F462513

General Info

Members Datasets Scaffolds Average Seq Length
550 306 1100 269

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10181371|Ga0307515_101813712
Length 267
Sequence MTALKWLLIVISVGYVCGLAVLFFAQRSFLFPIPTTERVAPQAAGFPEAEEHVLTTADGEKVIAWHVPAKPGRPVILYFHGNGDFLAGFFGRFRDLIADGTGVVALSYRGYAGSTGQPSERGLLQDGATAYAFTTERYSANRIVVWGFSLGTGVAVALAARPIGKLILEAPYTSTADVAASLFWFMPVRLVMRDQFRSDERIAHVQVPLLIMHGSNDPAIPIVFGERLFALAHEPKQFVRFPGGGHENLGNFGAIETARQFINAAKG

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
285 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
289 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
295 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
296 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
297 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
298 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
299 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
300 2922425934
301 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
302 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
303 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
304 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
305 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
306 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.73
Nodule 2
Rhizoplane 9.27
Rhizosphere 74.55
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10181371 3300028794 Bacteria 2054
2 JGI24742J22300_10025312 3300002244 Bacteria 1025
3 JGI25153J46596_10006996 3300003215 Bacteria 5618
4 JGI25153J46596_10012090 3300003215 Bacteria 3761
5 JGI25404J52841_10008618 3300003659 Bacteria 2175
6 Ga0070658_10041489 3300005327 Bacteria 3713
7 Ga0070658_10145775 3300005327 Bacteria 1980
8 Ga0070658_10229457 3300005327 Bacteria 1572
9 Ga0070683_100094445 3300005329 Bacteria 2811
10 Ga0070683_100347917 3300005329 Bacteria 1412
11 Ga0070690_100282828 3300005330 Bacteria 1184
12 Ga0068869_100114405 3300005334 Bacteria 2056
13 Ga0068869_100115681 3300005334 Bacteria 2045
14 Ga0070666_10351599 3300005335 Bacteria 1055
15 Ga0070680_100022476 3300005336 Bacteria 5024
16 Ga0070680_100059093 3300005336 Bacteria 3136
17 Ga0070682_100220138 3300005337 Bacteria 1351
18 Ga0070682_100256815 3300005337 Bacteria 1263
19 Ga0068868_100068385 3300005338 Bacteria 2828
20 Ga0070689_100149894 3300005340 Bacteria 1880
21 Ga0070668_100184816 3300005347 Bacteria 1704
22 Ga0070675_100173102 3300005354 Bacteria 1863
23 Ga0070671_100351146 3300005355 Bacteria 1259
24 Ga0070674_100100315 3300005356 Bacteria 2108
25 Ga0070674_100214334 3300005356 Bacteria 1494
26 Ga0070673_100070509 3300005364 Bacteria 2805
27 Ga0070673_100278332 3300005364 Bacteria 1467
28 Ga0070688_100159459 3300005365 Bacteria 1549
29 Ga0070659_100210898 3300005366 Bacteria 1601
30 Ga0070667_100243138 3300005367 Bacteria 1608
31 Ga0070703_10073553 3300005406 Bacteria 1147
32 Ga0070714_100140008 3300005435 Bacteria 2171
33 Ga0070713_100008690 3300005436 Bacteria 7223
34 Ga0070713_100214143 3300005436 Bacteria 1745
35 Ga0070710_10437157 3300005437 Bacteria 884
36 Ga0070701_10147483 3300005438 Bacteria 1351
37 Ga0070700_100262805 3300005441 Bacteria 1243
38 Ga0070663_100005020 3300005455 Bacteria 7814
39 Ga0070663_100051467 3300005455 Bacteria 2934
40 Ga0070663_100072740 3300005455 Bacteria 2505
41 Ga0070663_100247590 3300005455 Bacteria 1409
42 Ga0070663_100307106 3300005455 Bacteria 1271
43 Ga0070663_100312358 3300005455 Bacteria 1262
44 Ga0070678_100075591 3300005456 Bacteria 2534
45 Ga0070678_100100408 3300005456 Bacteria 2241
46 Ga0070678_100431259 3300005456 Bacteria 1151
47 Ga0070681_10104922 3300005458 Bacteria 2768
48 Ga0070681_10557714 3300005458 Bacteria 1059
49 Ga0068867_100227041 3300005459 Bacteria 1507
50 Ga0070685_10149764 3300005466 Bacteria 1478
51 Ga0070679_100069219 3300005530 Bacteria 3520
52 Ga0068853_100007138 3300005539 Bacteria 8934
53 Ga0068853_100133453 3300005539 Bacteria 2224
54 Ga0068853_100289658 3300005539 Bacteria 1511
55 Ga0070672_100266532 3300005543 Bacteria 1445
56 Ga0070665_100052243 3300005548 Bacteria 4100
57 Ga0070665_100373734 3300005548 Bacteria 1432
58 Ga0070665_100493513 3300005548 Bacteria 1235
59 Ga0070665_100674455 3300005548 Bacteria 1047
60 Ga0070665_100789068 3300005548 Bacteria 963
61 Ga0068855_100065667 3300005563 Bacteria 4230
62 Ga0068855_100633089 3300005563 Bacteria 1150
63 Ga0070664_100060422 3300005564 Bacteria 3227
64 Ga0070664_100622841 3300005564 Bacteria 1002
65 Ga0070702_100077149 3300005615 Bacteria 1985
66 Ga0068852_100589137 3300005616 Bacteria 1115
67 Ga0068859_100127160 3300005617 Bacteria 2618
68 Ga0068859_100225216 3300005617 Bacteria 1963
69 Ga0068859_100394116 3300005617 Bacteria 1480
70 Ga0068866_10162194 3300005718 Bacteria 1304
71 Ga0068861_100079985 3300005719 Bacteria 2556
72 Ga0068861_100127206 3300005719 Bacteria 2063
73 Ga0068861_100325691 3300005719 Bacteria 1339
74 Ga0068861_100413106 3300005719 Bacteria 1200
75 Ga0068851_10034253 3300005834 Bacteria 2534
76 Ga0068870_10015585 3300005840 Bacteria 3611
77 Ga0068870_10038319 3300005840 Bacteria 2474
78 Ga0068870_10109822 3300005840 Bacteria 1573
79 Ga0068870_10157234 3300005840 Bacteria 1345
80 Ga0068863_100049022 3300005841 Bacteria 4004
81 Ga0068858_100471060 3300005842 Bacteria 1212
82 Ga0068860_100254582 3300005843 Bacteria 1710
83 Ga0068860_100654575 3300005843 Bacteria 1058
84 Ga0068862_100134308 3300005844 Bacteria 2191
85 Ga0068862_100206435 3300005844 Bacteria 1773
86 Ga0068862_100305556 3300005844 Bacteria 1464
87 Ga0068862_100340729 3300005844 Bacteria 1389
88 Ga0081455_10073323 3300005937 Bacteria 2831
89 Ga0081538_10016437 3300005981 Bacteria 5672
90 Ga0081540_1001390 3300005983 Bacteria 20964
91 Ga0081540_1002860 3300005983 Bacteria 13966
