F462519

General Info

Members Datasets Scaffolds Average Seq Length
550 306 1100 78

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0240591|Ga0395899_0240591_71_358
Length 95
Sequence MVLALEHGKVEFQSYDSAMPTEPLQALLEQAFPDATEVSVVDRTGGGDHFQVTVASARFQGLSLVDQHRLVYEALSAPLADGSIHELRIKTKGTP

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
64 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
156 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
159 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 8.73
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0240591 3300037312 Bacteria 1246
2 Ga0070658_10087667 3300005327 Bacteria 2562
3 Ga0070658_11017575 3300005327 Bacteria 721
4 Ga0070683_100015515 3300005329 Bacteria 6695
5 Ga0070683_100045822 3300005329 Bacteria 4037
6 Ga0070683_100198020 3300005329 Bacteria 1908
7 Ga0070683_100395733 3300005329 Bacteria 1317
8 Ga0070682_100657609 3300005337 Bacteria 835
9 Ga0068868_100668347 3300005338 Bacteria 926
10 Ga0070660_100017491 3300005339 Bacteria 5228
11 Ga0070674_100238403 3300005356 Bacteria 1423
12 Ga0070659_101878442 3300005366 Unclassified 537
13 Ga0070709_10017895 3300005434 Bacteria 4071
14 Ga0070709_10772854 3300005434 Bacteria 752
15 Ga0070714_100409847 3300005435 Bacteria 1282
16 Ga0070713_101700164 3300005436 Bacteria 612
17 Ga0070701_10559948 3300005438 Bacteria 751
18 Ga0070711_100695776 3300005439 Bacteria 855
19 Ga0070711_100719733 3300005439 Bacteria 841
20 Ga0070708_101899474 3300005445 Bacteria 552
21 Ga0070663_100147972 3300005455 Bacteria 1798
22 Ga0070678_100143087 3300005456 Bacteria 1916
23 Ga0070662_100672232 3300005457 Bacteria 875
24 Ga0070662_101463640 3300005457 Unclassified 589
25 Ga0070681_10023346 3300005458 Bacteria 6219
26 Ga0068867_100248762 3300005459 Bacteria 1445
27 Ga0068867_100355336 3300005459 Bacteria 1224
28 Ga0070706_100118665 3300005467 Bacteria 2465
29 Ga0070706_100201402 3300005467 Bacteria 1859
30 Ga0070707_100837639 3300005468 Bacteria 884
31 Ga0070707_101973421 3300005468 Bacteria 551
32 Ga0070698_100305002 3300005471 Bacteria 1523
33 Ga0070699_100160571 3300005518 Bacteria 1989
34 Ga0070679_100040623 3300005530 Bacteria 4628
35 Ga0070679_101231167 3300005530 Bacteria 694
36 Ga0070684_100008993 3300005535 Bacteria 7848
37 Ga0070684_100009770 3300005535 Bacteria 7575
38 Ga0070684_100012986 3300005535 Bacteria 6699
39 Ga0070684_100060952 3300005535 Bacteria 3301
40 Ga0070672_100661491 3300005543 Bacteria 913
41 Ga0070686_100092266 3300005544 Bacteria 2028
42 Ga0070704_100596936 3300005549 Unclassified 970
43 Ga0070704_101051444 3300005549 Bacteria 738
44 Ga0068855_101712459 3300005563 Bacteria 641
45 Ga0070664_100204612 3300005564 Bacteria 1762
46 Ga0070664_100835004 3300005564 Bacteria 862
47 Ga0070664_102380366 3300005564 Bacteria 502
48 Ga0068857_100010331 3300005577 Bacteria 8110
49 Ga0068857_100019586 3300005577 Bacteria 5944
50 Ga0068854_100806004 3300005578 Bacteria 819
51 Ga0068856_100193144 3300005614 Bacteria 2049
52 Ga0070702_100493288 3300005615 Bacteria 898
53 Ga0068861_100226597 3300005719 Bacteria 1583
54 Ga0068862_101259431 3300005844 Unclassified 740
55 Ga0081455_10038590 3300005937 Bacteria 4228
56 Ga0081455_10052565 3300005937 Bacteria 3486
57 Ga0081455_10154025 3300005937 Bacteria 1769
58 Ga0081540_1003040 3300005983 Bacteria 13438
59 Ga0070717_10117915 3300006028 Bacteria 2271
60 Ga0070717_10216088 3300006028 Bacteria 1684
61 Ga0070717_12119742 3300006028 Bacteria 506
62 Ga0075364_10462344 3300006051 Bacteria 867
63 Ga0075432_10036241 3300006058 Bacteria 1714
64 Ga0070715_10005055 3300006163 Bacteria 4374
65 Ga0070712_100409497 3300006175 Bacteria 1121
66 Ga0075428_100235737 3300006844 Bacteria 1974
67 Ga0075428_100404781 3300006844 Bacteria 1462
68 Ga0075428_100599993 3300006844 Bacteria 1176
69 Ga0075430_100032997 3300006846 Bacteria 4394
70 Ga0075431_100061514 3300006847 Bacteria 3874
71 Ga0075431_100207632 3300006847 Bacteria 2002
72 Ga0075431_101518318 3300006847 Bacteria 628
73 Ga0075433_10110150 3300006852 Bacteria 2443
74 Ga0075433_10204458 3300006852 Bacteria 1755
75 Ga0075433_10388230 3300006852 Bacteria 1232
76 Ga0075434_100079856 3300006871 Bacteria 3268
77 Ga0075434_100384317 3300006871 Unclassified 1425
78 Ga0075434_100777560 3300006871 Bacteria 974
79 Ga0075434_100908203 3300006871 Bacteria 895
80 Ga0075429_100580892 3300006880 Bacteria 982
81 Ga0075429_101852346 3300006880 Unclassified 523
82 Ga0068865_100047832 3300006881 Bacteria 2941
83 Ga0075436_100084246 3300006914 Bacteria 2206
84 Ga0075435_100005187 3300007076 Bacteria 9062
85 Ga0075435_100050817 3300007076 Bacteria 3337
86 Ga0075435_100248240 3300007076 Unclassified 1515
87 Ga0075435_100467436 3300007076 Bacteria 1089
88 Ga0075435_100487481 3300007076 Bacteria 1065
89 Ga0111539_10023141 3300009094 Bacteria 7630
90 Ga0111539_10101809 3300009094 Bacteria 3372
91 Ga0111539_10259783 3300009094 Bacteria 2022
92 Ga0111539_10607938 3300009094 Unclassified 1273
93 Ga0111539_10952905 3300009094 Unclassified 998
94 Ga0105245_10309450 3300009098 Bacteria 1553
95 Ga0105245_11185071 3300009098 Bacteria 811
