F462505

General Info

Members Datasets Scaffolds Average Seq Length
550 259 1100 365

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10053191|Ga0207705_100531913
Length 360
Sequence MLRLGIVGLPNVGKSTLFNALTSAGVLAANYPFATKEPNVGRVNVPDDRLDELARVVQPQRTVPAAVEFVDIAGLVEGASKGEGLGNQFLANIRETDAIVHVVRCFDDDDILHVMNGVDPVRDREVIEFELALADLSSVEKRLDRVKRSAKTGDKEALAKAHEFLKEGRGLWEAKLSAEEKATLKPLSLLTTKPILYAANVTDAELSGEEGKHLTALRKAVAASGEDAEVVPFSAKIESELAELPAEDRKDFLASLGLESAGLDRLIKAGFHLLGLQTYFTAGEQEVRAWTIHRGDTAPQAAGVIHTDFERGFIKAETAGYDDFVKNGGWKGVKEKGMMRQEGKEYVVKDGDVLLFRFNV

Samples

Sample ID Description Type Environment
1 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
236 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
239 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
243 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
244 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.91
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207705_10053191 3300025909 Bacteria 2916
2 JGI25406J46586_10011244 3300003203 Bacteria 3934
3 Ga0065715_10005720 3300005293 Bacteria 4006
4 Ga0065707_10200596 3300005295 Bacteria 1312
5 Ga0070658_10010517 3300005327 Bacteria 7414
6 Ga0070658_10040666 3300005327 Bacteria 3751
7 Ga0070658_10078827 3300005327 Bacteria 2704
8 Ga0070658_10122410 3300005327 Bacteria 2162
9 Ga0070683_100000343 3300005329 Bacteria 32006
10 Ga0070683_100000560 3300005329 Bacteria 26426
11 Ga0070683_100003422 3300005329 Bacteria 12878
12 Ga0070683_100006575 3300005329 Bacteria 9762
13 Ga0070683_100009769 3300005329 Bacteria 8220
14 Ga0070683_100016026 3300005329 Bacteria 6596
15 Ga0070683_100019382 3300005329 Bacteria 6041
16 Ga0070683_100037156 3300005329 Bacteria 4457
17 Ga0070683_100058205 3300005329 Bacteria 3591
18 Ga0070683_100100448 3300005329 Bacteria 2724
19 Ga0070683_100109192 3300005329 Bacteria 2609
20 Ga0070683_100171579 3300005329 Bacteria 2059
21 Ga0070683_100243657 3300005329 Bacteria 1710
22 Ga0070670_100011603 3300005331 Bacteria 7531
23 Ga0068869_100001434 3300005334 Bacteria 14132
24 Ga0070666_10097955 3300005335 Bacteria 2019
25 Ga0070680_100000057 3300005336 Bacteria 57308
26 Ga0070680_100005645 3300005336 Bacteria 9480
27 Ga0070680_100008448 3300005336 Bacteria 7883
28 Ga0070680_100043448 3300005336 Bacteria 3650
29 Ga0070680_100059648 3300005336 Bacteria 3122
30 Ga0070680_100066916 3300005336 Bacteria 2946
31 Ga0070680_100130951 3300005336 Bacteria 2099
32 Ga0070682_100001114 3300005337 Bacteria 15372
33 Ga0070682_100002485 3300005337 Bacteria 10182
34 Ga0070682_100008305 3300005337 Bacteria 5853
35 Ga0070682_100023460 3300005337 Bacteria 3662
36 Ga0068868_100030959 3300005338 Bacteria 4106
37 Ga0068868_100052698 3300005338 Bacteria 3203
38 Ga0068868_100065794 3300005338 Bacteria 2880
39 Ga0070660_100039432 3300005339 Bacteria 3590
40 Ga0070660_100231459 3300005339 Bacteria 1504
41 Ga0070689_100022281 3300005340 Bacteria 4729
42 Ga0070691_10017661 3300005341 Bacteria 3283
43 Ga0070691_10036546 3300005341 Bacteria 2315
44 Ga0070687_100002140 3300005343 Bacteria 7304
45 Ga0070687_100045432 3300005343 Bacteria 2243
46 Ga0070661_100003464 3300005344 Bacteria 10886
47 Ga0070661_100068440 3300005344 Bacteria 2609
48 Ga0070661_100080582 3300005344 Bacteria 2403
49 Ga0070669_100024251 3300005353 Bacteria 4349
50 Ga0070669_100048183 3300005353 Bacteria 3110
51 Ga0070675_100028484 3300005354 Bacteria 4495
52 Ga0070659_100001513 3300005366 Bacteria 16764
53 Ga0070667_100042717 3300005367 Bacteria 3804
54 Ga0070709_10131701 3300005434 Bacteria 1708
55 Ga0070714_100040786 3300005435 Bacteria 3914
56 Ga0070714_100049953 3300005435 Bacteria 3561
57 Ga0070714_100266833 3300005435 Bacteria 1586
58 Ga0070713_100017610 3300005436 Bacteria 5407
59 Ga0070713_100022974 3300005436 Bacteria 4829
60 Ga0070710_10021963 3300005437 Bacteria 3333
61 Ga0070700_100022048 3300005441 Bacteria 3709
62 Ga0070708_100000006 3300005445 Bacteria 150596
63 Ga0070708_100000202 3300005445 Bacteria 43614
64 Ga0070663_100021690 3300005455 Bacteria 4277
65 Ga0070663_100247625 3300005455 Bacteria 1409
66 Ga0070678_100008001 3300005456 Bacteria 6302
67 Ga0070678_100184983 3300005456 Bacteria 1709
68 Ga0070662_100016687 3300005457 Bacteria 4934
69 Ga0070681_10000675 3300005458 Bacteria 28271
70 Ga0070681_10003369 3300005458 Bacteria 14944
71 Ga0070681_10022420 3300005458 Bacteria 6341
72 Ga0070681_10023987 3300005458 Bacteria 6141
73 Ga0070681_10024903 3300005458 Bacteria 6021
74 Ga0070681_10026447 3300005458 Bacteria 5831
75 Ga0070681_10123363 3300005458 Bacteria 2523
76 Ga0070681_10381313 3300005458 Bacteria 1320
77 Ga0068867_100018229 3300005459 Bacteria 4988
78 Ga0070685_10001162 3300005466 Bacteria 14076
79 Ga0070685_10221188 3300005466 Bacteria 1241
80 Ga0070706_100030802 3300005467 Bacteria 4945
81 Ga0070706_100186552 3300005467 Bacteria 1938
82 Ga0070707_100212630 3300005468 Bacteria 1884
83 Ga0070698_100003060 3300005471 Bacteria 18440
84 Ga0070698_100037137 3300005471 Bacteria 5024
85 Ga0070699_100000916 3300005518 Bacteria 27468
86 Ga0070699_100102885 3300005518 Bacteria 2504
87 Ga0070679_100000476 3300005530 Bacteria 34246
88 Ga0070679_100001894 3300005530 Bacteria 18792
89 Ga0070679_100003050 3300005530 Bacteria 15311
90 Ga0070679_100006246 3300005530 Bacteria 11101
91 Ga0070679_100020569 3300005530 Bacteria 6436
92 Ga0070679_100023395 3300005530 Bacteria 6047
93 Ga0070679_100023520 3300005530 Bacteria 6032
94 Ga0070679_100031529 3300005530 Bacteria 5237
95 Ga0070679_100035006 3300005530 Bacteria 4980
96 Ga0070679_100053605 3300005530 Bacteria 4015
97 Ga0070679_100074230 3300005530 Bacteria 3392
98 Ga0070679_100089810 3300005530 Bacteria 3059
99 Ga0070679_100131149 3300005530 Bacteria 2488
100 Ga0070679_100292721 3300005530 Bacteria 1579