92 Ga0081540_1014001 3300005983 Bacteria 5174
93 Ga0081540_1019312 3300005983 Bacteria 4148
94 Ga0081540_1033767 3300005983 Bacteria 2772
95 Ga0081540_1106951 3300005983 Bacteria 1192
96 Ga0081539_10021878 3300005985 Bacteria 4253
97 Ga0075365_10117336 3300006038 Bacteria 1833
98 Ga0075368_10006773 3300006042 Bacteria 4026
99 Ga0075363_100150076 3300006048 Bacteria 1315
100 Ga0075364_10234062 3300006051 Bacteria 1247
101 Ga0070716_100022666 3300006173 Bacteria 3321
102 Ga0070712_100003085 3300006175 Bacteria 10292
103 Ga0070712_100086499 3300006175 Bacteria 2285
104 Ga0075367_10178581 3300006178 Bacteria 1323
105 Ga0075369_10062367 3300006186 Bacteria 1628
106 Ga0097621_100294512 3300006237 Bacteria 1432
107 Ga0075370_10076266 3300006353 Bacteria 1922
108 Ga0075370_10175736 3300006353 Bacteria 1259
109 Ga0068871_100293735 3300006358 Bacteria 1425
110 Ga0068865_100261363 3300006881 Bacteria 1370
111 Ga0075436_100366050 3300006914 Bacteria 1041
112 Ga0097620_100127150 3300006931 Bacteria 2618
113 Ga0097620_100225225 3300006931 Bacteria 1963
114 Ga0097620_100394098 3300006931 Bacteria 1480
115 Ga0099794_10011830 3300007265 Bacteria 3748
116 Ga0099795_10006150 3300007788 Bacteria 3254
117 Ga0105240_10262772 3300009093 Bacteria 1990
118 Ga0105240_10433044 3300009093 Bacteria 1475
119 Ga0111539_10106243 3300009094 Bacteria 3293
120 Ga0111539_10541507 3300009094 Bacteria 1356
121 Ga0105245_10339864 3300009098 Bacteria 1484
122 Ga0105245_10383950 3300009098 Bacteria 1399
123 Ga0105245_10658827 3300009098 Bacteria 1077
124 Ga0105247_10079178 3300009101 Bacteria 2068
125 Ga0105243_10201368 3300009148 Bacteria 1746
126 Ga0105243_10241988 3300009148 Bacteria 1606
127 Ga0105243_10306971 3300009148 Bacteria 1440
128 Ga0105241_10027767 3300009174 Bacteria 4213
129 Ga0105241_10159560 3300009174 Bacteria 1852
130 Ga0105242_10055369 3300009176 Bacteria 3245
131 Ga0105242_10404233 3300009176 Bacteria 1275
132 Ga0105242_10909034 3300009176 Bacteria 881
133 Ga0105248_10094526 3300009177 Bacteria 3366
134 Ga0105248_10262840 3300009177 Bacteria 1943
135 Ga0105248_10268785 3300009177 Bacteria 1920
136 Ga0105237_10005657 3300009545 Bacteria 14064
137 Ga0105237_10100715 3300009545 Bacteria 2881
138 Ga0105238_10056071 3300009551 Bacteria 3953
139 Ga0105238_10549331 3300009551 Bacteria 1159
140 Ga0105238_10790023 3300009551 Bacteria 964
141 Ga0099796_10002883 3300010159 Bacteria 3876
142 Ga0099796_10102618 3300010159 Bacteria 1078
143 Ga0105239_10066387 3300010375 Bacteria 3963
144 Ga0105239_10200144 3300010375 Bacteria 2237
145 Ga0105239_10237957 3300010375 Bacteria 2044
146 Ga0105246_10029910 3300011119 Bacteria 3592
147 Ga0105246_10143673 3300011119 Bacteria 1797
148 Ga0105246_10363215 3300011119 Bacteria 1190
149 Ga0157370_10145487 3300013104 Bacteria 2207
150 Ga0157369_10042536 3300013105 Bacteria 4956
151 Ga0157374_10105820 3300013296 Bacteria 2702
152 Ga0157374_10110066 3300013296 Bacteria 2649
153 Ga0157374_10327847 3300013296 Bacteria 1518
154 Ga0157378_10053618 3300013297 Bacteria 3590
155 Ga0157378_10561323 3300013297 Bacteria 1148
156 Ga0157378_10646681 3300013297 Bacteria 1073
157 Ga0157378_10657005 3300013297 Bacteria 1064
158 Ga0157378_10676700 3300013297 Bacteria 1049
159 Ga0163162_10018380 3300013306 Bacteria 6849
160 Ga0163162_10227665 3300013306 Bacteria 1994
161 Ga0163162_10294940 3300013306 Bacteria 1753
162 Ga0163162_10562986 3300013306 Bacteria 1267
163 Ga0163162_10765826 3300013306 Bacteria 1084
164 Ga0157372_10563796 3300013307 Bacteria 1327
165 Ga0157375_10232985 3300013308 Bacteria 2000
166 Ga0163163_10032871 3300014325 Bacteria 5013
167 Ga0163163_10126249 3300014325 Bacteria 2596
168 Ga0163163_10441592 3300014325 Bacteria 1361
169 Ga0157380_10119221 3300014326 Bacteria 2232
170 Ga0157380_10316106 3300014326 Bacteria 1446
171 Ga0157380_10327646 3300014326 Bacteria 1423
172 Ga0157380_10358509 3300014326 Bacteria 1367
173 Ga0157380_10872431 3300014326 Bacteria 924
174 Ga0157377_10111529 3300014745 Bacteria 1645
175 Ga0157376_10042381 3300014969 Bacteria 3731
176 Ga0163161_10074667 3300017792 Bacteria 2487
177 Ga0163161_10172969 3300017792 Bacteria 1652
178 Ga0163161_10230802 3300017792 Bacteria 1436
179 Ga0163161_10266754 3300017792 Bacteria 1338
180 Ga0209233_1001365 3300025261 Bacteria 9696
181 Ga0209758_1002230 3300025297 Bacteria 20136
182 Ga0209758_1033090 3300025297 Bacteria 2084
183 Ga0207697_10100905 3300025315 Bacteria 1230
184 Ga0207697_10129019 3300025315 Bacteria 1092
185 Ga0207656_10010842 3300025321 Bacteria 3427
186 Ga0207653_10035198 3300025885 Bacteria 1628
187 Ga0207692_10037835 3300025898 Bacteria 2363
188 Ga0207642_10176486 3300025899 Bacteria 1160
189 Ga0207710_10046544 3300025900 Bacteria 1937
190 Ga0207688_10027813 3300025901 Bacteria 3110
191 Ga0207688_10039675 3300025901 Bacteria 2615
192 Ga0207680_10039387 3300025903 Bacteria 2742
193 Ga0207645_10147509 3300025907 Bacteria 1534
194 Ga0207645_10276184 3300025907 Bacteria 1115
195 Ga0207643_10117729 3300025908 Bacteria 1571
196 Ga0207705_10028830 3300025909 Bacteria 3956
197 Ga0207705_10326908 3300025909 Bacteria 1179
198 Ga0207654_10233028 3300025911 Bacteria 1227
199 Ga0207707_10002973 3300025912 Bacteria 15094
200 Ga0207671_10016779 3300025914 Bacteria 5678
201 Ga0207671_10457800 3300025914 Bacteria 1016
202 Ga0207693_10016864 3300025915 Bacteria 5832
203 Ga0207663_10035488 3300025916 Bacteria 2992
204 Ga0207660_10011895 3300025917 Bacteria 5676
205 Ga0207660_10031403 3300025917 Bacteria 3657
206 Ga0207657_10056503 3300025919 Bacteria 3386
207 Ga0207657_10170485 3300025919 Bacteria 1763
208 Ga0207657_10420054 3300025919 Bacteria 1051
209 Ga0207649_10063431 3300025920 Bacteria 2333
210 Ga0207652_10079420 3300025921 Bacteria 2866
211 Ga0207681_10252091 3300025923 Bacteria 1378