96 Ga0105245_11750514 3300009098 Unclassified 674
97 Ga0114129_10082990 3300009147 Bacteria 4453
98 Ga0114129_10180117 3300009147 Bacteria 2876
99 Ga0114129_10713696 3300009147 Bacteria 1287
100 Ga0114129_11490256 3300009147 Unclassified 832
101 Ga0114129_12213571 3300009147 Bacteria 661
102 Ga0114129_13348819 3300009147 Bacteria 517
103 Ga0105243_10505730 3300009148 Bacteria 1146
104 Ga0105241_10490765 3300009174 Bacteria 1093
105 Ga0105242_10304093 3300009176 Bacteria 1457
106 Ga0105237_11147742 3300009545 Bacteria 784
107 Ga0105238_12818915 3300009551 Bacteria 522
108 Ga0105249_10511266 3300009553 Bacteria 1247
109 Ga0105239_10555505 3300010375 Bacteria 1308
110 Ga0157345_1026058 3300012498 Bacteria 627
111 Ga0157345_1051985 3300012498 Unclassified 524
112 Ga0157342_1014947 3300012507 Bacteria 845
113 Ga0157373_10208218 3300013100 Bacteria 1379
114 Ga0157373_10210799 3300013100 Bacteria 1370
115 Ga0157370_11397071 3300013104 Unclassified 630
116 Ga0157374_10522726 3300013296 Bacteria 1193
117 Ga0157374_11122415 3300013296 Bacteria 807
118 Ga0157378_11332790 3300013297 Bacteria 759
119 Ga0157378_12726342 3300013297 Bacteria 547
120 Ga0163162_10247102 3300013306 Bacteria 1916
121 Ga0163163_10177306 3300014325 Unclassified 2178
122 Ga0157380_10941989 3300014326 Bacteria 893
123 Ga0157376_10116016 3300014969 Bacteria 2365
124 Ga0157376_11898435 3300014969 Bacteria 632
125 Ga0163161_10397118 3300017792 Bacteria 1105
126 Ga0206356_11640548 3300020070 Bacteria 792
127 Ga0206354_10790831 3300020081 Bacteria 704
128 Ga0206353_10194736 3300020082 Bacteria 819
129 Ga0213876_10710509 3300021384 Bacteria 535
130 Ga0207692_10495575 3300025898 Bacteria 775
131 Ga0207685_10035688 3300025905 Bacteria 1816
132 Ga0207685_10320747 3300025905 Bacteria 773
133 Ga0207699_10233250 3300025906 Bacteria 1261
134 Ga0207699_10552562 3300025906 Bacteria 835
135 Ga0207705_10521201 3300025909 Bacteria 923
136 Ga0207684_10101301 3300025910 Bacteria 2462
137 Ga0207707_10050911 3300025912 Bacteria 3606
138 Ga0207693_10064591 3300025915 Bacteria 2867
139 Ga0207693_10065933 3300025915 Bacteria 2835
140 Ga0207693_10269388 3300025915 Bacteria 1335
141 Ga0207663_10027714 3300025916 Bacteria 3306
142 Ga0207663_10049700 3300025916 Bacteria 2603
143 Ga0207663_10186734 3300025916 Bacteria 1485
144 Ga0207657_10041323 3300025919 Bacteria 4078
145 Ga0207652_10131356 3300025921 Bacteria 2234
146 Ga0207646_10290026 3300025922 Bacteria 1479
147 Ga0207646_11073338 3300025922 Bacteria 709
148 Ga0207681_11104889 3300025923 Bacteria 666
149 Ga0207687_10484761 3300025927 Bacteria 1030
150 Ga0207687_11505043 3300025927 Unclassified 578
151 Ga0207700_10368184 3300025928 Bacteria 1254
152 Ga0207700_11395127 3300025928 Bacteria 623
153 Ga0207664_10025419 3300025929 Bacteria 4461
154 Ga0207664_10198100 3300025929 Bacteria 1732
155 Ga0207664_11942992 3300025929 Bacteria 511
156 Ga0207706_10275251 3300025933 Unclassified 1469
157 Ga0207706_11271795 3300025933 Unclassified 609
158 Ga0207686_10882521 3300025934 Bacteria 721
159 Ga0207709_10073375 3300025935 Bacteria 2180
160 Ga0207709_10111904 3300025935 Bacteria 1827
161 Ga0207669_10742066 3300025937 Bacteria 810
162 Ga0207704_10118712 3300025938 Unclassified 1805
163 Ga0207665_10685274 3300025939 Bacteria 805
164 Ga0207661_10066450 3300025944 Bacteria 2929
165 Ga0207661_10513794 3300025944 Bacteria 1095
166 Ga0207661_10648803 3300025944 Bacteria 970
167 Ga0207661_11584114 3300025944 Unclassified 599
168 Ga0207679_10136111 3300025945 Bacteria 1978
169 Ga0207679_10856077 3300025945 Bacteria 830
170 Ga0207651_11755808 3300025960 Bacteria 559
171 Ga0207712_10378446 3300025961 Bacteria 1184
172 Ga0207678_10196544 3300026067 Bacteria 1724
173 Ga0207702_10701461 3300026078 Bacteria 997
174 Ga0207702_10779745 3300026078 Bacteria 944
175 Ga0207702_11746738 3300026078 Unclassified 615
176 Ga0207648_10223623 3300026089 Bacteria 1673
177 Ga0207674_10020150 3300026116 Bacteria 7212
178 Ga0207674_10034052 3300026116 Bacteria 5327
179 Ga0207675_100052212 3300026118 Bacteria 3815
180 Ga0209966_1046847 3300027695 Unclassified 913
181 Ga0209998_10018089 3300027717 Bacteria 1494
182 Ga0207428_10024080 3300027907 Bacteria 5112
183 Ga0207428_10037296 3300027907 Bacteria 3955
184 Ga0207428_10137844 3300027907 Bacteria 1865
185 Ga0265334_10146427 3300028573 Bacteria 834
186 Ga0265323_10257472 3300028653 Bacteria 542
187 Ga0265322_10098720 3300028654 Bacteria 830
188 Ga0265336_10133143 3300028666 Bacteria 740
189 Ga0265338_10018383 3300028800 Bacteria 7484
190 Ga0265324_10126475 3300029957 Bacteria 868
191 Ga0265330_10038951 3300031235 Bacteria 2113
192 Ga0265325_10010258 3300031241 Bacteria 5435
193 Ga0265329_10042343 3300031242 Bacteria 1459
194 Ga0265340_10120174 3300031247 Bacteria 1209
195 Ga0265339_10221833 3300031249 Bacteria 924
196 Ga0265327_10004284 3300031251 Bacteria 12759
197 Ga0265316_10010315 3300031344 Bacteria 8522
198 Ga0307408_100339306 3300031548 Bacteria 1271
199 Ga0265313_10009194 3300031595 Bacteria 6444
200 Ga0265314_10007017 3300031711 Bacteria 9842
201 Ga0265342_10173280 3300031712 Bacteria 1185
202 Ga0307405_10097873 3300031731 Bacteria 1960