101 Ga0070684_100000577 3300005535 Bacteria 25373
102 Ga0070684_100000876 3300005535 Bacteria 21239
103 Ga0070684_100074233 3300005535 Bacteria 2998
104 Ga0070684_100134156 3300005535 Bacteria 2235
105 Ga0070684_100229349 3300005535 Bacteria 1695
106 Ga0070684_100247684 3300005535 Bacteria 1628
107 Ga0070697_100239356 3300005536 Bacteria 1549
108 Ga0068853_100036806 3300005539 Bacteria 4162
109 Ga0070672_100002361 3300005543 Bacteria 11941
110 Ga0070686_100004409 3300005544 Bacteria 7766
111 Ga0070696_100044472 3300005546 Bacteria 3075
112 Ga0070696_100217763 3300005546 Bacteria 1431
113 Ga0070693_100035938 3300005547 Bacteria 2751
114 Ga0070693_100050274 3300005547 Bacteria 2382
115 Ga0068855_100015918 3300005563 Bacteria 9046
116 Ga0068855_100042197 3300005563 Bacteria 5405
117 Ga0068855_100042498 3300005563 Bacteria 5385
118 Ga0068855_100094171 3300005563 Bacteria 3454
119 Ga0070664_100012101 3300005564 Bacteria 7009
120 Ga0070664_100019352 3300005564 Bacteria 5602
121 Ga0070664_100025125 3300005564 Bacteria 4935
122 Ga0070664_100057287 3300005564 Bacteria 3312
123 Ga0068857_100002362 3300005577 Bacteria 15385
124 Ga0068857_100009102 3300005577 Bacteria 8614
125 Ga0068854_100001049 3300005578 Bacteria 16608
126 Ga0068856_100005302 3300005614 Bacteria 12723
127 Ga0068856_100006140 3300005614 Bacteria 11793
128 Ga0070702_100007905 3300005615 Bacteria 5119
129 Ga0068852_100005605 3300005616 Bacteria 9003
130 Ga0068852_100111993 3300005616 Bacteria 2482
131 Ga0068859_100003856 3300005617 Bacteria 15320
132 Ga0068859_100156259 3300005617 Bacteria 2358
133 Ga0068864_100002576 3300005618 Bacteria 14971
134 Ga0068864_100119600 3300005618 Bacteria 2354
135 Ga0068851_10019500 3300005834 Bacteria 3276
136 Ga0068870_10053113 3300005840 Bacteria 2151
137 Ga0068858_100052896 3300005842 Bacteria 3758
138 Ga0068860_100053708 3300005843 Bacteria 3830
139 Ga0068862_100000229 3300005844 Bacteria 62419
140 Ga0081539_10000075 3300005985 Bacteria 229419
141 Ga0070717_10001809 3300006028 Bacteria 14941
142 Ga0070712_100050416 3300006175 Bacteria 2896
143 Ga0070712_100059702 3300006175 Bacteria 2687
144 Ga0097621_100009333 3300006237 Bacteria 7122
145 Ga0097621_100116034 3300006237 Bacteria 2267
146 Ga0068871_100029871 3300006358 Bacteria 4286
147 Ga0075430_100005139 3300006846 Bacteria 11017
148 Ga0075430_100034365 3300006846 Bacteria 4303
149 Ga0075430_100090743 3300006846 Bacteria 2555
150 Ga0075431_100011295 3300006847 Bacteria 8996
151 Ga0075431_100025634 3300006847 Bacteria 6044
152 Ga0075433_10149719 3300006852 Bacteria 2076
153 Ga0075434_100162322 3300006871 Bacteria 2254
154 Ga0075429_100176939 3300006880 Bacteria 1869
155 Ga0068865_100013101 3300006881 Bacteria 5232
156 Ga0075436_100009882 3300006914 Bacteria 6526
157 Ga0075436_100018991 3300006914 Bacteria 4707
158 Ga0075436_100053976 3300006914 Bacteria 2774
159 Ga0097620_100003856 3300006931 Bacteria 15320
160 Ga0097620_100156261 3300006931 Bacteria 2358
161 Ga0105240_10005300 3300009093 Bacteria 19241
162 Ga0105240_10050934 3300009093 Bacteria 5215
163 Ga0105240_10062991 3300009093 Bacteria 4615
164 Ga0105240_10093084 3300009093 Bacteria 3679
165 Ga0105240_10141068 3300009093 Bacteria 2881
166 Ga0105240_10292591 3300009093 Bacteria 1866
167 Ga0111539_10412629 3300009094 Bacteria 1573
168 Ga0105245_10026305 3300009098 Bacteria 5121
169 Ga0105245_10028680 3300009098 Bacteria 4912
170 Ga0105245_10139043 3300009098 Bacteria 2285
171 Ga0105245_10208885 3300009098 Bacteria 1878
172 Ga0105245_10231166 3300009098 Bacteria 1789
173 Ga0105245_10263288 3300009098 Bacteria 1679
174 Ga0105243_10349185 3300009148 Bacteria 1358
175 Ga0105241_10000119 3300009174 Bacteria 57097
176 Ga0105241_10052728 3300009174 Bacteria 3107
177 Ga0105241_10241355 3300009174 Bacteria 1528
178 Ga0105248_10031991 3300009177 Bacteria 5878
179 Ga0105248_10059976 3300009177 Bacteria 4272
180 Ga0105248_10077679 3300009177 Bacteria 3732
181 Ga0105237_10086261 3300009545 Bacteria 3129
182 Ga0105237_10102348 3300009545 Bacteria 2856
183 Ga0105238_10142590 3300009551 Bacteria 2373
184 Ga0105249_10000179 3300009553 Bacteria 74358
185 Ga0105249_10146031 3300009553 Bacteria 2273
186 Ga0099796_10035924 3300010159 Bacteria 1647
187 Ga0105239_10045864 3300010375 Bacteria 4790
188 Ga0105239_10378186 3300010375 Bacteria 1601
189 Ga0105246_10004468 3300011119 Bacteria 8508
190 Ga0157373_10003998 3300013100 Bacteria 11120
191 Ga0157373_10011442 3300013100 Bacteria 6526
192 Ga0157373_10031441 3300013100 Bacteria 3822
193 Ga0157373_10038255 3300013100 Bacteria 3439
194 Ga0157373_10089332 3300013100 Bacteria 2170
195 Ga0157371_10196145 3300013102 Bacteria 1446
196 Ga0157370_10007586 3300013104 Bacteria 11784
197 Ga0157370_10011187 3300013104 Bacteria 9409
198 Ga0157370_10043910 3300013104 Bacteria 4300
199 Ga0157370_10043916 3300013104 Bacteria 4299
200 Ga0157370_10075274 3300013104 Bacteria 3183
201 Ga0157370_10148313 3300013104 Bacteria 2184
202 Ga0157370_10161922 3300013104 Bacteria 2081
203 Ga0157369_10066330 3300013105 Bacteria 3883
204 Ga0157369_10195474 3300013105 Bacteria 2124
205 Ga0157369_10460366 3300013105 Bacteria 1317
206 Ga0157374_10027392 3300013296 Bacteria 5140
207 Ga0157374_10065993 3300013296 Bacteria 3400
208 Ga0157378_10002297 3300013297 Bacteria 16992
209 Ga0157378_10346707 3300013297 Bacteria 1450
210 Ga0157372_10004267 3300013307 Bacteria 15285
211 Ga0157372_10014739 3300013307 Bacteria 8367
212 Ga0157372_10018674 3300013307 Bacteria 7460
213 Ga0157372_10031647 3300013307 Bacteria 5792
214 Ga0157372_10034911 3300013307 Bacteria 5534
215 Ga0157372_10040552 3300013307 Bacteria 5143
216 Ga0157372_10070206 3300013307 Bacteria 3941
217 Ga0157372_10070879 3300013307 Bacteria 3923
218 Ga0157372_10083145 3300013307 Bacteria 3626
219 Ga0157372_10130101 3300013307 Bacteria 2895