212 Ga0207681_10468704 3300025923 Bacteria 1027
213 Ga0207694_10385267 3300025924 Bacteria 1164
214 Ga0207650_10579737 3300025925 Bacteria 942
215 Ga0207659_10232462 3300025926 Bacteria 1488
216 Ga0207659_10236479 3300025926 Bacteria 1476
217 Ga0207687_10077089 3300025927 Bacteria 2396
218 Ga0207690_10254532 3300025932 Bacteria 1358
219 Ga0207706_10150048 3300025933 Bacteria 2050
220 Ga0207706_10408395 3300025933 Bacteria 1177
221 Ga0207706_10517214 3300025933 Bacteria 1029
222 Ga0207709_10130718 3300025935 Bacteria 1711
223 Ga0207670_10232756 3300025936 Bacteria 1416
224 Ga0207669_10153707 3300025937 Bacteria 1615
225 Ga0207669_10200696 3300025937 Bacteria 1447
226 Ga0207704_10269930 3300025938 Bacteria 1287
227 Ga0207704_10278826 3300025938 Bacteria 1270
228 Ga0207691_10337004 3300025940 Bacteria 1291
229 Ga0207691_10367130 3300025940 Bacteria 1230
230 Ga0207711_10183697 3300025941 Bacteria 1903
231 Ga0207689_10158151 3300025942 Bacteria 1868
232 Ga0207689_10177553 3300025942 Bacteria 1756
233 Ga0207689_10557139 3300025942 Bacteria 963
234 Ga0207661_10073487 3300025944 Bacteria 2800
235 Ga0207679_10066678 3300025945 Bacteria 2698
236 Ga0207679_10237082 3300025945 Bacteria 1544
237 Ga0207667_10137562 3300025949 Bacteria 2515
238 Ga0207651_10087416 3300025960 Bacteria 2269
239 Ga0207651_10375007 3300025960 Bacteria 1204
240 Ga0207712_10058302 3300025961 Bacteria 2728
241 Ga0207712_10215229 3300025961 Bacteria 1533
242 Ga0207712_10304364 3300025961 Bacteria 1310
243 Ga0207712_10462229 3300025961 Bacteria 1078
244 Ga0207668_10115565 3300025972 Bacteria 2021
245 Ga0207668_10169555 3300025972 Bacteria 1710
246 Ga0207640_10421875 3300025981 Bacteria 1092
247 Ga0207640_10443859 3300025981 Bacteria 1067
248 Ga0207658_10439371 3300025986 Bacteria 1153
249 Ga0207677_10021101 3300026023 Bacteria 3973
250 Ga0207677_10041309 3300026023 Bacteria 3048
251 Ga0207677_10169183 3300026023 Bacteria 1707
252 Ga0207677_10363616 3300026023 Bacteria 1216
253 Ga0207677_10639887 3300026023 Bacteria 937
254 Ga0207703_10042157 3300026035 Bacteria 3660
255 Ga0207639_10002921 3300026041 Bacteria 11490
256 Ga0207639_10180311 3300026041 Bacteria 1796
257 Ga0207639_10378271 3300026041 Bacteria 1271
258 Ga0207678_10014798 3300026067 Bacteria 6864
259 Ga0207678_10028543 3300026067 Bacteria 4870
260 Ga0207678_10091159 3300026067 Bacteria 2605
261 Ga0207678_10115662 3300026067 Bacteria 2288
262 Ga0207678_10142386 3300026067 Bacteria 2046
263 Ga0207678_10363201 3300026067 Bacteria 1250
264 Ga0207678_10645019 3300026067 Bacteria 930
265 Ga0207708_10188445 3300026075 Bacteria 1641
266 Ga0207708_10231214 3300026075 Bacteria 1484
267 Ga0207708_10314585 3300026075 Bacteria 1276
268 Ga0207641_10124569 3300026088 Bacteria 2305
269 Ga0207648_10038357 3300026089 Bacteria 4216
270 Ga0207648_10235299 3300026089 Bacteria 1630
271 Ga0207648_10312804 3300026089 Bacteria 1410
272 Ga0207648_10518011 3300026089 Bacteria 1092
273 Ga0207676_10436088 3300026095 Bacteria 1232
274 Ga0207674_10010835 3300026116 Bacteria 10279
275 Ga0207674_10165089 3300026116 Bacteria 2168
276 Ga0207675_100164653 3300026118 Bacteria 2117
277 Ga0207675_100186364 3300026118 Bacteria 1989
278 Ga0207675_100256285 3300026118 Bacteria 1695
279 Ga0207675_100323676 3300026118 Bacteria 1506
280 Ga0207683_10046018 3300026121 Bacteria 3817
281 Ga0207683_10087486 3300026121 Bacteria 2771
282 Ga0207683_10105119 3300026121 Bacteria 2524
283 Ga0207683_10200196 3300026121 Bacteria 1815
284 Ga0207683_10291662 3300026121 Bacteria 1492
285 Ga0207698_10200747 3300026142 Bacteria 1785
286 Ga0209179_1001706 3300027512 Bacteria 2785
287 Ga0209588_1008501 3300027671 Bacteria 3045
288 Ga0207428_10172412 3300027907 Bacteria 1638
289 Ga0268266_10003479 3300028379 Bacteria 15692
290 Ga0268266_10019404 3300028379 Bacteria 5789
291 Ga0268266_10085290 3300028379 Bacteria 2759
292 Ga0268266_10089728 3300028379 Bacteria 2692
293 Ga0268266_10134390 3300028379 Bacteria 2214
294 Ga0268266_10170525 3300028379 Bacteria 1975
295 Ga0268266_10328768 3300028379 Bacteria 1432
296 Ga0268265_10011119 3300028380 Bacteria 6081
297 Ga0268265_10109028 3300028380 Bacteria 2255
298 Ga0268265_10134979 3300028380 Bacteria 2057
299 Ga0268265_10190547 3300028380 Bacteria 1770
300 Ga0268264_10348554 3300028381 Bacteria 1409
301 Ga0268264_10417292 3300028381 Bacteria 1293
302 Ga0307517_10000098 3300028786 Bacteria 126044
303 Ga0307515_10053162 3300028794 Bacteria 5984
304 Ga0265330_10026959 3300031235 Bacteria 2597
305 Ga0265331_10081084 3300031250 Bacteria 1507
306 Ga0307513_10041234 3300031456 Bacteria 5098
307 Ga0307509_10322652 3300031507 Bacteria 1280
308 Ga0307408_100396553 3300031548 Bacteria 1184
309 Ga0307508_10198865 3300031616 Bacteria 1605
310 Ga0307516_10015410 3300031730 Bacteria 8046
311 Ga0307516_10069884 3300031730 Bacteria 3376
312 Ga0307516_10116230 3300031730 Bacteria 2471
313 Ga0307405_10166575 3300031731 Bacteria 1567
314 Ga0307405_10195286 3300031731 Bacteria 1465
315 Ga0307405_10219338 3300031731 Bacteria 1394
316 Ga0307413_10263934 3300031824 Bacteria 1285
317 Ga0307406_10149555 3300031901 Bacteria 1664
318 Ga0307406_10275373 3300031901 Bacteria 1281
319 Ga0307406_10357732 3300031901 Bacteria 1143
320 Ga0307407_10128069 3300031903 Bacteria 1620
321 Ga0307409_100151529 3300031995 Bacteria 2014
322 Ga0307416_100065036 3300032002 Bacteria 2995
323 Ga0307416_100108744 3300032002 Bacteria 2437
324 Ga0307416_100913932 3300032002 Bacteria 978
325 Ga0307411_10146243 3300032005 Bacteria 1750
326 Ga0307415_100027420 3300032126 Bacteria 3609
327 Ga0307415_100049870 3300032126 Bacteria 2833
328 Ga0307415_100181352 3300032126 Bacteria 1652
329 Ga0307510_10085661 3300033180 Bacteria 3026
330 Ga0307510_10085789 3300033180 Bacteria 3023