203 Ga0307405_10516735 3300031731 Unclassified 960
204 Ga0307405_11742758 3300031731 Bacteria 553
205 Ga0307413_10754469 3300031824 Unclassified 814
206 Ga0307410_10633519 3300031852 Unclassified 895
207 Ga0307410_11304527 3300031852 Bacteria 635
208 Ga0307406_10198787 3300031901 Bacteria 1474
209 Ga0307406_11031741 3300031901 Bacteria 707
210 Ga0307412_10440754 3300031911 Bacteria 1070
211 Ga0307409_100266527 3300031995 Bacteria 1575
212 Ga0307409_100656592 3300031995 Unclassified 1043
213 Ga0307409_101000053 3300031995 Unclassified 854
214 Ga0307416_100038804 3300032002 Bacteria 3678
215 Ga0307416_100633483 3300032002 Bacteria 1152
216 Ga0307416_100661222 3300032002 Unclassified 1130
217 Ga0307415_100147699 3300032126 Bacteria 1805
218 Ga0373926_0033915 3300035083 Bacteria 1806
219 Ga0373944_0230545 3300035089 Bacteria 678
220 Ga0373936_0043801 3300035113 Bacteria 1799
221 Ga0373945_0008401 3300035116 Bacteria 3363
222 Ga0373943_0110303 3300035170 Bacteria 1450
223 Ga0373943_0121639 3300035170 Bacteria 1387
224 Ga0373946_0000490 3300035171 Bacteria 13102
225 Ga0373955_0271789 3300035172 Bacteria 1019
226 Ga0373931_0162682 3300035691 Bacteria 1309
227 Ga0373931_0287196 3300035691 Bacteria 1012
228 Ga0373935_0001745 3300035692 Bacteria 12199
229 Ga0373935_0058512 3300035692 Bacteria 2462
230 Ga0373927_0345162 3300035695 Bacteria 981
231 Ga0373947_0002987 3300035725 Bacteria 10092
232 Ga0373947_0010822 3300035725 Bacteria 5235
233 Ga0373947_0492097 3300035725 Unclassified 833
234 Ga0373937_1934379 3300036401 Bacteria 536
235 Ga0373925_0046465 3300037068 Bacteria 3228
236 Ga0373925_0141776 3300037068 Bacteria 1881
237 Ga0395899_0029051 3300037312 Bacteria 4159
238 Ga0395899_0071181 3300037312 Bacteria 2545
239 Ga0395899_0330700 3300037312 Bacteria 1024
240 Ga0395899_0375319 3300037312 Bacteria 946
241 Ga0395899_0439668 3300037312 Unclassified 856
242 Ga0395899_0822269 3300037312 Bacteria 572
243 Ga0395900_0006111 3300037418 Bacteria 12557
244 Ga0395900_0040559 3300037418 Bacteria 4797
245 Ga0395900_0098964 3300037418 Unclassified 2996
246 Ga0395900_0099378 3300037418 Bacteria 2989
247 Ga0395900_0101635 3300037418 Bacteria 2953
248 Ga0395900_0198246 3300037418 Bacteria 2033
249 Ga0395900_0499243 3300037418 Bacteria 1167
250 Ga0395900_0568235 3300037418 Unclassified 1077
251 Ga0395900_0571317 3300037418 Bacteria 1073
252 Ga0395900_0849278 3300037418 Unclassified 839
253 Ga0395898_0005052 3300037466 Bacteria 14303
254 Ga0395898_0082338 3300037466 Bacteria 3102
255 Ga0395898_0094852 3300037466 Bacteria 2867
256 Ga0395898_0117726 3300037466 Bacteria 2545
257 Ga0395898_0176138 3300037466 Bacteria 2044
258 Ga0395898_0294097 3300037466 Bacteria 1549
259 Ga0395898_0497837 3300037466 Bacteria 1159
260 Ga0395898_0613786 3300037466 Bacteria 1030
261 Ga0395898_0741881 3300037466 Bacteria 923
262 Ga0395898_0810223 3300037466 Unclassified 876
263 Ga0395898_1257321 3300037466 Bacteria 670
264 Ga0395905_0012175 3300037471 Bacteria 8284
265 Ga0395905_0017272 3300037471 Bacteria 6854
266 Ga0395905_0024793 3300037471 Bacteria 5660
267 Ga0395905_0132962 3300037471 Bacteria 2340
268 Ga0395905_0200189 3300037471 Bacteria 1872
269 Ga0395905_0377308 3300037471 Bacteria 1312
270 Ga0395905_0399402 3300037471 Archaea 1269
271 Ga0395905_0555679 3300037471 Bacteria 1049
272 Ga0395905_0560564 3300037471 Unclassified 1044
273 Ga0395905_0571660 3300037471 Bacteria 1032
274 Ga0395905_0684713 3300037471 Bacteria 928
275 Ga0436364_0128800 3300037853 Bacteria 653
276 Ga0395901_0002473 3300038443 Bacteria 18746
277 Ga0395901_0006469 3300038443 Bacteria 11866
278 Ga0395901_0018774 3300038443 Bacteria 7065
279 Ga0395901_0027774 3300038443 Bacteria 5819
280 Ga0395901_0050767 3300038443 Bacteria 4308
281 Ga0395901_0341281 3300038443 Bacteria 1547
282 Ga0395901_0358899 3300038443 Unclassified 1503
283 Ga0395901_0376161 3300038443 Archaea 1462
284 Ga0395901_0409271 3300038443 Bacteria 1393
285 Ga0395901_0454875 3300038443 Bacteria 1309
286 Ga0395901_1382059 3300038443 Bacteria 663
287 Ga0436363_0200933 3300039450 Bacteria 1154
288 Ga0436363_1496836 3300039450 Bacteria 544
289 Ga0451789_0192847 3300041443 Bacteria 778
290 Ga0451791_0593328 3300041451 Bacteria 541
291 Ga0451804_0719484 3300041463 Bacteria 829
292 Ga0451804_0913404 3300041463 Bacteria 564
293 Ga0451845_0056164 3300041501 Bacteria 792
294 Ga0451851_0010059 3300041507 Unclassified 568
295 Ga0451853_0084396 3300041512 Bacteria 1682
296 Ga0439455_0029753 3300042012 Bacteria 1351
297 Ga0439463_034343 3300042016 Bacteria 1283
298 Ga0439460_0028145 3300042461 Bacteria 1584
299 Ga0466969_0417797 3300044656 Bacteria 609
300 Ga0466972_0320646 3300044658 Bacteria 724
301 Ga0466965_0662063 3300044683 Bacteria 597
302 Ga0466961_0009123 3300044693 Bacteria 6317
303 Ga0466963_0024538 3300044694 Bacteria 3839
304 Ga0466963_0501926 3300044694 Bacteria 856
305 Ga0466964_0053086 3300044706 Bacteria 1668
306 Ga0466964_0208486 3300044706 Bacteria 943
307 Ga0466964_0232538 3300044706 Bacteria 900
308 Ga0466971_0030551 3300044719 Bacteria 2411
309 Ga0466968_0600561 3300044735 Bacteria 556