220 Ga0157372_10250858 3300013307 Bacteria 2054
221 Ga0157372_10514466 3300013307 Bacteria 1396
222 Ga0157375_10014340 3300013308 Bacteria 7067
223 Ga0157375_10073048 3300013308 Bacteria 3448
224 Ga0157375_10444183 3300013308 Bacteria 1463
225 Ga0157375_10507370 3300013308 Bacteria 1370
226 Ga0163163_10003224 3300014325 Bacteria 13827
227 Ga0163163_10023575 3300014325 Bacteria 5843
228 Ga0163163_10186213 3300014325 Bacteria 2124
229 Ga0157377_10012310 3300014745 Bacteria 4298
230 Ga0157376_10083005 3300014969 Bacteria 2755
231 Ga0206356_11386822 3300020070 Bacteria 1646
232 Ga0213876_10033105 3300021384 Bacteria 2725
233 Ga0213876_10038514 3300021384 Bacteria 2524
234 Ga0213876_10056882 3300021384 Bacteria 2065
235 Ga0207656_10038999 3300025321 Bacteria 2007
236 Ga0207692_10025112 3300025898 Bacteria 2779
237 Ga0207645_10047412 3300025907 Bacteria 2744
238 Ga0207643_10010715 3300025908 Bacteria 4940
239 Ga0207705_10009989 3300025909 Bacteria 6909
240 Ga0207705_10030624 3300025909 Bacteria 3839
241 Ga0207705_10059728 3300025909 Bacteria 2752
242 Ga0207654_10002560 3300025911 Bacteria 9226
243 Ga0207654_10040694 3300025911 Bacteria 2620
244 Ga0207707_10001765 3300025912 Bacteria 19859
245 Ga0207707_10002124 3300025912 Bacteria 17943
246 Ga0207707_10003616 3300025912 Bacteria 13708
247 Ga0207707_10004462 3300025912 Bacteria 12322
248 Ga0207707_10006848 3300025912 Bacteria 9939
249 Ga0207707_10010089 3300025912 Bacteria 8196
250 Ga0207707_10010135 3300025912 Bacteria 8177
251 Ga0207707_10010671 3300025912 Bacteria 7981
252 Ga0207707_10062508 3300025912 Bacteria 3240
253 Ga0207707_10066894 3300025912 Bacteria 3129
254 Ga0207707_10143745 3300025912 Bacteria 2085
255 Ga0207707_10153808 3300025912 Bacteria 2011
256 Ga0207695_10003644 3300025913 Bacteria 21517
257 Ga0207695_10008011 3300025913 Bacteria 13305
258 Ga0207695_10015552 3300025913 Bacteria 8951
259 Ga0207695_10055591 3300025913 Bacteria 4123
260 Ga0207695_10104322 3300025913 Bacteria 2825
261 Ga0207671_10058575 3300025914 Bacteria 2856
262 Ga0207693_10120520 3300025915 Bacteria 2060
263 Ga0207663_10138790 3300025916 Bacteria 1690
264 Ga0207660_10000331 3300025917 Bacteria 30542
265 Ga0207660_10002004 3300025917 Bacteria 13554
266 Ga0207660_10008733 3300025917 Bacteria 6553
267 Ga0207660_10012231 3300025917 Bacteria 5608
268 Ga0207660_10017793 3300025917 Bacteria 4729
269 Ga0207660_10031307 3300025917 Bacteria 3662
270 Ga0207660_10060374 3300025917 Bacteria 2725
271 Ga0207660_10098983 3300025917 Bacteria 2175
272 Ga0207660_10114175 3300025917 Bacteria 2037
273 Ga0207660_10116694 3300025917 Bacteria 2016
274 Ga0207662_10008029 3300025918 Bacteria 5758
275 Ga0207662_10011143 3300025918 Bacteria 4976
276 Ga0207662_10041977 3300025918 Bacteria 2695
277 Ga0207662_10111784 3300025918 Bacteria 1704
278 Ga0207657_10027493 3300025919 Bacteria 5208
279 Ga0207657_10031985 3300025919 Bacteria 4759
280 Ga0207657_10105935 3300025919 Bacteria 2327
281 Ga0207649_10004095 3300025920 Bacteria 7938
282 Ga0207649_10012909 3300025920 Bacteria 4653
283 Ga0207649_10018543 3300025920 Bacteria 3961
284 Ga0207649_10070369 3300025920 Bacteria 2231
285 Ga0207649_10099190 3300025920 Bacteria 1924
286 Ga0207652_10001439 3300025921 Bacteria 21080
287 Ga0207652_10004041 3300025921 Bacteria 11976
288 Ga0207652_10004616 3300025921 Bacteria 11161
289 Ga0207652_10005427 3300025921 Bacteria 10344
290 Ga0207652_10007905 3300025921 Bacteria 8536
291 Ga0207652_10011615 3300025921 Bacteria 7105
292 Ga0207652_10034504 3300025921 Bacteria 4264
293 Ga0207652_10040494 3300025921 Bacteria 3957
294 Ga0207652_10067347 3300025921 Bacteria 3104
295 Ga0207652_10079860 3300025921 Bacteria 2859
296 Ga0207652_10088633 3300025921 Bacteria 2715
297 Ga0207652_10138523 3300025921 Bacteria 2174
298 Ga0207652_10208773 3300025921 Bacteria 1758
299 Ga0207652_10288912 3300025921 Bacteria 1479
300 Ga0207652_10291793 3300025921 Bacteria 1471
301 Ga0207681_10009599 3300025923 Bacteria 5914
302 Ga0207681_10041501 3300025923 Bacteria 3068
303 Ga0207681_10190511 3300025923 Bacteria 1569
304 Ga0207694_10000042 3300025924 Bacteria 177961
305 Ga0207694_10113530 3300025924 Bacteria 2157
306 Ga0207694_10134295 3300025924 Bacteria 1986
307 Ga0207650_10021568 3300025925 Bacteria 4551
308 Ga0207659_10086914 3300025926 Bacteria 2326
309 Ga0207687_10017437 3300025927 Bacteria 4729
310 Ga0207700_10019881 3300025928 Bacteria 4545
311 Ga0207700_10047177 3300025928 Bacteria 3191
312 Ga0207664_10032964 3300025929 Bacteria 3976
313 Ga0207664_10044686 3300025929 Bacteria 3470
314 Ga0207664_10071062 3300025929 Bacteria 2803
315 Ga0207690_10013719 3300025932 Bacteria 4877
316 Ga0207706_10001861 3300025933 Bacteria 20668
317 Ga0207670_10162516 3300025936 Bacteria 1668
318 Ga0207670_10212489 3300025936 Bacteria 1476
319 Ga0207704_10080471 3300025938 Bacteria 2103
320 Ga0207691_10050461 3300025940 Bacteria 3809
321 Ga0207691_10072000 3300025940 Bacteria 3118
322 Ga0207711_10028286 3300025941 Bacteria 4716
323 Ga0207711_10166354 3300025941 Bacteria 1999
324 Ga0207711_10385713 3300025941 Bacteria 1300
325 Ga0207689_10007649 3300025942 Bacteria 9462
326 Ga0207661_10001273 3300025944 Bacteria 16854
327 Ga0207661_10001373 3300025944 Bacteria 16337
328 Ga0207661_10031185 3300025944 Bacteria 4114
329 Ga0207661_10031668 3300025944 Bacteria 4088
330 Ga0207661_10040586 3300025944 Bacteria 3659
331 Ga0207661_10048275 3300025944 Bacteria 3382
332 Ga0207661_10207964 3300025944 Bacteria 1723
333 Ga0207679_10000775 3300025945 Bacteria 20909
334 Ga0207679_10000889 3300025945 Bacteria 19049
335 Ga0207679_10055946 3300025945 Bacteria 2911
336 Ga0207667_10040456 3300025949 Bacteria 4964
337 Ga0207667_10060410 3300025949 Bacteria 3967
338 Ga0207667_10081366 3300025949 Bacteria 3355
