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
347 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
348 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
349 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
350 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
351 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
352 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
353 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
354 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
355 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
356 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
357 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
358 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
359 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
360 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
361 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
362 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
363 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
364 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
365 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
366 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
367 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
368 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
369 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
370 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
371 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
372 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
373 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
374 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
375 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
376 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
377 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
378 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
379 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
380 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
381 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
382 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
383 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
384 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
385 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
386 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
387 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
388 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
389 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
390 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
391 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
392 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
393 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
394 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
395 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
396 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
397 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
398 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
399 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
400 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
401 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
402 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
403 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
404 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
405 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
406 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
407 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
408 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
409 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
410 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
411 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
412 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
413 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
414 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
415 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
416 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
417 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
418 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
419 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
420 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
421 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
422 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
423 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
424 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
425 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
426 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
427 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
428 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
429 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
430 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
431 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
432 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
433 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.18
Metatranscriptomes 0
Isolates 39.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 40.73
Rhizoplane 6.18
Rhizosphere 48.18
Stem 0
Stem Tuber 0
Unclassified 5.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100019540 3300005334 Bacteria 4632
2 Ga0068869_101953898 3300005334 Unclassified 526
3 Ga0070680_100013983 3300005336 Bacteria 6265
4 Ga0070691_10092506 3300005341 Bacteria 1493
5 Ga0070703_10001371 3300005406 Bacteria 7400
6 Ga0070709_10000728 3300005434 Bacteria 18607
7 Ga0070714_100087289 3300005435 Bacteria 2728
8 Ga0070714_101980146 3300005435 Bacteria 568
9 Ga0070710_10003264 3300005437 Bacteria 7687
10 Ga0070701_10018412 3300005438 Bacteria 3282
11 Ga0070711_100001618 3300005439 Bacteria 12434
12 Ga0070705_100001671 3300005440 Bacteria 11609
13 Ga0070700_100000273 3300005441 Bacteria 27454
14 Ga0070708_100003020 3300005445 Bacteria 13062
15 Ga0070663_100048429 3300005455 Bacteria 3014
16 Ga0070706_100062805 3300005467 Bacteria 3432
17 Ga0070707_101213788 3300005468 Bacteria 720
18 Ga0070699_100000473 3300005518 Bacteria 38374
19 Ga0070679_101647164 3300005530 Bacteria 589
20 Ga0070697_100059154 3300005536 Bacteria 3120
21 Ga0068853_100863994 3300005539 Bacteria 868
22 Ga0068853_101458118 3300005539 Bacteria 662
23 Ga0070695_100007776 3300005545 Bacteria 6351
24 Ga0070696_100000229 3300005546 Bacteria 33893
25 Ga0070693_100011151 3300005547 Bacteria 4524
26 Ga0070704_100001299 3300005549 Bacteria 13207
27 Ga0068855_100991527 3300005563 Bacteria 883
28 Ga0068857_100018549 3300005577 Bacteria 6103
29 Ga0068854_100255008 3300005578 Bacteria 1402
30 Ga0068859_100003426 3300005617 Bacteria 16126
31 Ga0068864_100044889 3300005618 Bacteria 3790
32 Ga0068861_100147627 3300005719 Bacteria 1926
33 Ga0068858_100034612 3300005842 Bacteria 4686
34 Ga0068860_100012226 3300005843 Bacteria 8458
35 Ga0068862_100018912 3300005844 Bacteria 5740
36 Ga0068862_101040574 3300005844 Bacteria 811
37 Ga0081455_10000834 3300005937 Bacteria 39725
38 Ga0081455_10130999 3300005937 Bacteria 1961
39 Ga0081540_1000578 3300005983 Bacteria 35378
40 Ga0081540_1051652 3300005983 Bacteria 2030
41 Ga0081540_1117996 3300005983 Bacteria 1107
42 Ga0081539_10503017 3300005985 Unclassified 502
43 Ga0070717_10158241 3300006028 Bacteria 1964
44 Ga0070715_10017630 3300006163 Bacteria 2706
45 Ga0070715_10018666 3300006163 Bacteria 2647
46 Ga0070716_100011340 3300006173 Bacteria 4487
47 Ga0068871_100728250 3300006358 Bacteria 910
48 Ga0075428_100002743 3300006844 Bacteria 19178
49 Ga0075430_100012065 3300006846 Bacteria 7355
50 Ga0075431_100002326 3300006847 Bacteria 18259
51 Ga0075431_100021363 3300006847 Bacteria 6619
52 Ga0075431_100605409 3300006847 Bacteria 1079
53 Ga0075433_10011909 3300006852 Bacteria 7008
54 Ga0075433_10032152 3300006852 Bacteria 4492
55 Ga0075434_100000792 3300006871 Bacteria 24957
56 Ga0075434_100005353 3300006871 Bacteria 11676
57 Ga0075429_100085065 3300006880 Bacteria 2757
58 Ga0075429_100249539 3300006880 Bacteria 1554
59 Ga0075429_100259154 3300006880 Bacteria 1522
60 Ga0075429_100268985 3300006880 Bacteria 1493
61 Ga0075429_100669198 3300006880 Bacteria 909
62 Ga0075436_100181531 3300006914 Bacteria 1487
63 Ga0075436_100461843 3300006914 Bacteria 925
64 Ga0097620_100003426 3300006931 Bacteria 16126
65 Ga0079104_1041921 3300006946 Bacteria 1062
66 Ga0079104_1060679 3300006946 Bacteria 815
67 Ga0079104_1081317 3300006946 Bacteria 666
68 Ga0099826_10188207 3300006948 Bacteria 1141
69 Ga0075435_100129356 3300007076 Bacteria 2112
70 Ga0099795_10089417 3300007788 Bacteria 1191
71 Ga0111539_10000292 3300009094 Bacteria 60528
72 Ga0111539_10039891 3300009094 Bacteria 5655
73 Ga0111539_10534180 3300009094 Bacteria 1366
74 Ga0111539_10574718 3300009094 Unclassified 1313
75 Ga0111539_11134498 3300009094 Bacteria 908
76 Ga0114129_10000098 3300009147 Bacteria 84407
77 Ga0114129_10218127 3300009147 Bacteria 2575
78 Ga0114129_10375444 3300009147 Bacteria 1879
79 Ga0114129_10760633 3300009147 Bacteria 1239
80 Ga0105243_10078278 3300009148 Bacteria 2691
81 Ga0105237_10216103 3300009545 Bacteria 1917
82 Ga0105249_10019769 3300009553 Bacteria 6012
83 Ga0105249_11998550 3300009553 Bacteria 652
84 Ga0105249_13372048 3300009553 Unclassified 514
85 Ga0105239_10238977 3300010375 Bacteria 2039
86 Ga0105246_10104248 3300011119 Bacteria 2071
87 Ga0157371_11221594 3300013102 Bacteria 580
88 Ga0157378_10136092 3300013297 Bacteria 2278
89 Ga0157378_11791091 3300013297 Bacteria 662
90 Ga0157375_13665510 3300013308 Bacteria 511
91 Ga0157380_10550888 3300014326 Bacteria 1131
92 Ga0157379_10273784 3300014968 Bacteria 1535
93 Ga0157379_10653628 3300014968 Bacteria 984
94 Ga0214542_1020080 3300021321 Bacteria 5020
95 Ga0214543_1000078 3300021327 Bacteria 119775
96 Ga0213873_10008825 3300021358 Bacteria 2073
97 Ga0228711_1006166 3300022739 Bacteria 17969
98 Ga0228710_1003077 3300022740 Bacteria 26562
99 Ga0228710_1042807 3300022740 Bacteria 1230
100 Ga0207653_10000931 3300025885 Bacteria 9702
101 Ga0207692_10215326 3300025898 Bacteria 1136
102 Ga0207685_10056578 3300025905 Bacteria 1535
103 Ga0207699_10090157 3300025906 Bacteria 1923
104 Ga0207663_10434912 3300025916 Bacteria 1009
105 Ga0207660_10066467 3300025917 Bacteria 2609
106 Ga0207646_10931854 3300025922 Bacteria 770
107 Ga0207659_10660116 3300025926 Bacteria 894
108 Ga0207664_10079577 3300025929 Bacteria 2661
109 Ga0207706_10050026 3300025933 Bacteria 3693
110 Ga0207709_10152832 3300025935 Bacteria 1601
111 Ga0207665_10010554 3300025939 Bacteria 6067
112 Ga0207689_10020616 3300025942 Bacteria 5544
113 Ga0207679_10149386 3300025945 Bacteria 1900
114 Ga0207679_10732648 3300025945 Bacteria 898