310 Ga0466957_0896938 3300044842 Bacteria 633
311 Ga0466960_0300115 3300044901 Bacteria 905
312 Ga0466959_0019785 3300045049 Bacteria 4954
313 Ga0466959_0238377 3300045049 Bacteria 1257
314 Ga0451576_0042988 3300045051 Bacteria 4769
315 Ga0451576_1355309 3300045051 Bacteria 741
316 Ga0466958_0011961 3300045836 Bacteria 4903
317 Ga0466967_0003738 3300045976 Bacteria 10030
318 Ga0466967_0256496 3300045976 Bacteria 1672
319 Ga0466967_0733323 3300045976 Bacteria 979
320 Ga0495592_0098656 3300046454 Bacteria 2085
321 Ga0495603_0113938 3300046455 Bacteria 1577
322 Ga0495603_0148873 3300046455 Bacteria 1360
323 Ga0495629_0004338 3300046459 Bacteria 10633
324 Ga0495629_0728401 3300046459 Bacteria 657
325 Ga0495641_0000709 3300046461 Bacteria 28205
326 Ga0495641_0061798 3300046461 Bacteria 1690
327 Ga0495651_0122698 3300046462 Bacteria 1906
328 Ga0495653_0189471 3300046463 Bacteria 1404
329 Ga0495653_0330995 3300046463 Bacteria 984
330 Ga0495582_0000237 3300046473 Bacteria 30675
331 Ga0495582_0385541 3300046473 Bacteria 808
332 Ga0495639_0005828 3300046475 Bacteria 5299
333 Ga0495662_0000484 3300046476 Bacteria 18104
334 Ga0495662_0117298 3300046476 Bacteria 1306
335 Ga0495664_0055214 3300046477 Bacteria 2363
336 Ga0495584_0663791 3300046491 Bacteria 531
337 Ga0495585_0556118 3300046492 Bacteria 542
338 Ga0495594_0057023 3300046499 Bacteria 2157
339 Ga0495594_0241792 3300046499 Bacteria 1029
340 Ga0495596_0126824 3300046500 Bacteria 991
341 Ga0495596_0248647 3300046500 Bacteria 690
342 Ga0495607_0268734 3300046501 Bacteria 814
343 Ga0495608_0142843 3300046511 Bacteria 1527
344 Ga0495616_0327354 3300046513 Unclassified 642
345 Ga0495618_0561462 3300046514 Bacteria 682
346 Ga0495628_0379390 3300046516 Bacteria 1035
347 Ga0495630_0024028 3300046517 Bacteria 4506
348 Ga0495630_0135396 3300046517 Bacteria 1872
349 Ga0495631_0035672 3300046518 Bacteria 2224
350 Ga0495632_0319421 3300046519 Unclassified 686
351 Ga0495637_0163311 3300046520 Bacteria 834
352 Ga0495643_0499302 3300046522 Unclassified 524
353 Ga0495644_0047910 3300046523 Bacteria 1605
354 Ga0495663_0250978 3300046525 Unclassified 628
355 Ga0495666_0220214 3300046526 Bacteria 869
356 Ga0495642_0110733 3300046528 Bacteria 1174
357 Ga0495652_0061355 3300046529 Bacteria 3174
358 Ga0495665_0001276 3300046531 Bacteria 13430
359 Ga0495640_0896908 3300046533 Bacteria 525
360 Ga0495586_0175388 3300046535 Bacteria 1212
361 Ga0495587_0047693 3300046536 Bacteria 2539
362 Ga0495609_0078879 3300046538 Bacteria 1441
363 Ga0495645_0166334 3300046543 Bacteria 1521
364 Ga0495645_0832960 3300046543 Bacteria 551
365 Ga0495633_0203536 3300046558 Bacteria 908
366 Ga0495633_0303314 3300046558 Archaea 725
367 Ga0495667_0090735 3300046559 Bacteria 1979
368 Ga0495667_0874292 3300046559 Bacteria 552
369 Ga0495656_0011824 3300046615 Unclassified 3209
370 Ga0495656_0177866 3300046615 Unclassified 1044
371 Ga0495634_0037586 3300046642 Bacteria 3307
372 Ga0495634_0235722 3300046642 Bacteria 1124
373 Ga0495634_0475301 3300046642 Bacteria 735
374 Ga0495611_0040915 3300046648 Unclassified 2067
375 Ga0495635_0010241 3300046663 Bacteria 6555
376 Ga0495659_0280291 3300046664 Unclassified 700
377 Ga0495657_0207378 3300046675 Bacteria 1192
378 Ga0495599_0104363 3300046678 Unclassified 1765
379 Ga0495623_0320275 3300046679 Bacteria 852
380 Ga0495646_0238702 3300046680 Bacteria 977
381 Ga0495647_0021233 3300046681 Bacteria 2336
382 Ga0495658_0001825 3300046683 Bacteria 10915
383 Ga0495613_0074518 3300046689 Bacteria 2471
384 Ga0495613_0364222 3300046689 Archaea 991
385 Ga0495613_0700946 3300046689 Bacteria 666
386 Ga0495624_0019594 3300046690 Bacteria 4513
387 Ga0495671_0096909 3300046692 Bacteria 1443
388 Ga0495589_0084937 3300046794 Bacteria 1538
389 Ga0495589_0166528 3300046794 Bacteria 1049
390 Ga0495600_0090023 3300046809 Bacteria 2001
391 Ga0495581_0001253 3300047315 Bacteria 13954
392 Ga0495581_0001600 3300047315 Bacteria 12638
393 Ga0495604_0418008 3300047317 Bacteria 880
394 Ga0495636_0095225 3300047318 Unclassified 1297
395 Ga0495636_0452506 3300047318 Unclassified 617
396 Ga0495636_0587207 3300047318 Unclassified 544
397 Ga0495674_0041297 3300047319 Bacteria 4121
398 Ga0495674_0514175 3300047319 Bacteria 956
399 Ga0495676_0011861 3300047321 Bacteria 7862
400 Ga0495676_0574965 3300047321 Bacteria 735
401 Ga0495680_0028388 3300047322 Bacteria 4587
402 Ga0495680_0287801 3300047322 Bacteria 1156
403 Ga0495680_0957922 3300047322 Bacteria 549
404 Ga0495683_0418908 3300047323 Unclassified 554
405 Ga0495677_0068529 3300047445 Bacteria 1321
406 Ga0495684_0434380 3300047471 Bacteria 915
407 Ga0495593_0014087 3300047673 Bacteria 4551
408 Ga0495593_0639539 3300047673 Bacteria 534
409 Ga0495602_0395132 3300048088 Bacteria 987
410 Ga0495614_0011419 3300048089 Bacteria 3911
411 Ga0495615_0091232 3300048090 Bacteria 849
412 Ga0496100_0004732 3300048903 Bacteria 7257
413 Ga0496100_1112720 3300048903 Bacteria 622
414 Ga0496101_0053116 3300048904 Bacteria 2922
415 Ga0496101_0055464 3300048904 Bacteria 2862
416 Ga0496102_0066317 3300048905 Bacteria 3308
417 Ga0496102_0641555 3300048905 Bacteria 985