331 Ga0307510_10313971 3300033180 Bacteria 1026
332 Ga0373945_0044818 3300035116 Bacteria 1610
333 Ga0373945_0083527 3300035116 Bacteria 1227
334 Ga0373961_0036180 3300035241 Bacteria 1405
335 Ga0373927_0003420 3300035695 Bacteria 11388
336 Ga0373927_0045151 3300035695 Bacteria 2850
337 Ga0373927_0065661 3300035695 Bacteria 2347
338 Ga0373947_0010770 3300035725 Bacteria 5246
339 Ga0373937_0189600 3300036401 Bacteria 1932
340 Ga0373925_0005492 3300037068 Bacteria 9435
341 Ga0395900_0200092 3300037418 Bacteria 2022
342 Ga0395901_0138115 3300038443 Bacteria 2562
343 Ga0436362_1175193 3300039453 Bacteria 2098
344 Ga0439465_0022067 3300041413 Bacteria 2000
345 Ga0451791_0752091 3300041451 Bacteria 1855
346 Ga0451802_1149463 3300041460 Bacteria 1163
347 Ga0451853_1862669 3300041512 Bacteria 932
348 Ga0466969_0162482 3300044656 Unclassified 1026
349 Ga0466966_0011338 3300044684 Bacteria 5913
350 Ga0495603_0012801 3300046455 Bacteria 5073
351 Ga0495603_0021693 3300046455 Bacteria 3889
352 Ga0495603_0039170 3300046455 Bacteria 2841
353 Ga0495603_0250704 3300046455 Bacteria 1019
354 Ga0495590_0032240 3300046457 Bacteria 1832
355 Ga0495590_0071296 3300046457 Bacteria 1219
356 Ga0495638_0047525 3300046460 Bacteria 2690
357 Ga0495638_0050845 3300046460 Bacteria 2587
358 Ga0495638_0085731 3300046460 Bacteria 1904
359 Ga0495638_0148578 3300046460 Bacteria 1361
360 Ga0495641_0121163 3300046461 Bacteria 1167
361 Ga0495651_0185948 3300046462 Bacteria 1466
362 Ga0495650_0098660 3300046471 Bacteria 1100
363 Ga0495580_0071714 3300046472 Bacteria 2420
364 Ga0495580_0232958 3300046472 Bacteria 1264
365 Ga0495582_0049270 3300046473 Bacteria 2320
366 Ga0495605_0123184 3300046474 Bacteria 1174
367 Ga0495639_0061543 3300046475 Bacteria 1721
368 Ga0495662_0185420 3300046476 Bacteria 1026
369 Ga0495584_0085463 3300046491 Bacteria 1589
370 Ga0495585_0189347 3300046492 Bacteria 1053
371 Ga0495594_0055665 3300046499 Bacteria 2181
372 Ga0495594_0089925 3300046499 Bacteria 1720
373 Ga0495607_0216330 3300046501 Bacteria 940
374 Ga0495583_0039186 3300046506 Bacteria 2234
375 Ga0495606_0168818 3300046507 Bacteria 1271
376 Ga0495610_0033064 3300046512 Bacteria 2678
377 Ga0495610_0067534 3300046512 Bacteria 1679
378 Ga0495630_0216046 3300046517 Bacteria 1464
379 Ga0495630_0284315 3300046517 Bacteria 1264
380 Ga0495631_0074599 3300046518 Bacteria 1464
381 Ga0495632_0064523 3300046519 Bacteria 1770
382 Ga0495632_0105751 3300046519 Bacteria 1324
383 Ga0495632_0145023 3300046519 Bacteria 1100
384 Ga0495637_0030544 3300046520 Bacteria 2390
385 Ga0495643_0089645 3300046522 Bacteria 1588
386 Ga0495643_0225890 3300046522 Bacteria 885
387 Ga0495644_0086148 3300046523 Bacteria 1184
388 Ga0495648_0000576 3300046524 Bacteria 39297
389 Ga0495663_0097870 3300046525 Bacteria 963
390 Ga0495666_0147459 3300046526 Bacteria 1095
391 Ga0495587_0284934 3300046536 Bacteria 925
392 Ga0495597_0083498 3300046542 Bacteria 1364
393 Ga0495622_0066110 3300046557 Bacteria 1671
394 Ga0495656_0041164 3300046615 Bacteria 1929
395 Ga0495656_0080961 3300046615 Bacteria 1465
396 Ga0495656_0155470 3300046615 Bacteria 1108
397 Ga0495668_0070445 3300046616 Bacteria 1922
398 Ga0495668_0162998 3300046616 Bacteria 1221
399 Ga0495611_0052890 3300046648 Bacteria 1832
400 Ga0495611_0075662 3300046648 Bacteria 1543
401 Ga0495625_0085123 3300046660 Bacteria 2195
402 Ga0495625_0205076 3300046660 Bacteria 1299
403 Ga0495625_0229541 3300046660 Bacteria 1213
404 Ga0495659_0025621 3300046664 Bacteria 2020
405 Ga0495657_0087559 3300046675 Bacteria 2004
406 Ga0495669_0005897 3300046684 Bacteria 5106
407 Ga0495669_0062139 3300046684 Bacteria 1692
408 Ga0495669_0091850 3300046684 Bacteria 1402
409 Ga0495670_0110785 3300046691 Bacteria 1420
410 Ga0495670_0293277 3300046691 Bacteria 871
411 Ga0495649_0084992 3300046694 Bacteria 1689
412 Ga0495649_0104594 3300046694 Bacteria 1503
413 Ga0495649_0134965 3300046694 Bacteria 1301
414 Ga0495589_0031001 3300046794 Bacteria 2692
415 Ga0495660_0128985 3300046810 Bacteria 1271
416 Ga0495581_0096525 3300047315 Bacteria 1716
417 Ga0495636_0021129 3300047318 Bacteria 2627
418 Ga0495636_0025913 3300047318 Bacteria 2383
419 Ga0495636_0055700 3300047318 Bacteria 1663
420 Ga0495672_0052925 3300047320 Bacteria 2382
421 Ga0495676_0129381 3300047321 Bacteria 1825
422 Ga0495680_0142686 3300047322 Bacteria 1751
423 Ga0495686_0033084 3300047472 Bacteria 3341
424 Ga0495686_0193056 3300047472 Bacteria 1173
425 Ga0495686_0194277 3300047472 Bacteria 1168
426 Ga0495686_0336535 3300047472 Bacteria 824
427 Ga0496100_0010222 3300048903 Bacteria 5307
428 Ga0496100_0107089 3300048903 Bacteria 1936
429 Ga0496100_0233263 3300048903 Bacteria 1355
430 Ga0496101_0006680 3300048904 Bacteria 7437
431 Ga0496101_0382443 3300048904 Bacteria 1107
432 Ga0496102_0002920 3300048905 Bacteria 14499
433 Ga0496102_0232526 3300048905 Bacteria 1738
434 Ga0496102_0585806 3300048905 Bacteria 1038
435 Ga0496102_0662785 3300048905 Bacteria 966
436 Ga0496103_0013542 3300048906 Bacteria 4837
437 Ga0496103_0023473 3300048906 Bacteria 3719
438 Ga0496103_0172208 3300048906 Bacteria 1390
439 Ga0496103_0283883 3300048906 Bacteria 1065
440 Ga0496104_0012479 3300048907 Bacteria 7642
441 Ga0496105_0007112 3300048908 Bacteria 8634
442 Ga0496105_0061036 3300048908 Bacteria 3110
443 Ga0496105_0082115 3300048908 Bacteria 2662
444 Ga0496105_0205121 3300048908 Bacteria 1608
445 Ga0496106_0179074 3300048909 Bacteria 1682
446 Ga0496106_0232090 3300048909 Bacteria 1473
447 Ga0496106_0246052 3300048909 Bacteria 1429
448 Ga0496107_0009657 3300048910 Bacteria 6691
449 Ga0496107_0110169 3300048910 Bacteria 2023
450 Ga0496108_0037489 3300048911 Bacteria 4038
451 Ga0496108_0068822 3300048911 Bacteria 2986
452 Ga0496108_0095423 3300048911 Bacteria 2532