115 Ga0207712_10002402 3300025961 Bacteria 12128
116 Ga0207712_11314945 3300025961 Unclassified 646
117 Ga0207640_10871283 3300025981 Bacteria 785
118 Ga0207658_12175706 3300025986 Bacteria 504
119 Ga0207639_10793864 3300026041 Bacteria 882
120 Ga0207678_10007341 3300026067 Bacteria 9762
121 Ga0207708_10000819 3300026075 Bacteria 23412
122 Ga0207708_10141173 3300026075 Bacteria 1890
123 Ga0207641_11066518 3300026088 Bacteria 806
124 Ga0207676_10059188 3300026095 Bacteria 3024
125 Ga0207674_10000240 3300026116 Bacteria 68544
126 Ga0207675_100120614 3300026118 Bacteria 2481
127 Ga0207683_10811343 3300026121 Unclassified 868
128 Ga0209281_1000132 3300027111 Bacteria 188464
129 Ga0209281_1002085 3300027111 Bacteria 8936
130 Ga0209281_1053261 3300027111 Bacteria 639
131 Ga0209282_1000018 3300027666 Bacteria 188472
132 Ga0207428_10094193 3300027907 Bacteria 2322
133 Ga0207428_10218317 3300027907 Bacteria 1430
134 Ga0207428_10407241 3300027907 Bacteria 995
135 Ga0207428_10686995 3300027907 Unclassified 733
136 Ga0268265_10001328 3300028380 Bacteria 21171
137 Ga0268265_10788559 3300028380 Bacteria 925
138 Ga0268264_10153237 3300028381 Bacteria 2069
139 Ga0265326_10032202 3300028558 Bacteria 1493
140 Ga0307408_101041508 3300031548 Bacteria 756
141 Ga0307408_101303809 3300031548 Unclassified 681
142 Ga0307413_11585035 3300031824 Unclassified 581
143 Ga0307410_10525221 3300031852 Bacteria 977
144 Ga0307410_11418015 3300031852 Bacteria 610
145 Ga0307406_10318091 3300031901 Bacteria 1203
146 Ga0307412_10067799 3300031911 Bacteria 2424
147 Ga0307412_10404882 3300031911 Bacteria 1112
148 Ga0315914_1000362 3300031967 Bacteria 53477
149 Ga0307414_10608505 3300032004 Bacteria 981
150 Ga0315913_1000078 3300033430 Bacteria 53476
151 Ga0315915_1000006 3300033464 Bacteria 330709
152 Ga0373948_0058654 3300034817 Unclassified 841
153 Ga0373950_0056801 3300034818 Unclassified 779
154 Ga0373958_0007775 3300034819 Bacteria 1718
155 Ga0373938_0031508 3300034957 Bacteria 1137
156 Ga0373938_0193333 3300034957 Bacteria 561
157 Ga0373928_0132899 3300035084 Unclassified 676
158 Ga0373940_0118164 3300035088 Bacteria 820
159 Ga0373940_0205447 3300035088 Unclassified 649
160 Ga0373949_0026803 3300035090 Bacteria 1352
161 Ga0373952_0124921 3300035092 Bacteria 701
162 Ga0373923_0673172 3300035111 Bacteria 513
163 Ga0373932_0032456 3300035112 Bacteria 1461
164 Ga0373939_0086537 3300035114 Bacteria 1051
165 Ga0373939_0116458 3300035114 Bacteria 937
166 Ga0373941_0068374 3300035115 Bacteria 1173
167 Ga0373960_0017494 3300035121 Bacteria 1859
168 Ga0373946_0326734 3300035171 Bacteria 763
169 Ga0373942_0006020 3300035207 Bacteria 2803
170 Ga0373961_0007961 3300035241 Bacteria 2573
171 Ga0373962_0039560 3300035242 Bacteria 1324
172 Ga0373962_0238833 3300035242 Unclassified 627
173 Ga0373931_0007882 3300035691 Bacteria 5037
174 Ga0373931_0084744 3300035691 Bacteria 1755
175 Ga0373935_0048884 3300035692 Bacteria 2680
176 Ga0373935_0798560 3300035692 Bacteria 697
177 Ga0373927_0036723 3300035695 Bacteria 3185
178 Ga0373927_0474186 3300035695 Bacteria 827
179 Ga0373925_0033784 3300037068 Bacteria 3769
180 Ga0373925_0050654 3300037068 Bacteria 3098
181 Ga0373925_1649945 3300037068 Unclassified 524
182 Ga0436364_0556056 3300037853 Bacteria 4607
183 Ga0436365_0797309 3300039437 Bacteria 23338
184 Ga0436363_1504040 3300039450 Bacteria 5500
185 Ga0436362_0788143 3300039453 Bacteria 3499
186 Ga0436362_1176438 3300039453 Bacteria 642
187 Ga0439436_0101426 3300041404 Bacteria 803
188 Ga0439449_0029133 3300042007 Bacteria 2057
189 Ga0439449_0086482 3300042007 Bacteria 1157
190 Ga0439462_0063021 3300042015 Bacteria 1004
191 Ga0466968_0035804 3300044735 Bacteria 2078
192 Ga0466957_0633506 3300044842 Bacteria 751
193 Ga0495603_0713992 3300046455 Bacteria 573
194 Ga0495638_0059302 3300046460 Bacteria 2370
195 Ga0495584_0010782 3300046491 Bacteria 4692
196 Ga0495584_0111522 3300046491 Bacteria 1384
197 Ga0495584_0133905 3300046491 Bacteria 1258
198 Ga0495630_0432735 3300046517 Bacteria 1008
199 Ga0495630_1280715 3300046517 Unclassified 553
200 Ga0495637_0248505 3300046520 Unclassified 641
201 Ga0495665_0204861 3300046531 Bacteria 1022
202 Ga0495640_0568434 3300046533 Bacteria 686
203 Ga0495609_0395887 3300046538 Unclassified 553
204 Ga0495621_0271217 3300046539 Bacteria 697
205 Ga0495667_0787154 3300046559 Bacteria 587
206 Ga0495668_0311025 3300046616 Bacteria 864
207 Ga0495661_0341976 3300046665 Bacteria 739
208 Ga0495647_0026183 3300046681 Bacteria 2135
209 Ga0495658_0010571 3300046683 Bacteria 4619
210 Ga0495613_0559779 3300046689 Unclassified 764
211 Ga0495624_0618774 3300046690 Bacteria 645
212 Ga0495636_0645107 3300047318 Bacteria 520
213 Ga0495674_0120258 3300047319 Bacteria 2219
214 Ga0495672_0049507 3300047320 Bacteria 2486
215 Ga0496100_0046697 3300048903 Bacteria 2787
216 Ga0496100_0285142 3300048903 Bacteria 1232
217 Ga0496100_0871173 3300048903 Bacteria 707
218 Ga0496101_0040028 3300048904 Bacteria 3337
219 Ga0496102_0035454 3300048905 Bacteria 4490
220 Ga0496102_1352985 3300048905 Unclassified 631
221 Ga0496103_0053222 3300048906 Bacteria 2508
222 Ga0496104_0008413 3300048907 Bacteria 9171
223 Ga0496104_0248413 3300048907 Bacteria 1692
224 Ga0496104_0597689 3300048907 Bacteria 1014
225 Ga0496104_1005378 3300048907 Bacteria 738
226 Ga0496105_0010541 3300048908 Bacteria 7270
227 Ga0496105_0010622 3300048908 Bacteria 7243