418 Ga0496102_0792838 3300048905 Bacteria 870
419 Ga0496103_0044530 3300048906 Bacteria 2734
420 Ga0496103_1051966 3300048906 Bacteria 505
421 Ga0496104_0443285 3300048907 Bacteria 1210
422 Ga0496104_0477803 3300048907 Bacteria 1157
423 Ga0496104_0558065 3300048907 Bacteria 1056
424 Ga0496104_1729766 3300048907 Bacteria 528
425 Ga0496105_0106665 3300048908 Bacteria 2312
426 Ga0496106_0010051 3300048909 Bacteria 6990
427 Ga0496106_0539201 3300048909 Bacteria 936
428 Ga0496106_0586223 3300048909 Bacteria 893
429 Ga0496107_0020725 3300048910 Bacteria 4646
430 Ga0496107_0171207 3300048910 Bacteria 1611
431 Ga0496107_0591326 3300048910 Bacteria 821
432 Ga0496108_0198216 3300048911 Bacteria 1742
433 Ga0496108_0379010 3300048911 Bacteria 1235
434 Ga0496108_1036048 3300048911 Bacteria 700
435 Ga0496109_0172234 3300048912 Unclassified 2031
436 Ga0496109_0587357 3300048912 Bacteria 1050
437 Ga0496109_1375335 3300048912 Bacteria 641
438 Ga0496110_0022751 3300048913 Bacteria 5326
439 Ga0496110_0096779 3300048913 Bacteria 2645
440 Ga0496110_0354896 3300048913 Unclassified 1336
441 Ga0496110_0481737 3300048913 Bacteria 1130
442 Ga0496111_0346647 3300048914 Unclassified 1099
443 Ga0496111_0424043 3300048914 Bacteria 983
444 Ga0496111_0658924 3300048914 Bacteria 763
445 Ga0496112_0011785 3300048915 Bacteria 8004
446 Ga0496112_0089302 3300048915 Bacteria 3049
447 Ga0496112_0239287 3300048915 Bacteria 1768
448 Ga0496112_0592858 3300048915 Bacteria 1040
449 Ga0496113_0157414 3300048916 Unclassified 1795
450 Ga0496113_0317891 3300048916 Bacteria 1248
451 Ga0496114_0033507 3300048917 Bacteria 4233
452 Ga0496114_0746869 3300048917 Bacteria 855
453 Ga0496115_0130213 3300048918 Bacteria 2073
454 Ga0496115_0357410 3300048918 Bacteria 1191
455 Ga0496115_0968190 3300048918 Bacteria 652
456 Ga0501032_0011785 3300049569 Bacteria 6267
457 Ga0501033_0022755 3300049570 Bacteria 4725
458 Ga0501034_0034813 3300049571 Bacteria 5107
459 Ga0501036_0085000 3300049572 Bacteria 2674
460 Ga0501038_0211227 3300049574 Unclassified 1552
461 Ga0501039_0062859 3300049575 Bacteria 2876
462 Ga0501040_0264909 3300049576 Bacteria 1226
463 Ga0501041_0141420 3300049577 Bacteria 1500
464 Ga0501041_0521325 3300049577 Bacteria 757
465 Ga0501041_0776332 3300049577 Unclassified 614
466 Ga0501042_0046363 3300049578 Bacteria 3098
467 Ga0501042_0555875 3300049578 Bacteria 834
468 Ga0501043_0007925 3300049579 Bacteria 8394
469 Ga0501046_0017756 3300049580 Bacteria 5934
470 Ga0501047_0081970 3300049581 Bacteria 3101
471 Ga0501047_0218416 3300049581 Bacteria 1763
472 Ga0501048_0006148 3300049582 Bacteria 9139
473 Ga0501048_1262551 3300049582 Bacteria 531
474 Ga0501067_0662836 3300049583 Bacteria 586
475 Ga0501068_0019772 3300049584 Bacteria 3915
476 Ga0501069_0004571 3300049585 Bacteria 7155
477 Ga0501071_0224423 3300049587 Bacteria 1414
478 Ga0501072_0544791 3300049588 Bacteria 916
479 Ga0501073_0065644 3300049589 Bacteria 2530
480 Ga0501073_0140456 3300049589 Bacteria 1674
481 Ga0501074_0047642 3300049590 Bacteria 3097
482 Ga0501074_0481923 3300049590 Bacteria 879
483 Ga0501074_0651916 3300049590 Bacteria 744
484 Ga0501074_0811080 3300049590 Bacteria 659
485 Ga0501075_0228908 3300049591 Bacteria 1417
486 Ga0501075_0696656 3300049591 Bacteria 774
487 Ga0501076_0072326 3300049592 Bacteria 2759
488 Ga0501077_0044900 3300049593 Bacteria 2806
489 Ga0501079_0178746 3300049741 Bacteria 1656
490 Ga0501079_0415297 3300049741 Bacteria 1056
491 Ga0501079_0964509 3300049741 Bacteria 671
492 Ga0501079_1022913 3300049741 Bacteria 651
493 Ga0501080_0085987 3300049742 Bacteria 2921
494 Ga0501080_0284105 3300049742 Bacteria 1504
495 Ga0501035_0036318 3300049822 Bacteria 4466
496 Ga0501044_0045191 3300049823 Bacteria 4565
497 Ga0501044_0228192 3300049823 Bacteria 1811
498 Ga0501045_0119966 3300049824 Unclassified 1952
499 Ga0501045_0869167 3300049824 Bacteria 663
500 nmdc:mga00v17_568983_c1 3300050491 Bacteria 732
501 nmdc:mga0yw44_274813_c1 3300050492 Bacteria 1125
502 nmdc:mga0yw44_723509_c1 3300050492 Unclassified 676
503 nmdc:mga0yw44_95769_c2 3300050492 Bacteria 783
504 nmdc:mga05p37_108174_c1 3300050507 Bacteria 3420
505 nmdc:mga05p37_3053_c1 3300050507 Bacteria 19448
506 nmdc:mga0qj67_181378_c1 3300050509 Bacteria 1710
507 nmdc:mga06r32_1279210_c1 3300050510 Bacteria 678
508 nmdc:mga06r32_183981_c1 3300050510 Bacteria 2076
509 nmdc:mga06r32_195516_c1 3300050510 Bacteria 2010
510 nmdc:mga06r32_761983_c1 3300050510 Bacteria 930
511 nmdc:mga08y16_1357471_c1 3300050511 Bacteria 676
512 nmdc:mga08y16_195919_c1 3300050511 Bacteria 2094
513 nmdc:mga08y16_224963_c1 3300050511 Bacteria 1942
514 nmdc:mga08y16_24059_c1 3300050511 Bacteria 6431
515 nmdc:mga08y16_698795_c1 3300050511 Unclassified 1014
516 nmdc:mga0n895_19850_c1 3300050512 Bacteria 6255
517 nmdc:mga0n895_31090_c1 3300050512 Bacteria 5109
518 nmdc:mga0n895_33203_c1 3300050512 Bacteria 4958
519 nmdc:mga0n895_839823_c1 3300050512 Bacteria 907
520 nmdc:mga0n895_85607_c1 3300050512 Bacteria 3147
521 nmdc:mga0rr50_1328603_c1 3300050513 Bacteria 609
522 nmdc:mga0rr50_173868_c1 3300050513 Bacteria 1757
523 nmdc:mga0rr50_188714_c1 3300050513 Bacteria 1688