339 Ga0207667_10175017 3300025949 Bacteria 2205
340 Ga0207667_10290245 3300025949 Bacteria 1671
341 Ga0207667_10378631 3300025949 Bacteria 1442
342 Ga0207651_10027138 3300025960 Bacteria 3592
343 Ga0207712_10050225 3300025961 Bacteria 2911
344 Ga0207712_10098301 3300025961 Bacteria 2170
345 Ga0207668_10258872 3300025972 Bacteria 1417
346 Ga0207640_10002117 3300025981 Bacteria 10663
347 Ga0207640_10082889 3300025981 Bacteria 2197
348 Ga0207677_10008608 3300026023 Bacteria 5711
349 Ga0207677_10178598 3300026023 Bacteria 1668
350 Ga0207677_10224920 3300026023 Bacteria 1508
351 Ga0207703_10371027 3300026035 Bacteria 1322
352 Ga0207639_10081198 3300026041 Bacteria 2568
353 Ga0207639_10105327 3300026041 Bacteria 2288
354 Ga0207678_10001116 3300026067 Bacteria 24596
355 Ga0207678_10015538 3300026067 Bacteria 6694
356 Ga0207678_10247666 3300026067 Bacteria 1526
357 Ga0207708_10319774 3300026075 Bacteria 1266
358 Ga0207702_10033871 3300026078 Bacteria 4269
359 Ga0207702_10055085 3300026078 Bacteria 3372
360 Ga0207702_10141096 3300026078 Bacteria 2180
361 Ga0207641_10061933 3300026088 Bacteria 3191
362 Ga0207641_10275038 3300026088 Bacteria 1582
363 Ga0207648_10036316 3300026089 Bacteria 4340
364 Ga0207648_10039925 3300026089 Bacteria 4125
365 Ga0207648_10044303 3300026089 Bacteria 3903
366 Ga0207648_10053182 3300026089 Bacteria 3540
367 Ga0207676_10005908 3300026095 Bacteria 8646
368 Ga0207676_10117828 3300026095 Bacteria 2234
369 Ga0207674_10000463 3300026116 Bacteria 53204
370 Ga0207674_10000687 3300026116 Bacteria 44015
371 Ga0207674_10034384 3300026116 Bacteria 5299
372 Ga0207674_10135456 3300026116 Bacteria 2425
373 Ga0207675_100010275 3300026118 Bacteria 8771
374 Ga0207675_100013012 3300026118 Bacteria 7767
375 Ga0207675_100038961 3300026118 Bacteria 4435
376 Ga0207683_10010926 3300026121 Bacteria 7745
377 Ga0207683_10192400 3300026121 Bacteria 1852
378 Ga0207683_10205005 3300026121 Bacteria 1793
379 Ga0207698_10012654 3300026142 Bacteria 5531
380 Ga0207698_10038115 3300026142 Bacteria 3548
381 Ga0207698_10255116 3300026142 Bacteria 1607
382 Ga0209996_1007438 3300027395 Bacteria 1425
383 Ga0210000_1001662 3300027462 Bacteria 3133
384 Ga0209995_1000989 3300027471 Bacteria 4374
385 Ga0209966_1000474 3300027695 Bacteria 10943
386 Ga0209998_10001272 3300027717 Bacteria 6163
387 Ga0268264_10099435 3300028381 Bacteria 2524
388 Ga0265332_10032971 3300031238 Bacteria 2255
389 Ga0307408_100008654 3300031548 Bacteria 6721
390 Ga0307408_100043124 3300031548 Bacteria 3209
391 Ga0265314_10032172 3300031711 Bacteria 3861
392 Ga0307405_10006389 3300031731 Bacteria 5794
393 Ga0307413_10003363 3300031824 Bacteria 6721
394 Ga0307413_10005349 3300031824 Bacteria 5718
395 Ga0307410_10005288 3300031852 Bacteria 6812
396 Ga0307410_10074308 3300031852 Bacteria 2367
397 Ga0307410_10311209 3300031852 Bacteria 1246
398 Ga0307410_10337594 3300031852 Bacteria 1200
399 Ga0307410_10380079 3300031852 Bacteria 1136
400 Ga0307406_10002429 3300031901 Bacteria 10132
401 Ga0307406_10002679 3300031901 Bacteria 9695
402 Ga0307406_10006545 3300031901 Bacteria 6437
403 Ga0307406_10246172 3300031901 Bacteria 1344
404 Ga0307407_10000755 3300031903 Bacteria 10629
405 Ga0307407_10039462 3300031903 Bacteria 2626
406 Ga0307412_10001557 3300031911 Bacteria 12643
407 Ga0307412_10003107 3300031911 Bacteria 9218
408 Ga0307412_10056150 3300031911 Bacteria 2623
409 Ga0307409_100003319 3300031995 Bacteria 8697
410 Ga0307409_100018450 3300031995 Bacteria 4692
411 Ga0307409_100020687 3300031995 Bacteria 4491
412 Ga0307416_100001367 3300032002 Bacteria 13173
413 Ga0307416_100005005 3300032002 Bacteria 8080
414 Ga0307416_100029912 3300032002 Bacteria 4078
415 Ga0307411_10000110 3300032005 Bacteria 25651
416 Ga0307411_10000390 3300032005 Bacteria 14991
417 Ga0307411_10073126 3300032005 Bacteria 2331
418 Ga0307415_100001419 3300032126 Bacteria 11455
419 Ga0307415_100010571 3300032126 Bacteria 5232
420 Ga0307415_100053648 3300032126 Bacteria 2748
421 Ga0307415_100077480 3300032126 Bacteria 2361
422 Ga0307415_100090892 3300032126 Bacteria 2209
423 Ga0373959_0000068 3300034820 Bacteria 23408
424 Ga0373934_0003979 3300035086 Bacteria 5439
425 Ga0373941_0018619 3300035115 Bacteria 1921
426 Ga0373941_0036479 3300035115 Bacteria 1495
427 Ga0373957_0013497 3300035120 Bacteria 2773
428 Ga0373931_0056413 3300035691 Bacteria 2104
429 Ga0373933_0023046 3300035724 Bacteria 3552
430 Ga0373933_0117519 3300035724 Bacteria 1663
431 Ga0373947_0055053 3300035725 Bacteria 2402
432 Ga0395899_0003533 3300037312 Bacteria 12383
433 Ga0395900_0015899 3300037418 Bacteria 7666
434 Ga0395905_0007304 3300037471 Bacteria 11011
435 Ga0395905_0090693 3300037471 Bacteria 2865
436 Ga0395905_0129955 3300037471 Bacteria 2369
437 Ga0395901_0003514 3300038443 Bacteria 15784
438 Ga0436365_1662375 3300039437 Bacteria 3573
439 Ga0451839_1027652 3300041496 Bacteria 1963
440 Ga0451577_0000001 3300042876 Bacteria 2461803
441 Ga0451577_0030833 3300042876 Bacteria 4841
442 Ga0451577_0055930 3300042876 Bacteria 3519
443 Ga0451577_0101806 3300042876 Bacteria 2566
444 Ga0466969_0082020 3300044656 Bacteria 1538
445 Ga0466965_0012026 3300044683 Bacteria 4063
446 Ga0466961_0005105 3300044693 Bacteria 8262
447 Ga0453684_0001014 3300044712 Bacteria 90517
448 Ga0466967_0151284 3300045976 Bacteria 2169
449 Ga0466967_0274432 3300045976 Bacteria 1616
450 Ga0495629_0235877 3300046459 Bacteria 1260
451 Ga0495653_0000235 3300046463 Bacteria 44573
452 Ga0495582_0147709 3300046473 Bacteria 1334
453 Ga0495594_0154683 3300046499 Bacteria 1302
454 Ga0495628_0003435 3300046516 Bacteria 14183
455 Ga0495630_0052530 3300046517 Bacteria 3051
456 Ga0495643_0000056 3300046522 Bacteria 196484
457 Ga0495652_0007862 3300046529 Bacteria 9795
458 Ga0495586_0055041 3300046535 Bacteria 2156