228 Ga0496105_0183870 3300048908 Bacteria 1711
229 Ga0496105_0391366 3300048908 Bacteria 1105
230 Ga0496106_0002221 3300048909 Bacteria 14476
231 Ga0496107_0057246 3300048910 Bacteria 2818
232 Ga0496108_0440931 3300048911 Bacteria 1138
233 Ga0496108_0735128 3300048911 Bacteria 854
234 Ga0496109_0309139 3300048912 Bacteria 1491
235 Ga0496109_0694305 3300048912 Bacteria 955
236 Ga0496110_0026559 3300048913 Bacteria 4957
237 Ga0496110_0122623 3300048913 Bacteria 2343
238 Ga0496110_0173640 3300048913 Bacteria 1956
239 Ga0496111_0078127 3300048914 Bacteria 2413
240 Ga0496112_0324197 3300048915 Bacteria 1484
241 Ga0496112_1764934 3300048915 Bacteria 531
242 Ga0496113_0022063 3300048916 Bacteria 4497
243 Ga0496114_0216858 3300048917 Bacteria 1679
244 Ga0496114_0307155 3300048917 Bacteria 1401
245 Ga0496115_0066625 3300048918 Bacteria 2910
246 Ga0496115_0143606 3300048918 Bacteria 1969
247 Ga0496115_0613790 3300048918 Bacteria 863
248 Ga0496115_0903870 3300048918 Unclassified 681
249 Ga0496119_0002394 3300048922 Bacteria 20600
250 Ga0496119_0343679 3300048922 Bacteria 724
251 Ga0496121_0720420 3300048924 Bacteria 597
252 Ga0496123_0037995 3300048926 Bacteria 3391
253 Ga0496125_0111386 3300048928 Bacteria 1981
254 Ga0496126_0311082 3300048929 Bacteria 1297
255 Ga0501036_0127086 3300049572 Bacteria 2153
256 Ga0501036_0237370 3300049572 Bacteria 1529
257 Ga0501038_0510585 3300049574 Bacteria 918
258 Ga0501038_0913069 3300049574 Bacteria 648
259 Ga0501039_0219989 3300049575 Bacteria 1493
260 Ga0501040_0036575 3300049576 Bacteria 3333
261 Ga0501040_1203820 3300049576 Bacteria 550
262 Ga0501041_0143733 3300049577 Bacteria 1488
263 Ga0501041_0402492 3300049577 Bacteria 867
264 Ga0501041_0450234 3300049577 Bacteria 817
265 Ga0501041_1065882 3300049577 Bacteria 520
266 Ga0501042_0123266 3300049578 Bacteria 1866
267 Ga0501042_0478358 3300049578 Bacteria 904
268 Ga0501042_0573679 3300049578 Bacteria 820
269 Ga0501042_1058572 3300049578 Bacteria 591
270 Ga0501046_0129451 3300049580 Unclassified 1915
271 Ga0501048_0746449 3300049582 Bacteria 703
272 Ga0501070_0838895 3300049586 Bacteria 720
273 Ga0501071_0270089 3300049587 Bacteria 1286
274 Ga0501071_0572953 3300049587 Bacteria 867
275 Ga0501072_0715635 3300049588 Bacteria 786
276 Ga0501072_0962334 3300049588 Bacteria 666
277 Ga0501075_0690356 3300049591 Bacteria 778
278 Ga0501075_0737024 3300049591 Unclassified 750
279 Ga0501076_0049740 3300049592 Bacteria 3316
280 Ga0501076_0370898 3300049592 Bacteria 1176
281 Ga0501076_1283417 3300049592 Bacteria 602
282 Ga0501077_0157376 3300049593 Bacteria 1442
283 Ga0501079_0133640 3300049741 Bacteria 1931
284 Ga0501081_0092377 3300049743 Bacteria 2130
285 Ga0501081_0240314 3300049743 Bacteria 1320
286 Ga0501081_0305448 3300049743 Bacteria 1167
287 Ga0501081_0745590 3300049743 Unclassified 736
288 Ga0501045_0033534 3300049824 Bacteria 3723
289 Ga0501045_1100937 3300049824 Bacteria 581
290 nmdc:mga05p37_194918_c2 3300050507 Bacteria 1485
291 nmdc:mga05p37_46_c1 3300050507 Bacteria 105665
292 nmdc:mga05p37_491466_c1 3300050507 Bacteria 1411
293 nmdc:mga05p37_616844_c1 3300050507 Bacteria 1221
294 nmdc:mga05p37_98597_c1 3300050507 Bacteria 3599
295 nmdc:mga09592_13760_c1 3300050508 Bacteria 6611
296 nmdc:mga0qj67_10285_c1 3300050509 Bacteria 6987
297 nmdc:mga06r32_103910_c1 3300050510 Bacteria 2790
298 nmdc:mga06r32_1530783_c1 3300050510 Bacteria 607
299 nmdc:mga06r32_237309_c1 3300050510 Bacteria 1811
300 nmdc:mga06r32_73_c1 3300050510 Bacteria 65778
301 nmdc:mga06r32_913375_c1 3300050510 Bacteria 834
302 nmdc:mga06r32_969201_c1 3300050510 Unclassified 804
303 nmdc:mga08y16_610773_c1 3300050511 Unclassified 1098
304 nmdc:mga08y16_816_c1 3300050511 Bacteria 29825
305 nmdc:mga08y16_845391_c1 3300050511 Bacteria 905
306 nmdc:mga0n895_1244_c1 3300050512 Bacteria 18783
307 nmdc:mga0n895_7171_c1 3300050512 Bacteria 9537
308 nmdc:mga0rr50_146564_c1 3300050513 Bacteria 1904
309 nmdc:mga08x19_311494_c1 3300050514 Bacteria 1094
310 nmdc:mga08x19_393689_c1 3300050514 Bacteria 971
311 nmdc:mga0a205_247045_c1 3300050515 Bacteria 1664
312 nmdc:mga0a205_6482_c1 3300050515 Bacteria 10582
313 nmdc:mga0a205_72638_c1 3300050515 Bacteria 3324
314 nmdc:mga0sz30_23559_c2 3300050516 Bacteria 1537
315 Ga0495595_0723122 3300053084 Unclassified 510
316 Ga0500556_0000344 3300053104 Bacteria 34671
317 Ga0500642_0094698 3300053130 Bacteria 1383
318 Ga0500652_162952 3300053131 Bacteria 920
319 Ga0500568_0000342 3300053139 Bacteria 36454
320 Ga0500616_0127078 3300053153 Bacteria 1209
321 Ga0500645_028874 3300053730 Bacteria 1677
322 Ga0501084_0219561 3300054114 Bacteria 1604
323 Ga0501084_0292498 3300054114 Bacteria 1376
324 Ga0501084_0478408 3300054114 Unclassified 1053
325 Ga0501082_0195700 3300060353 Bacteria 1759
326 Ga0501082_0474898 3300060353 Bacteria 1093
327 Ga0501082_0575364 3300060353 Bacteria 985
328 Ga0501082_0634728 3300060353 Bacteria 935
329 Ga0501082_1561234 3300060353 Bacteria 576
330 Ga0530510_0130575 3300061734 Bacteria 1848
331 Ga0530510_0184243 3300061734 Bacteria 1549
332 2513590168 2513237087 Bacteria 5817514
333 2509111366 2508501122 Bacteria 6292184
334 2509375685 2509276019 Bacteria 6802256
335 2510308460 2510065057 Bacteria 6649661
336 2511497201 2511231052 Bacteria 6974333
337 2512970135 2512875026 Bacteria 6861065
338 2513582192 2513237086 Bacteria 7265287
339 2513607213 2513237089 Bacteria 6553624