524 nmdc:mga0rr50_2615_c1 3300050513 Bacteria 10202
525 nmdc:mga0rr50_51388_c1 3300050513 Bacteria 3058
526 nmdc:mga0rr50_763676_c1 3300050513 Bacteria 825
527 nmdc:mga08x19_43882_c1 3300050514 Bacteria 2853
528 nmdc:mga08x19_517701_c1 3300050514 Bacteria 843
529 nmdc:mga08x19_822905_c1 3300050514 Bacteria 660
530 nmdc:mga0a205_123188_c1 3300050515 Bacteria 2492
531 nmdc:mga0a205_34318_c1 3300050515 Bacteria 4869
532 nmdc:mga0a205_40649_c1 3300050515 Bacteria 4477
533 nmdc:mga0a205_533992_c1 3300050515 Bacteria 1029
534 nmdc:mga0a205_585298_c1 3300050515 Bacteria 970
535 Ga0495601_0501193 3300053077 Bacteria 783
536 Ga0495612_0030276 3300053078 Bacteria 2180
537 Ga0495655_0062256 3300053083 Bacteria 1021
538 Ga0495595_0016538 3300053084 Bacteria 3158
539 Ga0495595_0143183 3300053084 Bacteria 1174
540 Ga0495595_0683864 3300053084 Unclassified 526
541 Ga0495619_0137416 3300053085 Bacteria 1681
542 Ga0495619_0486131 3300053085 Bacteria 849
543 Ga0501084_0141820 3300054114 Bacteria 2023
544 Ga0501084_0249056 3300054114 Bacteria 1500
545 Ga0501082_0752029 3300060353 Bacteria 853
546 Ga0501082_1295321 3300060353 Bacteria 636
547 Ga0466962_0101468 3300061719 Bacteria 1382
548 Ga0466962_0663432 3300061719 Bacteria 534
549 Ga0530510_0069967 3300061734 Bacteria 2546
550 Ga0530510_0570601 3300061734 Bacteria 860
551 Ga0395899_0240591
552 Ga0070658_10087667
553 Ga0070658_11017575
554 Ga0070683_100015515
555 Ga0070683_100045822
556 Ga0070683_100198020
557 Ga0070683_100395733
558 Ga0070682_100657609
559 Ga0068868_100668347
560 Ga0070660_100017491
561 Ga0070674_100238403
562 Ga0070659_101878442
563 Ga0070709_10017895
564 Ga0070709_10772854
565 Ga0070714_100409847
566 Ga0070713_101700164
567 Ga0070701_10559948
568 Ga0070711_100695776
569 Ga0070711_100719733
570 Ga0070708_101899474
571 Ga0070663_100147972
572 Ga0070678_100143087
573 Ga0070662_100672232
574 Ga0070662_101463640
575 Ga0070681_10023346
576 Ga0068867_100248762
577 Ga0068867_100355336
578 Ga0070706_100118665
579 Ga0070706_100201402
580 Ga0070707_100837639
581 Ga0070707_101973421
582 Ga0070698_100305002
583 Ga0070699_100160571
584 Ga0070679_100040623
585 Ga0070679_101231167
586 Ga0070684_100008993
587 Ga0070684_100009770
588 Ga0070684_100012986
589 Ga0070684_100060952
590 Ga0070672_100661491
591 Ga0070686_100092266
592 Ga0070704_100596936
593 Ga0070704_101051444
594 Ga0068855_101712459
595 Ga0070664_100204612
596 Ga0070664_100835004
597 Ga0070664_102380366
598 Ga0068857_100010331
599 Ga0068857_100019586
600 Ga0068854_100806004
601 Ga0068856_100193144
602 Ga0070702_100493288
603 Ga0068861_100226597
604 Ga0068862_101259431
605 Ga0081455_10038590
606 Ga0081455_10052565
607 Ga0081455_10154025
608 Ga0081540_1003040
609 Ga0070717_10117915
610 Ga0070717_10216088
611 Ga0070717_12119742
612 Ga0075364_10462344
613 Ga0075432_10036241
614 Ga0070715_10005055
615 Ga0070712_100409497
616 Ga0075428_100235737
617 Ga0075428_100404781
618 Ga0075428_100599993
619 Ga0075430_100032997
620 Ga0075431_100061514
621 Ga0075431_100207632
622 Ga0075431_101518318
623 Ga0075433_10110150
624 Ga0075433_10204458
625 Ga0075433_10388230
626 Ga0075434_100079856
627 Ga0075434_100384317
628 Ga0075434_100777560
629 Ga0075434_100908203
630 Ga0075429_100580892
631 Ga0075429_101852346
632 Ga0068865_100047832
633 Ga0075436_100084246
634 Ga0075435_100005187
635 Ga0075435_100050817
636 Ga0075435_100248240
637 Ga0075435_100467436
638 Ga0075435_100487481
639 Ga0111539_10023141
640 Ga0111539_10101809
641 Ga0111539_10259783
642 Ga0111539_10607938
643 Ga0111539_10952905
644 Ga0105245_10309450
645 Ga0105245_11185071
646 Ga0105245_11750514
647 Ga0114129_10082990
648 Ga0114129_10180117
649 Ga0114129_10713696
650 Ga0114129_11490256
651 Ga0114129_12213571
652 Ga0114129_13348819
653 Ga0105243_10505730
654 Ga0105241_10490765
655 Ga0105242_10304093
656 Ga0105237_11147742
657 Ga0105238_12818915
658 Ga0105249_10511266
659 Ga0105239_10555505
660 Ga0157345_1026058
661 Ga0157345_1051985
662 Ga0157342_1014947
663 Ga0157373_10208218
664 Ga0157373_10210799
665 Ga0157370_11397071
666 Ga0157374_10522726
667 Ga0157374_11122415
668 Ga0157378_11332790
669 Ga0157378_12726342
670 Ga0163162_10247102
671 Ga0163163_10177306
672 Ga0157380_10941989
673 Ga0157376_10116016
674 Ga0157376_11898435
675 Ga0163161_10397118
676 Ga0206356_11640548
677 Ga0206354_10790831
678 Ga0206353_10194736
679 Ga0213876_10710509
680 Ga0207692_10495575
681 Ga0207685_10035688
682 Ga0207685_10320747
683 Ga0207699_10233250
684 Ga0207699_10552562
685 Ga0207705_10521201
686 Ga0207684_10101301
687 Ga0207707_10050911
688 Ga0207693_10064591
689 Ga0207693_10065933
690 Ga0207693_10269388
691 Ga0207663_10027714
692 Ga0207663_10049700
693 Ga0207663_10186734
694 Ga0207657_10041323
695 Ga0207652_10131356
696 Ga0207646_10290026
697 Ga0207646_11073338
698 Ga0207681_11104889
699 Ga0207687_10484761
700 Ga0207687_11505043
701 Ga0207700_10368184
702 Ga0207700_11395127
703 Ga0207664_10025419
704 Ga0207664_10198100
705 Ga0207664_11942992
706 Ga0207706_10275251
707 Ga0207706_11271795
708 Ga0207686_10882521
709 Ga0207709_10073375
710 Ga0207709_10111904