459 Ga0495587_0000163 3300046536 Bacteria 48430
460 Ga0495587_0052027 3300046536 Bacteria 2418
461 Ga0495645_0000311 3300046543 Bacteria 35086
462 Ga0495645_0000866 3300046543 Bacteria 20642
463 Ga0495667_0001569 3300046559 Bacteria 15185
464 Ga0495667_0012325 3300046559 Bacteria 5795
465 Ga0495667_0022405 3300046559 Bacteria 4255
466 Ga0495634_0188711 3300046642 Bacteria 1287
467 Ga0495635_0000194 3300046663 Bacteria 38505
468 Ga0495588_0068304 3300046674 Bacteria 1846
469 Ga0495657_0000303 3300046675 Bacteria 44902
470 Ga0495599_0004251 3300046678 Bacteria 8460
471 Ga0495599_0010108 3300046678 Bacteria 5776
472 Ga0495599_0014746 3300046678 Bacteria 4839
473 Ga0495623_0000362 3300046679 Bacteria 29744
474 Ga0495623_0014079 3300046679 Bacteria 5181
475 Ga0495646_0008488 3300046680 Bacteria 6525
476 Ga0495658_0123487 3300046683 Bacteria 1568
477 Ga0495613_0053426 3300046689 Bacteria 2973
478 Ga0495600_0001333 3300046809 Bacteria 13625
479 Ga0495581_0011111 3300047315 Bacteria 5203
480 Ga0495581_0021145 3300047315 Bacteria 3774
481 Ga0495674_0003135 3300047319 Bacteria 16065
482 Ga0495672_0003001 3300047320 Bacteria 14838
483 Ga0495680_0009315 3300047322 Bacteria 8843
484 Ga0495675_0010109 3300047444 Bacteria 5886
485 Ga0495684_0001920 3300047471 Bacteria 16657
486 Ga0495684_0131800 3300047471 Bacteria 1877
487 Ga0495684_0246992 3300047471 Bacteria 1299
488 Ga0495593_0050288 3300047673 Bacteria 2209
489 Ga0495602_0004928 3300048088 Bacteria 13979
490 Ga0496100_0184709 3300048903 Bacteria 1510
491 Ga0496101_0192502 3300048904 Bacteria 1574
492 Ga0496112_0110311 3300048915 Bacteria 2721
493 Ga0496114_0405655 3300048917 Bacteria 1207
494 Ga0496115_0005061 3300048918 Bacteria 9583
495 Ga0501031_0011896 3300049568 Bacteria 5673
496 Ga0501032_0061544 3300049569 Bacteria 2516
497 Ga0501033_0003379 3300049570 Bacteria 13166
498 Ga0501033_0006978 3300049570 Bacteria 8819
499 Ga0501036_0121903 3300049572 Bacteria 2202
500 Ga0501036_0322395 3300049572 Bacteria 1291
501 Ga0501037_0091757 3300049573 Bacteria 2197
502 Ga0501038_0023266 3300049574 Bacteria 5542
503 Ga0501038_0027160 3300049574 Bacteria 5095
504 Ga0501043_0254656 3300049579 Bacteria 1351
505 Ga0501046_0045560 3300049580 Bacteria 3484
506 Ga0501047_0002393 3300049581 Bacteria 17940
507 Ga0501047_0065473 3300049581 Bacteria 3503
508 Ga0501048_0012126 3300049582 Bacteria 6422
509 Ga0501072_0026551 3300049588 Bacteria 4516
510 Ga0501073_0012776 3300049589 Bacteria 6125
511 Ga0501073_0024757 3300049589 Bacteria 4309
512 Ga0501074_0007312 3300049590 Bacteria 7984
513 Ga0501075_0041660 3300049591 Bacteria 3441
514 Ga0501075_0144329 3300049591 Bacteria 1814
515 Ga0501077_0084633 3300049593 Bacteria 2010
516 Ga0501202_000321 3300049652 Bacteria 6637
517 Ga0501207_001506 3300049654 Bacteria 2919
518 Ga0501223_004670 3300049663 Bacteria 2914
519 Ga0501224_001662 3300049664 Bacteria 2981
520 Ga0501227_003201 3300049665 Bacteria 3554
521 Ga0501235_001123 3300049669 Bacteria 5625
522 Ga0501249_029007 3300049679 Bacteria 1230
523 Ga0501257_006450 3300049686 Bacteria 2603
524 Ga0501259_003014 3300049688 Bacteria 2696
525 Ga0501221_001219 3300049704 Bacteria 4262
526 Ga0501225_0001944 3300049705 Bacteria 6469
527 Ga0501234_000916 3300049707 Bacteria 4658
528 Ga0501080_0039204 3300049742 Bacteria 4422
529 Ga0501083_0015500 3300049744 Bacteria 5338
530 Ga0501083_0048375 3300049744 Bacteria 2870
531 Ga0501035_0000313 3300049822 Bacteria 56245
532 Ga0501035_0023173 3300049822 Bacteria 5696
533 Ga0501044_0010455 3300049823 Bacteria 10072
534 Ga0501044_0142546 3300049823 Bacteria 2384
535 nmdc:mga0qj67_119372_c1 3300050509 Bacteria 2132
536 nmdc:mga0qj67_32049_c1 3300050509 Bacteria 4097
537 nmdc:mga06r32_21091_c1 3300050510 Bacteria 6011
538 nmdc:mga06r32_3670_c1 3300050510 Bacteria 13708
539 nmdc:mga0n895_41571_c1 3300050512 Bacteria 4470
540 nmdc:mga0n895_77832_c1 3300050512 Bacteria 3300
541 nmdc:mga08x19_11407_c1 3300050514 Bacteria 5350
542 nmdc:mga08x19_19963_c1 3300050514 Bacteria 4121
543 nmdc:mga08x19_23311_c1 3300050514 Bacteria 3839
544 nmdc:mga0a205_432810_c1 3300050515 Bacteria 1177
545 Ga0495601_0026344 3300053077 Bacteria 3590
546 Ga0495612_0001127 3300053078 Bacteria 10958
547 Ga0495595_0043331 3300053084 Bacteria 2064
548 Ga0501084_0038108 3300054114 Bacteria 4018
549 Ga0501084_0074087 3300054114 Bacteria 2851
550 Ga0501084_0165705 3300054114 Bacteria 1865
551 Ga0207705_10053191
552 JGI25406J46586_10011244
553 Ga0065715_10005720
554 Ga0065707_10200596
555 Ga0070658_10010517
556 Ga0070658_10040666
557 Ga0070658_10078827
558 Ga0070658_10122410
559 Ga0070683_100000343
560 Ga0070683_100000560
561 Ga0070683_100003422
562 Ga0070683_100006575
563 Ga0070683_100009769
564 Ga0070683_100016026
565 Ga0070683_100019382
566 Ga0070683_100037156
567 Ga0070683_100058205
568 Ga0070683_100100448
569 Ga0070683_100109192
570 Ga0070683_100171579
571 Ga0070683_100243657
572 Ga0070670_100011603
573 Ga0068869_100001434
574 Ga0070666_10097955
575 Ga0070680_100000057
576 Ga0070680_100005645
577 Ga0070680_100008448
578 Ga0070680_100043448
579 Ga0070680_100059648
580 Ga0070680_100066916
581 Ga0070680_100130951
582 Ga0070682_100001114
583 Ga0070682_100002485
584 Ga0070682_100008305
585 Ga0070682_100023460
586 Ga0068868_100030959
587 Ga0068868_100052698
588 Ga0068868_100065794
589 Ga0070660_100039432
590 Ga0070660_100231459
591 Ga0070689_100022281
592 Ga0070691_10017661
593 Ga0070691_10036546
594 Ga0070687_100002140
595 Ga0070687_100045432
596 Ga0070661_100003464
597 Ga0070661_100068440
598 Ga0070661_100080582
599 Ga0070669_100024251
600 Ga0070669_100048183
601 Ga0070675_100028484
602 Ga0070659_100001513
603 Ga0070667_100042717
604 Ga0070709_10131701
605 Ga0070714_100040786
606 Ga0070714_100049953
607 Ga0070714_100266833