340 2513617752 2513237091 Bacteria 6900273
341 2513881410 2513237140 Bacteria 7076289
342 2513901099 2513237143 Bacteria 6664116
343 2513985616 2513237156 Bacteria 6402557
344 2514005506 2513237160 Bacteria 6650282
345 2514588488 2513237351 Bacteria 6968952
346 2515609458 2515154107 Bacteria 6795637
347 2516207379 2516143018 Bacteria 6951533
348 2516895571 2516653046 Bacteria 6989037
349 2517566466 2517487022 Bacteria 7227575
350 2524452801 2524023207 Bacteria 6813453
351 2551682194 2551306084 Bacteria 8942552
352 2551688745 2551306085 Bacteria 7347181
353 2551696906 2551306086 Bacteria 6843938
354 2551699503 2551306087 Bacteria 7351905
355 2551699629 2551306087 Bacteria 7351905
356 2551712048 2551306089 Bacteria 7162724
357 2551718454 2551306090 Bacteria 7953713
358 2551726461 2551306091 Bacteria 7086830
359 2551739194 2551306092 Bacteria 6992595
360 2551740810 2551306093 Bacteria 7064773
361 2558868001 2558860100 Bacteria 8458965
362 2657684131 2657244999 Bacteria 5946535
363 2692318505 2690316117 Bacteria 6800650
364 2776914847 2775507049 Bacteria 6284736
365 2792641051 2791355094 Bacteria 7011481
366 2802716558 2802428858 Bacteria 6636079
367 2802722404 2802428859 Bacteria 6667919
368 2802734320 2802428860 Bacteria 6525526
369 2802735847 2802428861 Bacteria 6534206
370 2802741579 2802428862 Bacteria 6633353
371 2802748020 2802428863 Bacteria 6410669
372 2804755931 2802429268 Bacteria 6094027
373 2838078589 2838074704 Bacteria 6785777
374 2847422994 2847417321 Bacteria 6913799
375 2848997603 2848992105 Bacteria 6810864
376 2850081139 2850079185 Bacteria 6848280
377 2855829615 2855825444 Bacteria 6785811
378 2855844711 2855839649 Bacteria 7135830
379 2855875368 2855872281 Bacteria 6964271
380 2858805826 2858800743 Bacteria 6603254
381 2899807199 2899803654 Bacteria 5577784
382 2913296318 2913295892 Bacteria 6333755
383 2915983454 2915980308 Bacteria 6624279
384 2915991874 2915986958 Bacteria 6739310
385 2915995633 2915993759 Bacteria 7016183
386 2916005184 2916000859 Bacteria 6865702
387 2916010751 2916007675 Bacteria 6898660
388 2916018081 2916014648 Bacteria 6946486
389 2916025299 2916021584 Bacteria 6854472
390 2916030064 2916028427 Bacteria 6748433
391 2916036897 2916035215 Bacteria 6755766
392 2916042967 2916041962 Bacteria 6820487
393 2916051593 2916048683 Bacteria 6543552
394 2916056648 2916055098 Bacteria 6758838
395 2916064708 2916061851 Bacteria 6737736
396 2916075379 2916068649 Bacteria 6943657
397 2916080824 2916076590 Bacteria 6596108
398 2921202753 2921201388 Bacteria 6926299
399 2921211450 2921208531 Bacteria 6745326
400 2921241113 2921237296 Bacteria 6876710
401 2921246449 2921244191 Bacteria 6568419
402 2921254621 2921250672 Bacteria 6677771
403 2921258502 2921257292 Bacteria 6808382
404 2921265800 2921263974 Bacteria 6864552
405 2921284240 2921282425 Bacteria 6826397
406 2921291119 2921289301 Bacteria 7316391
407 2921304355 2921296804 Bacteria 7176999
408 2924148997 2924144063 Bacteria 6883928
409 2924157702 2924150972 Bacteria 7169444
410 2924161963 2924158325 Bacteria 7188855
411 2924165800 2924165586 Bacteria 7260590
412 2924176746 2924172951 Bacteria 6749356
413 2924182386 2924179722 Bacteria 6843264
414 2924191031 2924186466 Bacteria 6876637
415 2924197835 2924193448 Bacteria 6955718
416 2924202172 2924200457 Bacteria 6757188
417 2924210913 2924207177 Bacteria 6917007
418 2924218701 2924214083 Bacteria 7080103
419 2924226314 2924221636 Bacteria 7113495
420 2924229503 2924228884 Bacteria 6633132
421 2936997060 2936996657 Bacteria 6298727
422 2937006725 2937002841 Bacteria 6934057
423 2937014798 2937009748 Bacteria 6746052
424 2937016424 2937016420 Bacteria 6782579
425 2937025425 2937023124 Bacteria 6815156
426 2937032790 2937029754 Bacteria 6424026
427 2937040818 2937036028 Bacteria 6846469
428 2937046314 2937042894 Bacteria 6741576
429 2937052843 2937049772 Bacteria 6757901
430 2937058049 2937056579 Bacteria 7107896
431 2937069098 2937063883 Bacteria 7199456
432 2937073507 2937071275 Bacteria 6984483
433 2937082228 2937078374 Bacteria 6610289
434 2937085669 2937084907 Bacteria 6618516
435 2937097824 2937091812 Bacteria 6979387
436 2937100993 2937098957 Bacteria 7249374
437 2937109385 2937106411 Bacteria 6947143
438 2937115057 2937113482 Bacteria 6505872
439 2937121726 2937119839 Bacteria 6597547
440 2937129863 2937126314 Bacteria 6771275
441 2957378684 2957375807 Bacteria 6425588
442 2957387844 2957382221 Bacteria 6737050
443 2957392511 2957388812 Bacteria 6778072
444 2957399291 2957395598 Bacteria 6822399
445 2957402312 2957402308 Bacteria 6741770
446 2957412438 2957408893 Bacteria 6558585
447 2957420080 2957415311 Bacteria 6991633
448 2957423763 2957422303 Bacteria 7172205
449 2957433545 2957430029 Bacteria 7022557
450 2957442801 2957437181 Bacteria 6568994
451 2957447617 2957443900 Bacteria 6869977
452 2957452599 2957450854 Bacteria 6765715
453 2957462102 2957457609 Bacteria 6967680
454 2957466905 2957464669 Bacteria 6568877
455 2957471623 2957471148 Bacteria 6797643
456 2957479553 2957478035 Bacteria 6756658
457 2957487399 2957484790 Bacteria 6703082
458 2957495556 2957491536 Bacteria 6695180
459 2957503137 2957498199 Bacteria 7126688
460 2957506669 2957505466 Bacteria 7253085
461 2960589457 2960584000 Bacteria 6864594
462 2960594908 2960591022 Bacteria 6622873
463 2960599760 2960597568 Bacteria 6550735
464 2960610333 2960603979 Bacteria 6898737
