F462473

General Info

Members Datasets Scaffolds Average Seq Length
550 302 527 180

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100172184|Ga0070712_1001721842
Length 200
Sequence MIGQHQRFTALQRLLHWLMAVCILAMFFIGVGMVSTIMPKYLPLIAIHKSLGITILVLALIRLAVRLRYGAPALPADLPEPMKLAAYLSHYALYALMIVMPLLGWAMLSAAAYPVVVFGNTYLPAILPQSDSLHTLLWGAHFYLAFAFFGLVLMHVAAALFHALVRRDGVFESMAPVLSHGDLTALGAGTAAAKSVEEIR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
3 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2643221599 Rhizobium sp. Root708 Isolate Unclassified
8 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
9 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
10 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
11 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
12 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
13 2842694124 Methylopila sp. R-72369 Isolate Unclassified
14 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
15 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
16 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
17 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
18 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
19 2928963466 Dyella japonica 1073 Isolate Unclassified
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
289 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
290 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
295 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
296 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
297 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
300 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
301 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
302 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.82
Metatranscriptomes 0
Isolates 4.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 1.09
Rhizoplane 10.91
Rhizosphere 66.18
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10027846 3300001990 Bacteria 1779
2 JGI24735J21928_10005967 3300002067 Bacteria 4025
3 JGI25162J39368_1000822 3300002737 Bacteria 20460
4 rootH2_10324905 3300003320 Bacteria 1190
5 rootL2_10007828 3300003322 Bacteria 5807
6 rootL2_10063704 3300003322 Bacteria 4615
7 rootL2_10231946 3300003322 Bacteria 2877
8 rootH1_10186144 3300003323 Bacteria 1315
9 JGI25160J50197_1000196 3300003354 Bacteria 50978
10 JGI25160J50197_1001255 3300003354 Bacteria 12865
11 Ga0055542_1000552 3300003762 Bacteria 33226
12 Ga0055531_10019326 3300003794 Bacteria 2762
13 Ga0065165_1000729 3300005262 Bacteria 45939
14 Ga0065165_1031330 3300005262 Bacteria 1682
15 Ga0068869_101377329 3300005334 Bacteria 624
16 Ga0070666_10029744 3300005335 Bacteria 3594
17 Ga0068868_100295356 3300005338 Bacteria 1375
18 Ga0070668_101037187 3300005347 Bacteria 738
19 Ga0070667_100074229 3300005367 Bacteria 2901
20 Ga0070714_100045288 3300005435 Bacteria 3728
21 Ga0070713_100064128 3300005436 Bacteria 3082
22 Ga0070713_100069983 3300005436 Bacteria 2961
23 Ga0070713_100280749 3300005436 Bacteria 1528
24 Ga0070713_101199450 3300005436 Bacteria 734
25 Ga0070710_10442113 3300005437 Bacteria 880
26 Ga0070711_100506093 3300005439 Bacteria 996
27 Ga0070711_100538709 3300005439 Bacteria 967
28 Ga0070711_100874940 3300005439 Unclassified 766
29 Ga0070708_100020731 3300005445 Bacteria 5550
30 Ga0070708_100101624 3300005445 Bacteria 2633
31 Ga0070663_100102466 3300005455 Bacteria 2138
32 Ga0070663_100862434 3300005455 Bacteria 780