608 Ga0070713_100017610
609 Ga0070713_100022974
610 Ga0070710_10021963
611 Ga0070700_100022048
612 Ga0070708_100000006
613 Ga0070708_100000202
614 Ga0070663_100021690
615 Ga0070663_100247625
616 Ga0070678_100008001
617 Ga0070678_100184983
618 Ga0070662_100016687
619 Ga0070681_10000675
620 Ga0070681_10003369
621 Ga0070681_10022420
622 Ga0070681_10023987
623 Ga0070681_10024903
624 Ga0070681_10026447
625 Ga0070681_10123363
626 Ga0070681_10381313
627 Ga0068867_100018229
628 Ga0070685_10001162
629 Ga0070685_10221188
630 Ga0070706_100030802
631 Ga0070706_100186552
632 Ga0070707_100212630
633 Ga0070698_100003060
634 Ga0070698_100037137
635 Ga0070699_100000916
636 Ga0070699_100102885
637 Ga0070679_100000476
638 Ga0070679_100001894
639 Ga0070679_100003050
640 Ga0070679_100006246
641 Ga0070679_100020569
642 Ga0070679_100023395
643 Ga0070679_100023520
644 Ga0070679_100031529
645 Ga0070679_100035006
646 Ga0070679_100053605
647 Ga0070679_100074230
648 Ga0070679_100089810
649 Ga0070679_100131149
650 Ga0070679_100292721
651 Ga0070684_100000577
652 Ga0070684_100000876
653 Ga0070684_100074233
654 Ga0070684_100134156
655 Ga0070684_100229349
656 Ga0070684_100247684
657 Ga0070697_100239356
658 Ga0068853_100036806
659 Ga0070672_100002361
660 Ga0070686_100004409
661 Ga0070696_100044472
662 Ga0070696_100217763
663 Ga0070693_100035938
664 Ga0070693_100050274
665 Ga0068855_100015918
666 Ga0068855_100042197
667 Ga0068855_100042498
668 Ga0068855_100094171
669 Ga0070664_100012101
670 Ga0070664_100019352
671 Ga0070664_100025125
672 Ga0070664_100057287
673 Ga0068857_100002362
674 Ga0068857_100009102
675 Ga0068854_100001049
676 Ga0068856_100005302
677 Ga0068856_100006140
678 Ga0070702_100007905
679 Ga0068852_100005605
680 Ga0068852_100111993
681 Ga0068859_100003856
682 Ga0068859_100156259
683 Ga0068864_100002576
684 Ga0068864_100119600
685 Ga0068851_10019500
686 Ga0068870_10053113
687 Ga0068858_100052896
688 Ga0068860_100053708
689 Ga0068862_100000229
690 Ga0081539_10000075
691 Ga0070717_10001809
692 Ga0070712_100050416
693 Ga0070712_100059702
694 Ga0097621_100009333
695 Ga0097621_100116034
696 Ga0068871_100029871
697 Ga0075430_100005139
698 Ga0075430_100034365
699 Ga0075430_100090743
700 Ga0075431_100011295
701 Ga0075431_100025634
702 Ga0075433_10149719
703 Ga0075434_100162322
704 Ga0075429_100176939
705 Ga0068865_100013101
706 Ga0075436_100009882
707 Ga0075436_100018991
708 Ga0075436_100053976
709 Ga0097620_100003856
710 Ga0097620_100156261
711 Ga0105240_10005300
712 Ga0105240_10050934
713 Ga0105240_10062991
714 Ga0105240_10093084
715 Ga0105240_10141068
716 Ga0105240_10292591
717 Ga0111539_10412629
718 Ga0105245_10026305
719 Ga0105245_10028680
720 Ga0105245_10139043
721 Ga0105245_10208885
722 Ga0105245_10231166
723 Ga0105245_10263288
724 Ga0105243_10349185
725 Ga0105241_10000119
726 Ga0105241_10052728
727 Ga0105241_10241355
728 Ga0105248_10031991
729 Ga0105248_10059976
730 Ga0105248_10077679
731 Ga0105237_10086261
732 Ga0105237_10102348
733 Ga0105238_10142590
734 Ga0105249_10000179
735 Ga0105249_10146031
736 Ga0099796_10035924
737 Ga0105239_10045864
738 Ga0105239_10378186
739 Ga0105246_10004468
740 Ga0157373_10003998
741 Ga0157373_10011442
742 Ga0157373_10031441
743 Ga0157373_10038255
744 Ga0157373_10089332
745 Ga0157371_10196145
746 Ga0157370_10007586
747 Ga0157370_10011187
748 Ga0157370_10043910
749 Ga0157370_10043916
750 Ga0157370_10075274
751 Ga0157370_10148313
752 Ga0157370_10161922
753 Ga0157369_10066330
754 Ga0157369_10195474
755 Ga0157369_10460366
756 Ga0157374_10027392
757 Ga0157374_10065993
758 Ga0157378_10002297
759 Ga0157378_10346707
760 Ga0157372_10004267
761 Ga0157372_10014739
762 Ga0157372_10018674
763 Ga0157372_10031647
764 Ga0157372_10034911
765 Ga0157372_10040552
766 Ga0157372_10070206
767 Ga0157372_10070879
768 Ga0157372_10083145
769 Ga0157372_10130101
770 Ga0157372_10250858
771 Ga0157372_10514466
772 Ga0157375_10014340
773 Ga0157375_10073048
774 Ga0157375_10444183
775 Ga0157375_10507370
776 Ga0163163_10003224
777 Ga0163163_10023575
778 Ga0163163_10186213
779 Ga0157377_10012310
780 Ga0157376_10083005
781 Ga0206356_11386822
782 Ga0213876_10033105
783 Ga0213876_10038514
784 Ga0213876_10056882
785 Ga0207656_10038999
786 Ga0207692_10025112
787 Ga0207645_10047412
788 Ga0207643_10010715
789 Ga0207705_10009989
790 Ga0207705_10030624
791 Ga0207705_10059728
792 Ga0207654_10002560
793 Ga0207654_10040694
794 Ga0207707_10001765
795 Ga0207707_10002124
796 Ga0207707_10003616
797 Ga0207707_10004462
798 Ga0207707_10006848
799 Ga0207707_10010089
800 Ga0207707_10010135
801 Ga0207707_10010671
802 Ga0207707_10062508
803 Ga0207707_10066894
804 Ga0207707_10143745
805 Ga0207707_10153808
806 Ga0207695_10003644
807 Ga0207695_10008011
808 Ga0207695_10015552
809 Ga0207695_10055591
810 Ga0207695_10104322
811 Ga0207671_10058575
812 Ga0207693_10120520
813 Ga0207663_10138790
814 Ga0207660_10000331
815 Ga0207660_10002004
816 Ga0207660_10008733
817 Ga0207660_10012231
818 Ga0207660_10017793
819 Ga0207660_10031307
820 Ga0207660_10060374
821 Ga0207660_10098983
822 Ga0207660_10114175
823 Ga0207660_10116694
824 Ga0207662_10008029
825 Ga0207662_10011143
826 Ga0207662_10041977
827 Ga0207662_10111784
828 Ga0207657_10027493
829 Ga0207657_10031985
830 Ga0207657_10105935
831 Ga0207649_10004095
832 Ga0207649_10012909
833 Ga0207649_10018543
834 Ga0207649_10070369
835 Ga0207649_10099190
836 Ga0207652_10001439
837 Ga0207652_10004041
838 Ga0207652_10004616
839 Ga0207652_10005427
840 Ga0207652_10007905
841 Ga0207652_10011615
842 Ga0207652_10034504
843 Ga0207652_10040494
844 Ga0207652_10067347
845 Ga0207652_10079860
846 Ga0207652_10088633
847 Ga0207652_10138523
848 Ga0207652_10208773
849 Ga0207652_10288912
850 Ga0207652_10291793
851 Ga0207681_10009599
852 Ga0207681_10041501
853 Ga0207681_10190511
854 Ga0207694_10000042