453 Ga0496108_0106926 3300048911 Bacteria 2389
454 Ga0496109_0002712 3300048912 Bacteria 14835
455 Ga0496109_0048791 3300048912 Bacteria 3852
456 Ga0496109_0179801 3300048912 Bacteria 1986
457 Ga0496110_0007239 3300048913 Bacteria 8842
458 Ga0496110_0125938 3300048913 Bacteria 2311
459 Ga0496110_0159390 3300048913 Bacteria 2045
460 Ga0496111_0021936 3300048914 Bacteria 4465
461 Ga0496111_0023020 3300048914 Bacteria 4369
462 Ga0496111_0105096 3300048914 Bacteria 2077
463 Ga0496111_0127795 3300048914 Bacteria 1880
464 Ga0496112_0089821 3300048915 Bacteria 3040
465 Ga0496112_0306415 3300048915 Bacteria 1533
466 Ga0496113_0003010 3300048916 Bacteria 9981
467 Ga0496113_0043625 3300048916 Bacteria 3319
468 Ga0496114_0015585 3300048917 Bacteria 6111
469 Ga0496114_0060407 3300048917 Bacteria 3168
470 Ga0496114_0168650 3300048917 Bacteria 1907
471 Ga0496114_0439277 3300048917 Bacteria 1156
472 Ga0496115_0000800 3300048918 Bacteria 23066
473 Ga0496115_0005721 3300048918 Bacteria 9050
474 Ga0496115_0034674 3300048918 Bacteria 3988
475 Ga0496115_0144181 3300048918 Bacteria 1965
476 Ga0496117_0134654 3300048920 Bacteria 1491
477 Ga0496117_0151672 3300048920 Bacteria 1371
478 Ga0496121_0000265 3300048924 Bacteria 109251
479 Ga0496121_0006145 3300048924 Bacteria 15075
480 Ga0496121_0057740 3300048924 Bacteria 3214
481 Ga0496121_0212448 3300048924 Bacteria 1369
482 Ga0496121_0263469 3300048924 Bacteria 1188
483 Ga0496121_0296789 3300048924 Bacteria 1098
484 Ga0496124_0048488 3300048927 Bacteria 3629
485 Ga0496124_0282804 3300048927 Bacteria 1208
486 Ga0496126_0025583 3300048929 Bacteria 5674
487 Ga0496126_0033541 3300048929 Bacteria 4828
488 Ga0496126_0069840 3300048929 Bacteria 3131
489 Ga0496126_0140153 3300048929 Bacteria 2082
490 Ga0496126_0251608 3300048929 Bacteria 1472
491 Ga0495682_0065200 3300049460 Bacteria 1313
492 Ga0501071_0065848 3300049587 Bacteria 2632
493 Ga0501071_0115453 3300049587 Bacteria 1987
494 Ga0501079_0405211 3300049741 Bacteria 1070
495 nmdc:mga03n38_104507_c1 3300050490 Bacteria 1370
496 nmdc:mga00v17_214834_c1 3300050491 Bacteria 1245
497 nmdc:mga0yw44_164717_c1 3300050492 Bacteria 1453
498 nmdc:mga0k408_262791_c1 3300050493 Bacteria 1031
499 nmdc:mga06z11_178669_c1 3300050494 Bacteria 1223
500 nmdc:mga07m45_19528_c1 3300050496 Bacteria 3673
501 nmdc:mga07m45_286905_c1 3300050496 Bacteria 957
502 nmdc:mga08y16_480994_c1 3300050511 Bacteria 1263
503 nmdc:mga0n895_147850_c1 3300050512 Bacteria 2379
504 nmdc:mga0rr50_244091_c1 3300050513 Bacteria 1489
505 Ga0495612_0119757 3300053078 Bacteria 1132
506 Ga0495595_0005066 3300053084 Bacteria 5323
507 Ga0495595_0142639 3300053084 Bacteria 1176
508 Ga0495619_0276802 3300053085 Bacteria 1163
509 Ga0500583_0060785 3300053092 Bacteria 1782
510 Ga0500583_0092618 3300053092 Bacteria 1472
511 Ga0500651_0138688 3300053093 Bacteria 1467
512 Ga0500641_0027077 3300053096 Bacteria 2230
513 Ga0500650_0084022 3300053098 Bacteria 1489
514 Ga0500555_064922 3300053103 Bacteria 974
515 Ga0500594_0013622 3300053118 Bacteria 1935
516 Ga0500595_005628 3300053119 Bacteria 5447
517 Ga0500595_011695 3300053119 Bacteria 3421
518 Ga0500642_0006973 3300053130 Bacteria 3766
519 Ga0500655_019884 3300053133 Bacteria 1252
520 Ga0500658_0030245 3300053134 Bacteria 2110
521 Ga0500561_0043160 3300053137 Bacteria 1200
522 Ga0500568_0005053 3300053139 Bacteria 6910
523 Ga0500568_0045154 3300053139 Bacteria 1755
524 Ga0500577_0085877 3300053142 Bacteria 1263
525 Ga0500589_081867 3300053147 Bacteria 1439
526 Ga0500604_0032851 3300053151 Bacteria 1531
527 Ga0500604_0058882 3300053151 Bacteria 1202
528 Ga0500622_0113284 3300053156 Bacteria 1323
529 Ga0500627_0035399 3300053158 Bacteria 2121
530 Ga0500627_0055648 3300053158 Bacteria 1733
531 Ga0500633_0010034 3300053160 Bacteria 2516
532 Ga0500634_0070622 3300053161 Bacteria 1828
533 Ga0500634_0091228 3300053161 Bacteria 1545
534 Ga0500636_0112591 3300053177 Bacteria 1536
535 Ga0500611_013612 3300053727 Bacteria 1400
536 Ga0500645_005343 3300053730 Bacteria 4751
537 Ga0501082_0375852 3300060353 Bacteria 1240
538 2513677211 2513237098 Bacteria 9902361
539 2513716412 2513237104 Bacteria 10034502
540 2879116749 2879110137 Bacteria 8907982
541 2903751072 2903748898 Bacteria 9972761
542 2908745814 2908739725 Bacteria 8628932
543 2908763794 2908756301 Bacteria 8864324
544 2922433101
545 8006970072 8006964411 Bacteria 8966052
546 8006986285 8006984368 Bacteria 9651211
547 8006998958 8006994254 Bacteria 8309700
548 8019563671 8019555841 Bacteria 9642137
549 8019573740 8019565922 Bacteria 9639779
550 8056675420 8056673599 Bacteria 7871253
551 Ga0307515_10181371
552 JGI24742J22300_10025312
553 JGI25153J46596_10006996
554 JGI25153J46596_10012090
555 JGI25404J52841_10008618
556 Ga0070658_10041489
557 Ga0070658_10145775
558 Ga0070658_10229457
559 Ga0070683_100094445
560 Ga0070683_100347917
561 Ga0070690_100282828
562 Ga0068869_100114405
563 Ga0068869_100115681
564 Ga0070666_10351599
565 Ga0070680_100022476
566 Ga0070680_100059093
567 Ga0070682_100220138
568 Ga0070682_100256815
569 Ga0068868_100068385
570 Ga0070689_100149894
571 Ga0070668_100184816
572 Ga0070675_100173102
573 Ga0070671_100351146
574 Ga0070674_100100315
575 Ga0070674_100214334
576 Ga0070673_100070509
577 Ga0070673_100278332
578 Ga0070688_100159459
579 Ga0070659_100210898
580 Ga0070667_100243138
581 Ga0070703_10073553
582 Ga0070714_100140008
583 Ga0070713_100008690
584 Ga0070713_100214143
585 Ga0070710_10437157
586 Ga0070701_10147483
587 Ga0070700_100262805
588 Ga0070663_100005020
589 Ga0070663_100051467
590 Ga0070663_100072740
591 Ga0070663_100247590
592 Ga0070663_100307106
593 Ga0070663_100312358
594 Ga0070678_100075591
595 Ga0070678_100100408
596 Ga0070678_100431259
597 Ga0070681_10104922
598 Ga0070681_10557714
599 Ga0068867_100227041