711 Ga0207669_10742066
712 Ga0207704_10118712
713 Ga0207665_10685274
714 Ga0207661_10066450
715 Ga0207661_10513794
716 Ga0207661_10648803
717 Ga0207661_11584114
718 Ga0207679_10136111
719 Ga0207679_10856077
720 Ga0207651_11755808
721 Ga0207712_10378446
722 Ga0207678_10196544
723 Ga0207702_10701461
724 Ga0207702_10779745
725 Ga0207702_11746738
726 Ga0207648_10223623
727 Ga0207674_10020150
728 Ga0207674_10034052
729 Ga0207675_100052212
730 Ga0209966_1046847
731 Ga0209998_10018089
732 Ga0207428_10024080
733 Ga0207428_10037296
734 Ga0207428_10137844
735 Ga0265334_10146427
736 Ga0265323_10257472
737 Ga0265322_10098720
738 Ga0265336_10133143
739 Ga0265338_10018383
740 Ga0265324_10126475
741 Ga0265330_10038951
742 Ga0265325_10010258
743 Ga0265329_10042343
744 Ga0265340_10120174
745 Ga0265339_10221833
746 Ga0265327_10004284
747 Ga0265316_10010315
748 Ga0307408_100339306
749 Ga0265313_10009194
750 Ga0265314_10007017
751 Ga0265342_10173280
752 Ga0307405_10097873
753 Ga0307405_10516735
754 Ga0307405_11742758
755 Ga0307413_10754469
756 Ga0307410_10633519
757 Ga0307410_11304527
758 Ga0307406_10198787
759 Ga0307406_11031741
760 Ga0307412_10440754
761 Ga0307409_100266527
762 Ga0307409_100656592
763 Ga0307409_101000053
764 Ga0307416_100038804
765 Ga0307416_100633483
766 Ga0307416_100661222
767 Ga0307415_100147699
768 Ga0373926_0033915
769 Ga0373944_0230545
770 Ga0373936_0043801
771 Ga0373945_0008401
772 Ga0373943_0110303
773 Ga0373943_0121639
774 Ga0373946_0000490
775 Ga0373955_0271789
776 Ga0373931_0162682
777 Ga0373931_0287196
778 Ga0373935_0001745
779 Ga0373935_0058512
780 Ga0373927_0345162
781 Ga0373947_0002987
782 Ga0373947_0010822
783 Ga0373947_0492097
784 Ga0373937_1934379
785 Ga0373925_0046465
786 Ga0373925_0141776
787 Ga0395899_0029051
788 Ga0395899_0071181
789 Ga0395899_0330700
790 Ga0395899_0375319
791 Ga0395899_0439668
792 Ga0395899_0822269
793 Ga0395900_0006111
794 Ga0395900_0040559
795 Ga0395900_0098964
796 Ga0395900_0099378
797 Ga0395900_0101635
798 Ga0395900_0198246
799 Ga0395900_0499243
800 Ga0395900_0568235
801 Ga0395900_0571317
802 Ga0395900_0849278
803 Ga0395898_0005052
804 Ga0395898_0082338
805 Ga0395898_0094852
806 Ga0395898_0117726
807 Ga0395898_0176138
808 Ga0395898_0294097
809 Ga0395898_0497837
810 Ga0395898_0613786
811 Ga0395898_0741881
812 Ga0395898_0810223
813 Ga0395898_1257321
814 Ga0395905_0012175
815 Ga0395905_0017272
816 Ga0395905_0024793
817 Ga0395905_0132962
818 Ga0395905_0200189
819 Ga0395905_0377308
820 Ga0395905_0399402
821 Ga0395905_0555679
822 Ga0395905_0560564
823 Ga0395905_0571660
824 Ga0395905_0684713
825 Ga0436364_0128800
826 Ga0395901_0002473
827 Ga0395901_0006469
828 Ga0395901_0018774
829 Ga0395901_0027774
830 Ga0395901_0050767
831 Ga0395901_0341281
832 Ga0395901_0358899
833 Ga0395901_0376161
834 Ga0395901_0409271
835 Ga0395901_0454875
836 Ga0395901_1382059
837 Ga0436363_0200933
838 Ga0436363_1496836
839 Ga0451789_0192847
840 Ga0451791_0593328
841 Ga0451804_0719484
842 Ga0451804_0913404
843 Ga0451845_0056164
844 Ga0451851_0010059
845 Ga0451853_0084396
846 Ga0439455_0029753
847 Ga0439463_034343
848 Ga0439460_0028145
849 Ga0466969_0417797
850 Ga0466972_0320646
851 Ga0466965_0662063
852 Ga0466961_0009123
853 Ga0466963_0024538
854 Ga0466963_0501926
855 Ga0466964_0053086
856 Ga0466964_0208486
857 Ga0466964_0232538
858 Ga0466971_0030551
859 Ga0466968_0600561
860 Ga0466957_0896938
861 Ga0466960_0300115
862 Ga0466959_0019785
863 Ga0466959_0238377
864 Ga0451576_0042988
865 Ga0451576_1355309
866 Ga0466958_0011961
867 Ga0466967_0003738
868 Ga0466967_0256496
869 Ga0466967_0733323
870 Ga0495592_0098656
871 Ga0495603_0113938
872 Ga0495603_0148873
873 Ga0495629_0004338
874 Ga0495629_0728401
875 Ga0495641_0000709
876 Ga0495641_0061798
877 Ga0495651_0122698
878 Ga0495653_0189471
879 Ga0495653_0330995
880 Ga0495582_0000237
881 Ga0495582_0385541
882 Ga0495639_0005828
883 Ga0495662_0000484
884 Ga0495662_0117298
885 Ga0495664_0055214
886 Ga0495584_0663791
887 Ga0495585_0556118
888 Ga0495594_0057023
889 Ga0495594_0241792
890 Ga0495596_0126824
891 Ga0495596_0248647
892 Ga0495607_0268734
893 Ga0495608_0142843
894 Ga0495616_0327354
895 Ga0495618_0561462
896 Ga0495628_0379390
897 Ga0495630_0024028
898 Ga0495630_0135396
899 Ga0495631_0035672
900 Ga0495632_0319421
901 Ga0495637_0163311
902 Ga0495643_0499302
903 Ga0495644_0047910
904 Ga0495663_0250978
905 Ga0495666_0220214
906 Ga0495642_0110733
907 Ga0495652_0061355
908 Ga0495665_0001276
909 Ga0495640_0896908
910 Ga0495586_0175388
911 Ga0495587_0047693
912 Ga0495609_0078879
913 Ga0495645_0166334
914 Ga0495645_0832960
915 Ga0495633_0203536
916 Ga0495633_0303314
917 Ga0495667_0090735
918 Ga0495667_0874292
919 Ga0495656_0011824
920 Ga0495656_0177866
921 Ga0495634_0037586
922 Ga0495634_0235722
923 Ga0495634_0475301
924 Ga0495611_0040915
925 Ga0495635_0010241
926 Ga0495659_0280291
927 Ga0495657_0207378
928 Ga0495599_0104363
929 Ga0495623_0320275
930 Ga0495646_0238702
931 Ga0495647_0021233
932 Ga0495658_0001825
933 Ga0495613_0074518
934 Ga0495613_0364222
935 Ga0495613_0700946
936 Ga0495624_0019594
937 Ga0495671_0096909
938 Ga0495589_0084937
939 Ga0495589_0166528