855 Ga0207694_10113530
856 Ga0207694_10134295
857 Ga0207650_10021568
858 Ga0207659_10086914
859 Ga0207687_10017437
860 Ga0207700_10019881
861 Ga0207700_10047177
862 Ga0207664_10032964
863 Ga0207664_10044686
864 Ga0207664_10071062
865 Ga0207690_10013719
866 Ga0207706_10001861
867 Ga0207670_10162516
868 Ga0207670_10212489
869 Ga0207704_10080471
870 Ga0207691_10050461
871 Ga0207691_10072000
872 Ga0207711_10028286
873 Ga0207711_10166354
874 Ga0207711_10385713
875 Ga0207689_10007649
876 Ga0207661_10001273
877 Ga0207661_10001373
878 Ga0207661_10031185
879 Ga0207661_10031668
880 Ga0207661_10040586
881 Ga0207661_10048275
882 Ga0207661_10207964
883 Ga0207679_10000775
884 Ga0207679_10000889
885 Ga0207679_10055946
886 Ga0207667_10040456
887 Ga0207667_10060410
888 Ga0207667_10081366
889 Ga0207667_10175017
890 Ga0207667_10290245
891 Ga0207667_10378631
892 Ga0207651_10027138
893 Ga0207712_10050225
894 Ga0207712_10098301
895 Ga0207668_10258872
896 Ga0207640_10002117
897 Ga0207640_10082889
898 Ga0207677_10008608
899 Ga0207677_10178598
900 Ga0207677_10224920
901 Ga0207703_10371027
902 Ga0207639_10081198
903 Ga0207639_10105327
904 Ga0207678_10001116
905 Ga0207678_10015538
906 Ga0207678_10247666
907 Ga0207708_10319774
908 Ga0207702_10033871
909 Ga0207702_10055085
910 Ga0207702_10141096
911 Ga0207641_10061933
912 Ga0207641_10275038
913 Ga0207648_10036316
914 Ga0207648_10039925
915 Ga0207648_10044303
916 Ga0207648_10053182
917 Ga0207676_10005908
918 Ga0207676_10117828
919 Ga0207674_10000463
920 Ga0207674_10000687
921 Ga0207674_10034384
922 Ga0207674_10135456
923 Ga0207675_100010275
924 Ga0207675_100013012
925 Ga0207675_100038961
926 Ga0207683_10010926
927 Ga0207683_10192400
928 Ga0207683_10205005
929 Ga0207698_10012654
930 Ga0207698_10038115
931 Ga0207698_10255116
932 Ga0209996_1007438
933 Ga0210000_1001662
934 Ga0209995_1000989
935 Ga0209966_1000474
936 Ga0209998_10001272
937 Ga0268264_10099435
938 Ga0265332_10032971
939 Ga0307408_100008654
940 Ga0307408_100043124
941 Ga0265314_10032172
942 Ga0307405_10006389
943 Ga0307413_10003363
944 Ga0307413_10005349
945 Ga0307410_10005288
946 Ga0307410_10074308
947 Ga0307410_10311209
948 Ga0307410_10337594
949 Ga0307410_10380079
950 Ga0307406_10002429
951 Ga0307406_10002679
952 Ga0307406_10006545
953 Ga0307406_10246172
954 Ga0307407_10000755
955 Ga0307407_10039462
956 Ga0307412_10001557
957 Ga0307412_10003107
958 Ga0307412_10056150
959 Ga0307409_100003319
960 Ga0307409_100018450
961 Ga0307409_100020687
962 Ga0307416_100001367
963 Ga0307416_100005005
964 Ga0307416_100029912
965 Ga0307411_10000110
966 Ga0307411_10000390
967 Ga0307411_10073126
968 Ga0307415_100001419
969 Ga0307415_100010571
970 Ga0307415_100053648
971 Ga0307415_100077480
972 Ga0307415_100090892
973 Ga0373959_0000068
974 Ga0373934_0003979
975 Ga0373941_0018619
976 Ga0373941_0036479
977 Ga0373957_0013497
978 Ga0373931_0056413
979 Ga0373933_0023046
980 Ga0373933_0117519
981 Ga0373947_0055053
982 Ga0395899_0003533
983 Ga0395900_0015899
984 Ga0395905_0007304
985 Ga0395905_0090693
986 Ga0395905_0129955
987 Ga0395901_0003514
988 Ga0436365_1662375
989 Ga0451839_1027652
990 Ga0451577_0000001
991 Ga0451577_0030833
992 Ga0451577_0055930
993 Ga0451577_0101806
994 Ga0466969_0082020
995 Ga0466965_0012026
996 Ga0466961_0005105
997 Ga0453684_0001014
998 Ga0466967_0151284
999 Ga0466967_0274432
1000 Ga0495629_0235877
1001 Ga0495653_0000235
1002 Ga0495582_0147709
1003 Ga0495594_0154683
1004 Ga0495628_0003435
1005 Ga0495630_0052530
1006 Ga0495643_0000056
1007 Ga0495652_0007862
1008 Ga0495586_0055041
1009 Ga0495587_0000163
1010 Ga0495587_0052027
1011 Ga0495645_0000311
1012 Ga0495645_0000866
1013 Ga0495667_0001569
1014 Ga0495667_0012325
1015 Ga0495667_0022405
1016 Ga0495634_0188711
1017 Ga0495635_0000194
1018 Ga0495588_0068304
1019 Ga0495657_0000303
1020 Ga0495599_0004251
1021 Ga0495599_0010108
1022 Ga0495599_0014746
1023 Ga0495623_0000362
1024 Ga0495623_0014079
1025 Ga0495646_0008488
1026 Ga0495658_0123487
1027 Ga0495613_0053426
1028 Ga0495600_0001333
1029 Ga0495581_0011111
1030 Ga0495581_0021145
1031 Ga0495674_0003135
1032 Ga0495672_0003001
1033 Ga0495680_0009315
1034 Ga0495675_0010109
1035 Ga0495684_0001920
1036 Ga0495684_0131800
1037 Ga0495684_0246992
1038 Ga0495593_0050288
1039 Ga0495602_0004928
1040 Ga0496100_0184709
1041 Ga0496101_0192502
1042 Ga0496112_0110311
1043 Ga0496114_0405655
1044 Ga0496115_0005061
1045 Ga0501031_0011896
1046 Ga0501032_0061544
1047 Ga0501033_0003379
1048 Ga0501033_0006978
1049 Ga0501036_0121903
1050 Ga0501036_0322395
1051 Ga0501037_0091757
1052 Ga0501038_0023266
1053 Ga0501038_0027160
1054 Ga0501043_0254656
1055 Ga0501046_0045560
1056 Ga0501047_0002393
1057 Ga0501047_0065473
1058 Ga0501048_0012126
1059 Ga0501072_0026551
1060 Ga0501073_0012776
1061 Ga0501073_0024757
1062 Ga0501074_0007312
1063 Ga0501075_0041660
1064 Ga0501075_0144329
1065 Ga0501077_0084633
1066 Ga0501202_000321
1067 Ga0501207_001506
1068 Ga0501223_004670
1069 Ga0501224_001662
1070 Ga0501227_003201
1071 Ga0501235_001123
1072 Ga0501249_029007
1073 Ga0501257_006450
1074 Ga0501259_003014
1075 Ga0501221_001219
1076 Ga0501225_0001944
1077 Ga0501234_000916
1078 Ga0501080_0039204
1079 Ga0501083_0015500
1080 Ga0501083_0048375
1081 Ga0501035_0000313
1082 Ga0501035_0023173
1083 Ga0501044_0010455
1084 Ga0501044_0142546
1085 nmdc:mga0qj67_119372_c1
1086 nmdc:mga0qj67_32049_c1
1087 nmdc:mga06r32_21091_c1
1088 nmdc:mga06r32_3670_c1
1089 nmdc:mga0n895_41571_c1
1090 nmdc:mga0n895_77832_c1
1091 nmdc:mga08x19_11407_c1
1092 nmdc:mga08x19_19963_c1
1093 nmdc:mga08x19_23311_c1
1094 nmdc:mga0a205_432810_c1
1095 Ga0495601_0026344
1096 Ga0495612_0001127
1097 Ga0495595_0043331
1098 Ga0501084_0038108
1099 Ga0501084_0074087
1100 Ga0501084_0165705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06071