600 Ga0070685_10149764
601 Ga0070679_100069219
602 Ga0068853_100007138
603 Ga0068853_100133453
604 Ga0068853_100289658
605 Ga0070672_100266532
606 Ga0070665_100052243
607 Ga0070665_100373734
608 Ga0070665_100493513
609 Ga0070665_100674455
610 Ga0070665_100789068
611 Ga0068855_100065667
612 Ga0068855_100633089
613 Ga0070664_100060422
614 Ga0070664_100622841
615 Ga0070702_100077149
616 Ga0068852_100589137
617 Ga0068859_100127160
618 Ga0068859_100225216
619 Ga0068859_100394116
620 Ga0068866_10162194
621 Ga0068861_100079985
622 Ga0068861_100127206
623 Ga0068861_100325691
624 Ga0068861_100413106
625 Ga0068851_10034253
626 Ga0068870_10015585
627 Ga0068870_10038319
628 Ga0068870_10109822
629 Ga0068870_10157234
630 Ga0068863_100049022
631 Ga0068858_100471060
632 Ga0068860_100254582
633 Ga0068860_100654575
634 Ga0068862_100134308
635 Ga0068862_100206435
636 Ga0068862_100305556
637 Ga0068862_100340729
638 Ga0081455_10073323
639 Ga0081538_10016437
640 Ga0081540_1001390
641 Ga0081540_1002860
642 Ga0081540_1014001
643 Ga0081540_1019312
644 Ga0081540_1033767
645 Ga0081540_1106951
646 Ga0081539_10021878
647 Ga0075365_10117336
648 Ga0075368_10006773
649 Ga0075363_100150076
650 Ga0075364_10234062
651 Ga0070716_100022666
652 Ga0070712_100003085
653 Ga0070712_100086499
654 Ga0075367_10178581
655 Ga0075369_10062367
656 Ga0097621_100294512
657 Ga0075370_10076266
658 Ga0075370_10175736
659 Ga0068871_100293735
660 Ga0068865_100261363
661 Ga0075436_100366050
662 Ga0097620_100127150
663 Ga0097620_100225225
664 Ga0097620_100394098
665 Ga0099794_10011830
666 Ga0099795_10006150
667 Ga0105240_10262772
668 Ga0105240_10433044
669 Ga0111539_10106243
670 Ga0111539_10541507
671 Ga0105245_10339864
672 Ga0105245_10383950
673 Ga0105245_10658827
674 Ga0105247_10079178
675 Ga0105243_10201368
676 Ga0105243_10241988
677 Ga0105243_10306971
678 Ga0105241_10027767
679 Ga0105241_10159560
680 Ga0105242_10055369
681 Ga0105242_10404233
682 Ga0105242_10909034
683 Ga0105248_10094526
684 Ga0105248_10262840
685 Ga0105248_10268785
686 Ga0105237_10005657
687 Ga0105237_10100715
688 Ga0105238_10056071
689 Ga0105238_10549331
690 Ga0105238_10790023
691 Ga0099796_10002883
692 Ga0099796_10102618
693 Ga0105239_10066387
694 Ga0105239_10200144
695 Ga0105239_10237957
696 Ga0105246_10029910
697 Ga0105246_10143673
698 Ga0105246_10363215
699 Ga0157370_10145487
700 Ga0157369_10042536
701 Ga0157374_10105820
702 Ga0157374_10110066
703 Ga0157374_10327847
704 Ga0157378_10053618
705 Ga0157378_10561323
706 Ga0157378_10646681
707 Ga0157378_10657005
708 Ga0157378_10676700
709 Ga0163162_10018380
710 Ga0163162_10227665
711 Ga0163162_10294940
712 Ga0163162_10562986
713 Ga0163162_10765826
714 Ga0157372_10563796
715 Ga0157375_10232985
716 Ga0163163_10032871
717 Ga0163163_10126249
718 Ga0163163_10441592
719 Ga0157380_10119221
720 Ga0157380_10316106
721 Ga0157380_10327646
722 Ga0157380_10358509
723 Ga0157380_10872431
724 Ga0157377_10111529
725 Ga0157376_10042381
726 Ga0163161_10074667
727 Ga0163161_10172969
728 Ga0163161_10230802
729 Ga0163161_10266754
730 Ga0209233_1001365
731 Ga0209758_1002230
732 Ga0209758_1033090
733 Ga0207697_10100905
734 Ga0207697_10129019
735 Ga0207656_10010842
736 Ga0207653_10035198
737 Ga0207692_10037835
738 Ga0207642_10176486
739 Ga0207710_10046544
740 Ga0207688_10027813
741 Ga0207688_10039675
742 Ga0207680_10039387
743 Ga0207645_10147509
744 Ga0207645_10276184
745 Ga0207643_10117729
746 Ga0207705_10028830
747 Ga0207705_10326908
748 Ga0207654_10233028
749 Ga0207707_10002973
750 Ga0207671_10016779
751 Ga0207671_10457800
752 Ga0207693_10016864
753 Ga0207663_10035488
754 Ga0207660_10011895
755 Ga0207660_10031403
756 Ga0207657_10056503
757 Ga0207657_10170485
758 Ga0207657_10420054
759 Ga0207649_10063431
760 Ga0207652_10079420
761 Ga0207681_10252091
762 Ga0207681_10468704
763 Ga0207694_10385267
764 Ga0207650_10579737
765 Ga0207659_10232462
766 Ga0207659_10236479
767 Ga0207687_10077089
768 Ga0207690_10254532
769 Ga0207706_10150048
770 Ga0207706_10408395
771 Ga0207706_10517214
772 Ga0207709_10130718
773 Ga0207670_10232756
774 Ga0207669_10153707
775 Ga0207669_10200696
776 Ga0207704_10269930
777 Ga0207704_10278826
778 Ga0207691_10337004
779 Ga0207691_10367130
780 Ga0207711_10183697
781 Ga0207689_10158151
782 Ga0207689_10177553
783 Ga0207689_10557139
784 Ga0207661_10073487
785 Ga0207679_10066678
786 Ga0207679_10237082
787 Ga0207667_10137562
788 Ga0207651_10087416
789 Ga0207651_10375007
790 Ga0207712_10058302
791 Ga0207712_10215229
792 Ga0207712_10304364
793 Ga0207712_10462229
794 Ga0207668_10115565
795 Ga0207668_10169555
796 Ga0207640_10421875
797 Ga0207640_10443859
798 Ga0207658_10439371
799 Ga0207677_10021101
800 Ga0207677_10041309
801 Ga0207677_10169183
802 Ga0207677_10363616
803 Ga0207677_10639887
804 Ga0207703_10042157
805 Ga0207639_10002921
806 Ga0207639_10180311
807 Ga0207639_10378271
808 Ga0207678_10014798
809 Ga0207678_10028543
810 Ga0207678_10091159
811 Ga0207678_10115662
812 Ga0207678_10142386
813 Ga0207678_10363201
814 Ga0207678_10645019
815 Ga0207708_10188445
816 Ga0207708_10231214
817 Ga0207708_10314585
818 Ga0207641_10124569
819 Ga0207648_10038357
820 Ga0207648_10235299
821 Ga0207648_10312804
822 Ga0207648_10518011
823 Ga0207676_10436088
824 Ga0207674_10010835
825 Ga0207674_10165089
826 Ga0207675_100164653
827 Ga0207675_100186364
828 Ga0207675_100256285
829 Ga0207675_100323676
830 Ga0207683_10046018
831 Ga0207683_10087486
832 Ga0207683_10105119
833 Ga0207683_10200196
834 Ga0207683_10291662
835 Ga0207698_10200747
836 Ga0209179_1001706
837 Ga0209588_1008501
838 Ga0207428_10172412
839 Ga0268266_10003479
840 Ga0268266_10019404
841 Ga0268266_10085290
842 Ga0268266_10089728
843 Ga0268266_10134390
844 Ga0268266_10170525
845 Ga0268266_10328768
846 Ga0268265_10011119