33 Ga0070678_101037933 3300005456 Bacteria 755
34 Ga0070678_101380884 3300005456 Bacteria 657
35 Ga0070681_10267672 3300005458 Bacteria 1620
36 Ga0070681_10487372 3300005458 Bacteria 1146
37 Ga0070706_100011756 3300005467 Bacteria 8122
38 Ga0070706_100041523 3300005467 Bacteria 4246
39 Ga0070707_100014146 3300005468 Bacteria 7478
40 Ga0070707_100014295 3300005468 Bacteria 7442
41 Ga0070698_100008312 3300005471 Bacteria 11222
42 Ga0070698_100366618 3300005471 Bacteria 1372
43 Ga0070699_100036758 3300005518 Bacteria 4236
44 Ga0070699_100038939 3300005518 Bacteria 4115
45 Ga0070699_100089204 3300005518 Bacteria 2694
46 Ga0070697_100103678 3300005536 Bacteria 2365
47 Ga0070696_100171769 3300005546 Bacteria 1603
48 Ga0070665_100129659 3300005548 Bacteria 2524
49 Ga0070665_101620736 3300005548 Bacteria 655
50 Ga0070664_100438915 3300005564 Bacteria 1197
51 Ga0068856_101542240 3300005614 Bacteria 678
52 Ga0068852_100131042 3300005616 Bacteria 2309
53 Ga0081455_10001113 3300005937 Bacteria 33715
54 Ga0081540_1003844 3300005983 Bacteria 11739
55 Ga0070717_10428393 3300006028 Bacteria 1190
56 Ga0075365_10002266 3300006038 Bacteria 9332
57 Ga0075364_10331746 3300006051 Bacteria 1036
58 Ga0070715_10002984 3300006163 Bacteria 5294
59 Ga0070715_10275596 3300006163 Bacteria 890
60 Ga0070716_100314320 3300006173 Bacteria 1095
61 Ga0070712_100003254 3300006175 Bacteria 9999
62 Ga0070712_100062639 3300006175 Bacteria 2631
63 Ga0070712_100172184 3300006175 Bacteria 1681
64 Ga0075362_10000368 3300006177 Bacteria 13038
65 Ga0075362_10089958 3300006177 Unclassified 1424
66 Ga0075362_10132813 3300006177 Bacteria 1185
67 Ga0075367_10020416 3300006178 Bacteria 3688
68 Ga0075367_10036498 3300006178 Bacteria 2851
69 Ga0075369_10001885 3300006186 Bacteria 7340
70 Ga0075369_10006759 3300006186 Bacteria 4350
71 Ga0075370_10032035 3300006353 Bacteria 2936
72 Ga0075428_100601140 3300006844 Bacteria 1175
73 Ga0075431_100060328 3300006847 Bacteria 3913
74 Ga0075434_100458078 3300006871 Bacteria 1296
75 Ga0075434_100830998 3300006871 Bacteria 939
76 Ga0075435_100280063 3300007076 Bacteria 1423
77 Ga0105251_10007738 3300009011 Bacteria 6556
78 Ga0105250_10053894 3300009092 Bacteria 1613
79 Ga0105250_10363546 3300009092 Bacteria 636
80 Ga0105240_10148765 3300009093 Bacteria 2791
81 Ga0105240_10519250 3300009093 Bacteria 1322
82 Ga0111539_10000051 3300009094 Bacteria 117607
83 Ga0111539_10443807 3300009094 Bacteria 1511
84 Ga0105247_10188735 3300009101 Bacteria 1379
85 Ga0114129_12170535 3300009147 Bacteria 669
86 Ga0105243_10371918 3300009148 Bacteria 1319
87 Ga0105243_10938400 3300009148 Bacteria 863
88 Ga0105248_10026929 3300009177 Bacteria 6393
89 Ga0105248_10148508 3300009177 Bacteria 2645
90 Ga0105237_10112710 3300009545 Bacteria 2712
91 Ga0105237_10130473 3300009545 Bacteria 2508
92 Ga0105237_10168887 3300009545 Bacteria 2187
93 Ga0105238_10135648 3300009551 Bacteria 2439
94 Ga0105238_10708045 3300009551 Bacteria 1019
95 Ga0105249_11410913 3300009553 Bacteria 768
96 Ga0099796_10179191 3300010159 Bacteria 850
97 Ga0105239_10048793 3300010375 Bacteria 4642
98 Ga0105239_10567116 3300010375 Bacteria 1293
99 Ga0105246_10238829 3300011119 Bacteria 1435
100 Ga0157370_10493317 3300013104 Bacteria 1125
101 Ga0157374_10015881 3300013296 Bacteria 6615
102 Ga0157374_10903351 3300013296 Bacteria 901
103 Ga0157378_11295234 3300013297 Bacteria 770
104 Ga0163162_10002427 3300013306 Bacteria 17557