465 2960612518 2960610863 Bacteria 6691244
466 2960619620 2960617483 Bacteria 6727748
467 2960627195 2960624210 Bacteria 6875384
468 2960631158 2960631154 Bacteria 6732508
469 2960640255 2960637947 Bacteria 7296468
470 2960652110 2960645483 Bacteria 7211087
471 2960655859 2960652885 Bacteria 7083688
472 2960661747 2960660292 Bacteria 7041660
473 2960671810 2960667422 Bacteria 6763020
474 2960674275 2960674078 Bacteria 6609048
475 2960684615 2960680706 Bacteria 6624464
476 2960687650 2960687367 Bacteria 6535474
477 2960698714 2960693952 Bacteria 6749742
478 2964613963 2964607997 Bacteria 7101408
479 2964616684 2964615318 Bacteria 6809089
480 2964627776 2964621998 Bacteria 6834995
481 2964634954 2964628898 Bacteria 7083044
482 2964638174 2964636051 Bacteria 7091832
483 2964645634 2964643177 Bacteria 6820887
484 2964654937 2964649959 Bacteria 6675118
485 2964663534 2964656573 Bacteria 7100150
486 2964667768 2964663802 Bacteria 7019362
487 2964671218 2964670856 Bacteria 6851364
488 2964683173 2964678106 Bacteria 6792020
489 2964685123 2964685014 Bacteria 6839111
490 2964696675 2964691889 Bacteria 6802758
491 2964704438 2964698721 Bacteria 6765331
492 2964710296 2964705432 Bacteria 7114648
493 2964716777 2964712639 Bacteria 6695970
494 2964723939 2964719344 Bacteria 7286602
495 2967667204 2967664464 Bacteria 6948836
496 2967677492 2967671571 Bacteria 7021409
497 2967683218 2967678726 Bacteria 7264382
498 2967688652 2967686174 Bacteria 6678622
499 2967698125 2967693043 Bacteria 6804451
500 2967702403 2967699805 Bacteria 6854538
501 2967708029 2967706974 Bacteria 7186053
502 2967718792 2967714385 Bacteria 7000047
503 2967721866 2967721400 Bacteria 7073753
504 2967731232 2967728569 Bacteria 6641507
505 2967737608 2967735183 Bacteria 6827012
506 2967744058 2967742019 Bacteria 6794534
507 2967751129 2967748971 Bacteria 6733771
508 2967757610 2967755722 Bacteria 6814706
509 2967767720 2967762386 Bacteria 6923502
510 2967770975 2967769361 Bacteria 6587838
511 2967778764 2967775926 Bacteria 6738189
512 2970026339 2970019648 Bacteria 7072033
513 2970029995 2970026789 Bacteria 6785236
514 2970034371 2970033650 Bacteria 7118744
515 2970043819 2970040964 Bacteria 6731123
516 2970052108 2970047711 Bacteria 7088379
517 2970056411 2970054988 Bacteria 6611507
518 2970066494 2970061556 Bacteria 7099761
519 2970069892 2970068827 Bacteria 7123112
520 2970076418 2970076120 Bacteria 6697332
521 2970086963 2970082768 Bacteria 6183754
522 2970090712 2970088815 Bacteria 6933825
523 2970098592 2970095765 Bacteria 6936963
524 2970104633 2970102677 Bacteria 6812532
525 2970114289 2970109326 Bacteria 6863976
526 2970116507 2970116247 Bacteria 6501857
527 2970125384 2970122695 Bacteria 6625855
528 2970134130 2970129317 Bacteria 6806560
529 2970140024 2970136068 Bacteria 7207982
530 2970146620 2970143518 Bacteria 6446480
531 2970150339 2970149975 Bacteria 6779706
532 2970157985 2970156795 Bacteria 7168044
533 2970169059 2970164137 Bacteria 6861252
534 2970174110 2970170962 Bacteria 6876229
535 2970178113 2970177841 Bacteria 6768001
536 2970190670 2970184632 Bacteria 7054431
537 2970198797 2970191845 Bacteria 7032787
538 2977517129 2977516862 Bacteria 6940108
539 2977527501 2977523885 Bacteria 6960446
540 2977533950 2977530762 Bacteria 6951399
541 2977539472 2977537788 Bacteria 6929320
542 2977546691 2977544691 Bacteria 6875412
543 2977552341 2977551784 Bacteria 7125765
544 2977563224 2977558990 Bacteria 6863948
545 2977569582 2977565890 Bacteria 6901543
546 2977573883 2977572785 Bacteria 6763888
547 2977582925 2977579622 Bacteria 6772100
548 648739070 648276728 Bacteria 6968865
549 8003997240 8003992118 Bacteria 7266902
550 8004004939 8003999396 Bacteria 7063185
551 Ga0068869_100019540
552 Ga0068869_101953898
553 Ga0070680_100013983
554 Ga0070691_10092506
555 Ga0070703_10001371
556 Ga0070709_10000728
557 Ga0070714_100087289
558 Ga0070714_101980146
559 Ga0070710_10003264
560 Ga0070701_10018412
561 Ga0070711_100001618
562 Ga0070705_100001671
563 Ga0070700_100000273
564 Ga0070708_100003020
565 Ga0070663_100048429
566 Ga0070706_100062805
567 Ga0070707_101213788
568 Ga0070699_100000473
569 Ga0070679_101647164
570 Ga0070697_100059154
571 Ga0068853_100863994
572 Ga0068853_101458118
573 Ga0070695_100007776
574 Ga0070696_100000229
575 Ga0070693_100011151
576 Ga0070704_100001299
577 Ga0068855_100991527
578 Ga0068857_100018549
579 Ga0068854_100255008
580 Ga0068859_100003426
581 Ga0068864_100044889
582 Ga0068861_100147627
583 Ga0068858_100034612
584 Ga0068860_100012226
585 Ga0068862_100018912
586 Ga0068862_101040574
587 Ga0081455_10000834
588 Ga0081455_10130999
589 Ga0081540_1000578
590 Ga0081540_1051652
591 Ga0081540_1117996
592 Ga0081539_10503017
593 Ga0070717_10158241
594 Ga0070715_10017630
595 Ga0070715_10018666
596 Ga0070716_100011340
597 Ga0068871_100728250
598 Ga0075428_100002743
599 Ga0075430_100012065
600 Ga0075431_100002326
601 Ga0075431_100021363
602 Ga0075431_100605409
603 Ga0075433_10011909
604 Ga0075433_10032152
605 Ga0075434_100000792
606 Ga0075434_100005353
607 Ga0075429_100085065
608 Ga0075429_100249539
609 Ga0075429_100259154
610 Ga0075429_100268985
611 Ga0075429_100669198
612 Ga0075436_100181531
613 Ga0075436_100461843
614 Ga0097620_100003426
615 Ga0079104_1041921
616 Ga0079104_1060679
617 Ga0079104_1081317
618 Ga0099826_10188207
619 Ga0075435_100129356
620 Ga0099795_10089417
621 Ga0111539_10000292