847 Ga0268265_10109028
848 Ga0268265_10134979
849 Ga0268265_10190547
850 Ga0268264_10348554
851 Ga0268264_10417292
852 Ga0307517_10000098
853 Ga0307515_10053162
854 Ga0265330_10026959
855 Ga0265331_10081084
856 Ga0307513_10041234
857 Ga0307509_10322652
858 Ga0307408_100396553
859 Ga0307508_10198865
860 Ga0307516_10015410
861 Ga0307516_10069884
862 Ga0307516_10116230
863 Ga0307405_10166575
864 Ga0307405_10195286
865 Ga0307405_10219338
866 Ga0307413_10263934
867 Ga0307406_10149555
868 Ga0307406_10275373
869 Ga0307406_10357732
870 Ga0307407_10128069
871 Ga0307409_100151529
872 Ga0307416_100065036
873 Ga0307416_100108744
874 Ga0307416_100913932
875 Ga0307411_10146243
876 Ga0307415_100027420
877 Ga0307415_100049870
878 Ga0307415_100181352
879 Ga0307510_10085661
880 Ga0307510_10085789
881 Ga0307510_10313971
882 Ga0373945_0044818
883 Ga0373945_0083527
884 Ga0373961_0036180
885 Ga0373927_0003420
886 Ga0373927_0045151
887 Ga0373927_0065661
888 Ga0373947_0010770
889 Ga0373937_0189600
890 Ga0373925_0005492
891 Ga0395900_0200092
892 Ga0395901_0138115
893 Ga0436362_1175193
894 Ga0439465_0022067
895 Ga0451791_0752091
896 Ga0451802_1149463
897 Ga0451853_1862669
898 Ga0466969_0162482
899 Ga0466966_0011338
900 Ga0495603_0012801
901 Ga0495603_0021693
902 Ga0495603_0039170
903 Ga0495603_0250704
904 Ga0495590_0032240
905 Ga0495590_0071296
906 Ga0495638_0047525
907 Ga0495638_0050845
908 Ga0495638_0085731
909 Ga0495638_0148578
910 Ga0495641_0121163
911 Ga0495651_0185948
912 Ga0495650_0098660
913 Ga0495580_0071714
914 Ga0495580_0232958
915 Ga0495582_0049270
916 Ga0495605_0123184
917 Ga0495639_0061543
918 Ga0495662_0185420
919 Ga0495584_0085463
920 Ga0495585_0189347
921 Ga0495594_0055665
922 Ga0495594_0089925
923 Ga0495607_0216330
924 Ga0495583_0039186
925 Ga0495606_0168818
926 Ga0495610_0033064
927 Ga0495610_0067534
928 Ga0495630_0216046
929 Ga0495630_0284315
930 Ga0495631_0074599
931 Ga0495632_0064523
932 Ga0495632_0105751
933 Ga0495632_0145023
934 Ga0495637_0030544
935 Ga0495643_0089645
936 Ga0495643_0225890
937 Ga0495644_0086148
938 Ga0495648_0000576
939 Ga0495663_0097870
940 Ga0495666_0147459
941 Ga0495587_0284934
942 Ga0495597_0083498
943 Ga0495622_0066110
944 Ga0495656_0041164
945 Ga0495656_0080961
946 Ga0495656_0155470
947 Ga0495668_0070445
948 Ga0495668_0162998
949 Ga0495611_0052890
950 Ga0495611_0075662
951 Ga0495625_0085123
952 Ga0495625_0205076
953 Ga0495625_0229541
954 Ga0495659_0025621
955 Ga0495657_0087559
956 Ga0495669_0005897
957 Ga0495669_0062139
958 Ga0495669_0091850
959 Ga0495670_0110785
960 Ga0495670_0293277
961 Ga0495649_0084992
962 Ga0495649_0104594
963 Ga0495649_0134965
964 Ga0495589_0031001
965 Ga0495660_0128985
966 Ga0495581_0096525
967 Ga0495636_0021129
968 Ga0495636_0025913
969 Ga0495636_0055700
970 Ga0495672_0052925
971 Ga0495676_0129381
972 Ga0495680_0142686
973 Ga0495686_0033084
974 Ga0495686_0193056
975 Ga0495686_0194277
976 Ga0495686_0336535
977 Ga0496100_0010222
978 Ga0496100_0107089
979 Ga0496100_0233263
980 Ga0496101_0006680
981 Ga0496101_0382443
982 Ga0496102_0002920
983 Ga0496102_0232526
984 Ga0496102_0585806
985 Ga0496102_0662785
986 Ga0496103_0013542
987 Ga0496103_0023473
988 Ga0496103_0172208
989 Ga0496103_0283883
990 Ga0496104_0012479
991 Ga0496105_0007112
992 Ga0496105_0061036
993 Ga0496105_0082115
994 Ga0496105_0205121
995 Ga0496106_0179074
996 Ga0496106_0232090
997 Ga0496106_0246052
998 Ga0496107_0009657
999 Ga0496107_0110169
1000 Ga0496108_0037489
1001 Ga0496108_0068822
1002 Ga0496108_0095423
1003 Ga0496108_0106926
1004 Ga0496109_0002712
1005 Ga0496109_0048791
1006 Ga0496109_0179801
1007 Ga0496110_0007239
1008 Ga0496110_0125938
1009 Ga0496110_0159390
1010 Ga0496111_0021936
1011 Ga0496111_0023020
1012 Ga0496111_0105096
1013 Ga0496111_0127795
1014 Ga0496112_0089821
1015 Ga0496112_0306415
1016 Ga0496113_0003010
1017 Ga0496113_0043625
1018 Ga0496114_0015585
1019 Ga0496114_0060407
1020 Ga0496114_0168650
1021 Ga0496114_0439277
1022 Ga0496115_0000800
1023 Ga0496115_0005721
1024 Ga0496115_0034674
1025 Ga0496115_0144181
1026 Ga0496117_0134654
1027 Ga0496117_0151672
1028 Ga0496121_0000265
1029 Ga0496121_0006145
1030 Ga0496121_0057740
1031 Ga0496121_0212448
1032 Ga0496121_0263469
1033 Ga0496121_0296789
1034 Ga0496124_0048488
1035 Ga0496124_0282804
1036 Ga0496126_0025583
1037 Ga0496126_0033541
1038 Ga0496126_0069840
1039 Ga0496126_0140153
1040 Ga0496126_0251608
1041 Ga0495682_0065200
1042 Ga0501071_0065848
1043 Ga0501071_0115453
1044 Ga0501079_0405211
1045 nmdc:mga03n38_104507_c1
1046 nmdc:mga00v17_214834_c1
1047 nmdc:mga0yw44_164717_c1
1048 nmdc:mga0k408_262791_c1
1049 nmdc:mga06z11_178669_c1
1050 nmdc:mga07m45_19528_c1
1051 nmdc:mga07m45_286905_c1
1052 nmdc:mga08y16_480994_c1
1053 nmdc:mga0n895_147850_c1
1054 nmdc:mga0rr50_244091_c1
1055 Ga0495612_0119757
1056 Ga0495595_0005066
1057 Ga0495595_0142639
1058 Ga0495619_0276802
1059 Ga0500583_0060785
1060 Ga0500583_0092618
1061 Ga0500651_0138688
1062 Ga0500641_0027077
1063 Ga0500650_0084022
1064 Ga0500555_064922
1065 Ga0500594_0013622
1066 Ga0500595_005628
1067 Ga0500595_011695
1068 Ga0500642_0006973
1069 Ga0500655_019884
1070 Ga0500658_0030245
1071 Ga0500561_0043160
1072 Ga0500568_0005053
1073 Ga0500568_0045154
1074 Ga0500577_0085877
1075 Ga0500589_081867
1076 Ga0500604_0032851
1077 Ga0500604_0058882
1078 Ga0500622_0113284
1079 Ga0500627_0035399
1080 Ga0500627_0055648
1081 Ga0500633_0010034
1082 Ga0500634_0070622
1083 Ga0500634_0091228
1084 Ga0500636_0112591
1085 Ga0500611_013612
1086 Ga0500645_005343
1087 Ga0501082_0375852
1088 2513677211
1089 2513716412
1090 2879116749
1091 2903751072
1092 2908745814
1093 2908763794
1094 2922433101
1095 8006970072
1096 8006986285
1097 8006998958
1098 8019563671
1099 8019573740
1100 8056675420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