940 Ga0495600_0090023
941 Ga0495581_0001253
942 Ga0495581_0001600
943 Ga0495604_0418008
944 Ga0495636_0095225
945 Ga0495636_0452506
946 Ga0495636_0587207
947 Ga0495674_0041297
948 Ga0495674_0514175
949 Ga0495676_0011861
950 Ga0495676_0574965
951 Ga0495680_0028388
952 Ga0495680_0287801
953 Ga0495680_0957922
954 Ga0495683_0418908
955 Ga0495677_0068529
956 Ga0495684_0434380
957 Ga0495593_0014087
958 Ga0495593_0639539
959 Ga0495602_0395132
960 Ga0495614_0011419
961 Ga0495615_0091232
962 Ga0496100_0004732
963 Ga0496100_1112720
964 Ga0496101_0053116
965 Ga0496101_0055464
966 Ga0496102_0066317
967 Ga0496102_0641555
968 Ga0496102_0792838
969 Ga0496103_0044530
970 Ga0496103_1051966
971 Ga0496104_0443285
972 Ga0496104_0477803
973 Ga0496104_0558065
974 Ga0496104_1729766
975 Ga0496105_0106665
976 Ga0496106_0010051
977 Ga0496106_0539201
978 Ga0496106_0586223
979 Ga0496107_0020725
980 Ga0496107_0171207
981 Ga0496107_0591326
982 Ga0496108_0198216
983 Ga0496108_0379010
984 Ga0496108_1036048
985 Ga0496109_0172234
986 Ga0496109_0587357
987 Ga0496109_1375335
988 Ga0496110_0022751
989 Ga0496110_0096779
990 Ga0496110_0354896
991 Ga0496110_0481737
992 Ga0496111_0346647
993 Ga0496111_0424043
994 Ga0496111_0658924
995 Ga0496112_0011785
996 Ga0496112_0089302
997 Ga0496112_0239287
998 Ga0496112_0592858
999 Ga0496113_0157414
1000 Ga0496113_0317891
1001 Ga0496114_0033507
1002 Ga0496114_0746869
1003 Ga0496115_0130213
1004 Ga0496115_0357410
1005 Ga0496115_0968190
1006 Ga0501032_0011785
1007 Ga0501033_0022755
1008 Ga0501034_0034813
1009 Ga0501036_0085000
1010 Ga0501038_0211227
1011 Ga0501039_0062859
1012 Ga0501040_0264909
1013 Ga0501041_0141420
1014 Ga0501041_0521325
1015 Ga0501041_0776332
1016 Ga0501042_0046363
1017 Ga0501042_0555875
1018 Ga0501043_0007925
1019 Ga0501046_0017756
1020 Ga0501047_0081970
1021 Ga0501047_0218416
1022 Ga0501048_0006148
1023 Ga0501048_1262551
1024 Ga0501067_0662836
1025 Ga0501068_0019772
1026 Ga0501069_0004571
1027 Ga0501071_0224423
1028 Ga0501072_0544791
1029 Ga0501073_0065644
1030 Ga0501073_0140456
1031 Ga0501074_0047642
1032 Ga0501074_0481923
1033 Ga0501074_0651916
1034 Ga0501074_0811080
1035 Ga0501075_0228908
1036 Ga0501075_0696656
1037 Ga0501076_0072326
1038 Ga0501077_0044900
1039 Ga0501079_0178746
1040 Ga0501079_0415297
1041 Ga0501079_0964509
1042 Ga0501079_1022913
1043 Ga0501080_0085987
1044 Ga0501080_0284105
1045 Ga0501035_0036318
1046 Ga0501044_0045191
1047 Ga0501044_0228192
1048 Ga0501045_0119966
1049 Ga0501045_0869167
1050 nmdc:mga00v17_568983_c1
1051 nmdc:mga0yw44_274813_c1
1052 nmdc:mga0yw44_723509_c1
1053 nmdc:mga0yw44_95769_c2
1054 nmdc:mga05p37_108174_c1
1055 nmdc:mga05p37_3053_c1
1056 nmdc:mga0qj67_181378_c1
1057 nmdc:mga06r32_1279210_c1
1058 nmdc:mga06r32_183981_c1
1059 nmdc:mga06r32_195516_c1
1060 nmdc:mga06r32_761983_c1
1061 nmdc:mga08y16_1357471_c1
1062 nmdc:mga08y16_195919_c1
1063 nmdc:mga08y16_224963_c1
1064 nmdc:mga08y16_24059_c1
1065 nmdc:mga08y16_698795_c1
1066 nmdc:mga0n895_19850_c1
1067 nmdc:mga0n895_31090_c1
1068 nmdc:mga0n895_33203_c1
1069 nmdc:mga0n895_839823_c1
1070 nmdc:mga0n895_85607_c1
1071 nmdc:mga0rr50_1328603_c1
1072 nmdc:mga0rr50_173868_c1
1073 nmdc:mga0rr50_188714_c1
1074 nmdc:mga0rr50_2615_c1
1075 nmdc:mga0rr50_51388_c1
1076 nmdc:mga0rr50_763676_c1
1077 nmdc:mga08x19_43882_c1
1078 nmdc:mga08x19_517701_c1
1079 nmdc:mga08x19_822905_c1
1080 nmdc:mga0a205_123188_c1
1081 nmdc:mga0a205_34318_c1
1082 nmdc:mga0a205_40649_c1
1083 nmdc:mga0a205_533992_c1
1084 nmdc:mga0a205_585298_c1
1085 Ga0495601_0501193
1086 Ga0495612_0030276
1087 Ga0495655_0062256
1088 Ga0495595_0016538
1089 Ga0495595_0143183
1090 Ga0495595_0683864
1091 Ga0495619_0137416
1092 Ga0495619_0486131
1093 Ga0501084_0141820
1094 Ga0501084_0249056
1095 Ga0501082_0752029
1096 Ga0501082_1295321
1097 Ga0466962_0101468
1098 Ga0466962_0663432
1099 Ga0530510_0069967
1100 Ga0530510_0570601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

2

95

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9132 3 74
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9096 1 73
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.8976 4 74
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8957 4 74
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8851 1 73
ID Description Score Start End Superfamily
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9612 4 74 3.30.300.90
af_Q9USK1_28_105_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9405 4 74 3.30.300.90
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9399 3 73 3.10.20.90
af_Q9NEY7_29_106_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9396 4 74 3.30.300.90
af_P39724_22_112_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9363 4 77 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A2V2SJE2-F1-model_v4 deleted 1.001 4 74
AF-A0A537WDK0-F1-model_v4 BolA family transcriptional regulator 0.9965 4 77
AF-A0A538H4P8-F1-model_v4 BolA family transcriptional regulator 0.9865 1 77 GO:0106035
AF-A0A538E3Z5-F1-model_v4 BolA/IbaG family iron-sulfur metabolism protein 0.9849 1 77
AF-A0A2Y9QTJ5-F1-model_v4 BolA-like protein 3 0.9811 4 74 GO:0005759
GO:0106035

Map