622 Ga0111539_10039891
623 Ga0111539_10534180
624 Ga0111539_10574718
625 Ga0111539_11134498
626 Ga0114129_10000098
627 Ga0114129_10218127
628 Ga0114129_10375444
629 Ga0114129_10760633
630 Ga0105243_10078278
631 Ga0105237_10216103
632 Ga0105249_10019769
633 Ga0105249_11998550
634 Ga0105249_13372048
635 Ga0105239_10238977
636 Ga0105246_10104248
637 Ga0157371_11221594
638 Ga0157378_10136092
639 Ga0157378_11791091
640 Ga0157375_13665510
641 Ga0157380_10550888
642 Ga0157379_10273784
643 Ga0157379_10653628
644 Ga0214542_1020080
645 Ga0214543_1000078
646 Ga0213873_10008825
647 Ga0228711_1006166
648 Ga0228710_1003077
649 Ga0228710_1042807
650 Ga0207653_10000931
651 Ga0207692_10215326
652 Ga0207685_10056578
653 Ga0207699_10090157
654 Ga0207663_10434912
655 Ga0207660_10066467
656 Ga0207646_10931854
657 Ga0207659_10660116
658 Ga0207664_10079577
659 Ga0207706_10050026
660 Ga0207709_10152832
661 Ga0207665_10010554
662 Ga0207689_10020616
663 Ga0207679_10149386
664 Ga0207679_10732648
665 Ga0207712_10002402
666 Ga0207712_11314945
667 Ga0207640_10871283
668 Ga0207658_12175706
669 Ga0207639_10793864
670 Ga0207678_10007341
671 Ga0207708_10000819
672 Ga0207708_10141173
673 Ga0207641_11066518
674 Ga0207676_10059188
675 Ga0207674_10000240
676 Ga0207675_100120614
677 Ga0207683_10811343
678 Ga0209281_1000132
679 Ga0209281_1002085
680 Ga0209281_1053261
681 Ga0209282_1000018
682 Ga0207428_10094193
683 Ga0207428_10218317
684 Ga0207428_10407241
685 Ga0207428_10686995
686 Ga0268265_10001328
687 Ga0268265_10788559
688 Ga0268264_10153237
689 Ga0265326_10032202
690 Ga0307408_101041508
691 Ga0307408_101303809
692 Ga0307413_11585035
693 Ga0307410_10525221
694 Ga0307410_11418015
695 Ga0307406_10318091
696 Ga0307412_10067799
697 Ga0307412_10404882
698 Ga0315914_1000362
699 Ga0307414_10608505
700 Ga0315913_1000078
701 Ga0315915_1000006
702 Ga0373948_0058654
703 Ga0373950_0056801
704 Ga0373958_0007775
705 Ga0373938_0031508
706 Ga0373938_0193333
707 Ga0373928_0132899
708 Ga0373940_0118164
709 Ga0373940_0205447
710 Ga0373949_0026803
711 Ga0373952_0124921
712 Ga0373923_0673172
713 Ga0373932_0032456
714 Ga0373939_0086537
715 Ga0373939_0116458
716 Ga0373941_0068374
717 Ga0373960_0017494
718 Ga0373946_0326734
719 Ga0373942_0006020
720 Ga0373961_0007961
721 Ga0373962_0039560
722 Ga0373962_0238833
723 Ga0373931_0007882
724 Ga0373931_0084744
725 Ga0373935_0048884
726 Ga0373935_0798560
727 Ga0373927_0036723
728 Ga0373927_0474186
729 Ga0373925_0033784
730 Ga0373925_0050654
731 Ga0373925_1649945
732 Ga0436364_0556056
733 Ga0436365_0797309
734 Ga0436363_1504040
735 Ga0436362_0788143
736 Ga0436362_1176438
737 Ga0439436_0101426
738 Ga0439449_0029133
739 Ga0439449_0086482
740 Ga0439462_0063021
741 Ga0466968_0035804
742 Ga0466957_0633506
743 Ga0495603_0713992
744 Ga0495638_0059302
745 Ga0495584_0010782
746 Ga0495584_0111522
747 Ga0495584_0133905
748 Ga0495630_0432735
749 Ga0495630_1280715
750 Ga0495637_0248505
751 Ga0495665_0204861
752 Ga0495640_0568434
753 Ga0495609_0395887
754 Ga0495621_0271217
755 Ga0495667_0787154
756 Ga0495668_0311025
757 Ga0495661_0341976
758 Ga0495647_0026183
759 Ga0495658_0010571
760 Ga0495613_0559779
761 Ga0495624_0618774
762 Ga0495636_0645107
763 Ga0495674_0120258
764 Ga0495672_0049507
765 Ga0496100_0046697
766 Ga0496100_0285142
767 Ga0496100_0871173
768 Ga0496101_0040028
769 Ga0496102_0035454
770 Ga0496102_1352985
771 Ga0496103_0053222
772 Ga0496104_0008413
773 Ga0496104_0248413
774 Ga0496104_0597689
775 Ga0496104_1005378
776 Ga0496105_0010541
777 Ga0496105_0010622
778 Ga0496105_0183870
779 Ga0496105_0391366
780 Ga0496106_0002221
781 Ga0496107_0057246
782 Ga0496108_0440931
783 Ga0496108_0735128
784 Ga0496109_0309139
785 Ga0496109_0694305
786 Ga0496110_0026559
787 Ga0496110_0122623
788 Ga0496110_0173640
789 Ga0496111_0078127
790 Ga0496112_0324197
791 Ga0496112_1764934
792 Ga0496113_0022063
793 Ga0496114_0216858
794 Ga0496114_0307155
795 Ga0496115_0066625
796 Ga0496115_0143606
797 Ga0496115_0613790
798 Ga0496115_0903870
799 Ga0496119_0002394
800 Ga0496119_0343679
801 Ga0496121_0720420
802 Ga0496123_0037995
803 Ga0496125_0111386
804 Ga0496126_0311082
805 Ga0501036_0127086
806 Ga0501036_0237370
807 Ga0501038_0510585
808 Ga0501038_0913069
809 Ga0501039_0219989
810 Ga0501040_0036575
811 Ga0501040_1203820
812 Ga0501041_0143733
813 Ga0501041_0402492
814 Ga0501041_0450234
815 Ga0501041_1065882
816 Ga0501042_0123266
817 Ga0501042_0478358
818 Ga0501042_0573679
819 Ga0501042_1058572
820 Ga0501046_0129451
821 Ga0501048_0746449
822 Ga0501070_0838895
823 Ga0501071_0270089
824 Ga0501071_0572953
825 Ga0501072_0715635
826 Ga0501072_0962334
827 Ga0501075_0690356
828 Ga0501075_0737024
829 Ga0501076_0049740
830 Ga0501076_0370898
831 Ga0501076_1283417
832 Ga0501077_0157376
833 Ga0501079_0133640
834 Ga0501081_0092377
835 Ga0501081_0240314
836 Ga0501081_0305448
837 Ga0501081_0745590
838 Ga0501045_0033534
839 Ga0501045_1100937
840 nmdc:mga05p37_194918_c2
841 nmdc:mga05p37_46_c1
842 nmdc:mga05p37_491466_c1
843 nmdc:mga05p37_616844_c1
844 nmdc:mga05p37_98597_c1
845 nmdc:mga09592_13760_c1
846 nmdc:mga0qj67_10285_c1
847 nmdc:mga06r32_103910_c1
848 nmdc:mga06r32_1530783_c1
849 nmdc:mga06r32_237309_c1
850 nmdc:mga06r32_73_c1
851 nmdc:mga06r32_913375_c1
852 nmdc:mga06r32_969201_c1
853 nmdc:mga08y16_610773_c1
854 nmdc:mga08y16_816_c1
855 nmdc:mga08y16_845391_c1
856 nmdc:mga0n895_1244_c1
857 nmdc:mga0n895_7171_c1