70

196

0.89

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

74

188

0.83

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

76

204

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pf9-assembly1.cif.gz_A crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant 0.8342 46 263
7xrh-assembly1.cif.gz_A feruloyl esterase from lactobacillus acidophilus 0.8338 50 265
3pf8-assembly1.cif.gz_B crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 0.8317 50 265
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.8315 49 265
7q4h-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex with pmsf 0.8242 50 263
ID Description Score Start End Superfamily
af_Q7L211_70_310_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9355 49 257 3.40.50.1820
af_O76462_74_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9182 49 249 3.40.50.1820
af_Q54H73_43_283_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9151 40 263 3.40.50.1820
af_P54069_41_276_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9141 33 249 3.40.50.1820
af_I1MSD1_25_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9103 25 263 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A363TQX2-F1-model_v4 Alpha/beta hydrolase 0.9928 149 265 GO:0016020
GO:0016787
AF-A0A327JHZ6-F1-model_v4 Alpha/beta hydrolase 0.9844 145 263 GO:0016020
GO:0016787
AF-A0A363TQX2-F1-model_v4 Alpha/beta hydrolase 0.9844 149 265 GO:0016020
GO:0016787
AF-A0A1W9IEZ3-F1-model_v4 Alpha/beta hydrolase 0.9774 1 263 GO:0016020
GO:0016787
AF-A0A2D6TAL4-F1-model_v4 Alpha/beta hydrolase 0.975 2 263 GO:0016020
GO:0016787

Map