YchF-GTPase_C

Protein of unknown function (DUF933)

276

359

0.99

PF02421

FeoB_N

Ferrous iron transport protein B

2

53

0.9

PF01926

MMR_HSR1

50S ribosome-binding GTPase

3

137

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y9i-assembly1.cif.gz_A complex structure of atychf1 with ppgpp 0.9024 2 366
7y9i-assembly1.cif.gz_A complex structure of atychf1 with ppgpp 0.8742 2 366
5ee9-assembly1.cif.gz_A complex structure of osychf1 with gmp-pnp 0.8712 2 365
5ee3-assembly1.cif.gz_A complex structure of osychf1 with amp-pnp 0.8681 1 365
1jal-assembly2.cif.gz_B ychf protein (hi0393) 0.8676 2 366
ID Description Score Start End Superfamily
af_K7L8F3_337_419_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9872 283 365 3.10.20.30
af_K7L8F3_337_419_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9756 283 365 3.10.20.30
2dbyA02 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9646 283 364 3.10.20.30
1jalB03 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Obg-related GTPase Ych/YyaF, coiled-coil domain 0.9632 122 199 1.10.150.300
af_Q7ZU42_294_388_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9586 273 365 3.10.20.30
ID Description Score Start End GO Terms
AF-A0Y360-F1-model_v4 GTP-dependent nucleic acid-binding protein engD 0.9935 280 366 GO:0005737
GO:0016887
AF-A0A2W5SUJ7-F1-model_v4 Redox-regulated ATPase YchF 0.9935 296 366 GO:0005737
GO:0016887
AF-W1VBG4-F1-model_v4 GTP-binding protein 0.9932 294 366 GO:0005737
GO:0016887
AF-S8E599-F1-model_v4 TGS domain-containing protein 0.9925 296 365 GO:0005737
GO:0016887
AF-A0A848VND1-F1-model_v4 DUF933 domain-containing protein 0.9914 294 366 GO:0005737
GO:0016887

Map