858 nmdc:mga0rr50_146564_c1
859 nmdc:mga08x19_311494_c1
860 nmdc:mga08x19_393689_c1
861 nmdc:mga0a205_247045_c1
862 nmdc:mga0a205_6482_c1
863 nmdc:mga0a205_72638_c1
864 nmdc:mga0sz30_23559_c2
865 Ga0495595_0723122
866 Ga0500556_0000344
867 Ga0500642_0094698
868 Ga0500652_162952
869 Ga0500568_0000342
870 Ga0500616_0127078
871 Ga0500645_028874
872 Ga0501084_0219561
873 Ga0501084_0292498
874 Ga0501084_0478408
875 Ga0501082_0195700
876 Ga0501082_0474898
877 Ga0501082_0575364
878 Ga0501082_0634728
879 Ga0501082_1561234
880 Ga0530510_0130575
881 Ga0530510_0184243
882 2513590168
883 2509111366
884 2509375685
885 2510308460
886 2511497201
887 2512970135
888 2513582192
889 2513607213
890 2513617752
891 2513881410
892 2513901099
893 2513985616
894 2514005506
895 2514588488
896 2515609458
897 2516207379
898 2516895571
899 2517566466
900 2524452801
901 2551682194
902 2551688745
903 2551696906
904 2551699503
905 2551699629
906 2551712048
907 2551718454
908 2551726461
909 2551739194
910 2551740810
911 2558868001
912 2657684131
913 2692318505
914 2776914847
915 2792641051
916 2802716558
917 2802722404
918 2802734320
919 2802735847
920 2802741579
921 2802748020
922 2804755931
923 2838078589
924 2847422994
925 2848997603
926 2850081139
927 2855829615
928 2855844711
929 2855875368
930 2858805826
931 2899807199
932 2913296318
933 2915983454
934 2915991874
935 2915995633
936 2916005184
937 2916010751
938 2916018081
939 2916025299
940 2916030064
941 2916036897
942 2916042967
943 2916051593
944 2916056648
945 2916064708
946 2916075379
947 2916080824
948 2921202753
949 2921211450
950 2921241113
951 2921246449
952 2921254621
953 2921258502
954 2921265800
955 2921284240
956 2921291119
957 2921304355
958 2924148997
959 2924157702
960 2924161963
961 2924165800
962 2924176746
963 2924182386
964 2924191031
965 2924197835
966 2924202172
967 2924210913
968 2924218701
969 2924226314
970 2924229503
971 2936997060
972 2937006725
973 2937014798
974 2937016424
975 2937025425
976 2937032790
977 2937040818
978 2937046314
979 2937052843
980 2937058049
981 2937069098
982 2937073507
983 2937082228
984 2937085669
985 2937097824
986 2937100993
987 2937109385
988 2937115057
989 2937121726
990 2937129863
991 2957378684
992 2957387844
993 2957392511
994 2957399291
995 2957402312
996 2957412438
997 2957420080
998 2957423763
999 2957433545
1000 2957442801
1001 2957447617
1002 2957452599
1003 2957462102
1004 2957466905
1005 2957471623
1006 2957479553
1007 2957487399
1008 2957495556
1009 2957503137
1010 2957506669
1011 2960589457
1012 2960594908
1013 2960599760
1014 2960610333
1015 2960612518
1016 2960619620
1017 2960627195
1018 2960631158
1019 2960640255
1020 2960652110
1021 2960655859
1022 2960661747
1023 2960671810
1024 2960674275
1025 2960684615
1026 2960687650
1027 2960698714
1028 2964613963
1029 2964616684
1030 2964627776
1031 2964634954
1032 2964638174
1033 2964645634
1034 2964654937
1035 2964663534
1036 2964667768
1037 2964671218
1038 2964683173
1039 2964685123
1040 2964696675
1041 2964704438
1042 2964710296
1043 2964716777
1044 2964723939
1045 2967667204
1046 2967677492
1047 2967683218
1048 2967688652
1049 2967698125
1050 2967702403
1051 2967708029
1052 2967718792
1053 2967721866
1054 2967731232
1055 2967737608
1056 2967744058
1057 2967751129
1058 2967757610
1059 2967767720
1060 2967770975
1061 2967778764
1062 2970026339
1063 2970029995
1064 2970034371
1065 2970043819
1066 2970052108
1067 2970056411
1068 2970066494
1069 2970069892
1070 2970076418
1071 2970086963
1072 2970090712
1073 2970098592
1074 2970104633
1075 2970114289
1076 2970116507
1077 2970125384
1078 2970134130
1079 2970140024
1080 2970146620
1081 2970150339
1082 2970157985
1083 2970169059
1084 2970174110
1085 2970178113
1086 2970190670
1087 2970198797
1088 2977517129
1089 2977527501
1090 2977533950
1091 2977539472
1092 2977546691
1093 2977552341
1094 2977563224
1095 2977569582
1096 2977573883
1097 2977582925
1098 648739070
1099 8003997240
1100 8004004939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zkr-assembly1.cif.gz_B crystal structure of the major cat allergen fel d 1 (1+2) 0.4402 37 114
5a9z-assembly1.cif.gz_AY complex of thermous thermophilus ribosome bound to bipa-gdpcp 0.42 61 116
5nmo-assembly1.cif.gz_B structure of the bacillus subtilis smc joint domain 0.4176 35 114
2mtq-assembly1.cif.gz_A solution structure of a de novo designed peptide that sequesters toxic heavy metals 0.4074 37 116
2j1o-assembly1.cif.gz_A-2 geranylgeranyl diphosphate synthase from sinapis alba 0.4047 37 114
ID Description Score Start End Superfamily
af_Q6DGU5_174_403_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.5335 53 115 1.50.40.10
af_Q2MHK8_4_319_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5036 53 115 1.20.1070.10
af_Q8R298_16_321_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5036 53 115 1.20.1070.10
af_A0A0N5E8A1_27_231_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.4817 34 87 1.20.144.10
af_Q9VXK8_38_378_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4672 24 117 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A444MBV0-F1-model_v4 Uncharacterized protein 0.9502 24 118
AF-A0A2M7YD82-F1-model_v4 Uncharacterized protein 0.9439 24 118
AF-F8JBN9-F1-model_v4 Uncharacterized protein 0.9352 24 118
AF-A0A2N8M9C6-F1-model_v4 Uncharacterized protein 0.9344 24 118
AF-A0A2S3UKV7-F1-model_v4 Uncharacterized protein 0.9337 24 118

Map