105 Ga0157375_10576731 3300013308 Bacteria 1285
106 Ga0157380_10606656 3300014326 Bacteria 1084
107 Ga0157379_11133255 3300014968 Bacteria 750
108 Ga0163161_10294020 3300017792 Bacteria 1277
109 Ga0163161_10546132 3300017792 Bacteria 949
110 Ga0213873_10002357 3300021358 Bacteria 3261
111 Ga0213872_10010188 3300021361 Bacteria 4482
112 Ga0213872_10021693 3300021361 Bacteria 2959
113 Ga0213872_10078066 3300021361 Bacteria 1488
114 Ga0213871_10059435 3300021441 Unclassified 1062
115 Ga0209435_112311 3300025206 Bacteria 917
116 Ga0207427_101883 3300025231 Bacteria 6610
117 Ga0209437_100106 3300025233 Bacteria 219071
118 Ga0209258_109587 3300025242 Unclassified 1292
119 Ga0209026_1001198 3300025250 Bacteria 12005
120 Ga0209148_1000002 3300025254 Bacteria 2399500
121 Ga0209233_1008437 3300025261 Bacteria 3191
122 Ga0209673_1066503 3300025273 Bacteria 876
123 Ga0209130_1009423 3300025284 Bacteria 2786
124 Ga0209564_1009460 3300025295 Bacteria 4634
125 Ga0209758_1000858 3300025297 Bacteria 42148
126 Ga0207426_1000014 3300025302 Bacteria 649413
127 Ga0207426_1000237 3300025302 Bacteria 124707
128 Ga0207426_1005073 3300025302 Bacteria 6156
129 Ga0207426_1030339 3300025302 Bacteria 1774
130 Ga0209051_1013446 3300025303 Bacteria 3895
131 Ga0209257_1033817 3300025304 Bacteria 1602
132 Ga0207713_1014486 3300025735 Bacteria 4094
133 Ga0207692_10013921 3300025898 Bacteria 3502
134 Ga0207692_10303427 3300025898 Bacteria 972
135 Ga0207692_10436895 3300025898 Bacteria 822
136 Ga0207710_10116457 3300025900 Bacteria 1273
137 Ga0207680_10063061 3300025903 Bacteria 2267
138 Ga0207647_10023243 3300025904 Bacteria 4104
139 Ga0207685_10347206 3300025905 Bacteria 747
140 Ga0207699_10207222 3300025906 Bacteria 1332
141 Ga0207699_10276461 3300025906 Bacteria 1165
142 Ga0207699_10446189 3300025906 Bacteria 927
143 Ga0207684_10054407 3300025910 Bacteria 3395
144 Ga0207707_10142537 3300025912 Bacteria 2095
145 Ga0207695_10214663 3300025913 Bacteria 1833
146 Ga0207671_10332112 3300025914 Bacteria 1204
147 Ga0207671_10654694 3300025914 Bacteria 836
148 Ga0207693_10005600 3300025915 Bacteria 10441
149 Ga0207693_10089079 3300025915 Bacteria 2418
150 Ga0207693_10338825 3300025915 Bacteria 1177
151 Ga0207693_10445311 3300025915 Bacteria 1012
152 Ga0207693_10456606 3300025915 Bacteria 998
153 Ga0207663_10275354 3300025916 Bacteria 1248
154 Ga0207646_10015149 3300025922 Bacteria 7293
155 Ga0207646_10016883 3300025922 Bacteria 6843
156 Ga0207694_10097081 3300025924 Bacteria 2331
157 Ga0207694_10206707 3300025924 Bacteria 1599
158 Ga0207700_10124168 3300025928 Bacteria 2097
159 Ga0207700_10192568 3300025928 Bacteria 1714
160 Ga0207700_10603554 3300025928 Bacteria 977
161 Ga0207664_10063349 3300025929 Bacteria 2955
162 Ga0207709_10425532 3300025935 Bacteria 1021
163 Ga0207665_10005349 3300025939 Bacteria 8575
164 Ga0207665_10637551 3300025939 Bacteria 834
165 Ga0207711_10032405 3300025941 Bacteria 4419
166 Ga0207711_10076229 3300025941 Bacteria 2920
167 Ga0207668_10264160 3300025972 Bacteria 1404
168 Ga0207658_10102968 3300025986 Bacteria 2240
169 Ga0207678_10146714 3300026067 Bacteria 2014
170 Ga0207678_10693553 3300026067 Bacteria 896
171 Ga0207708_10119224 3300026075 Bacteria 2055
172 Ga0207683_10278308 3300026121 Bacteria 1529
173 Ga0207683_10888019 3300026121 Bacteria 828
174 Ga0207428_10000376 3300027907 Bacteria 56585
175 Ga0268265_10593697 3300028380 Bacteria 1057
176 Ga0265334_10032467 3300028573 Bacteria 2082
177 Ga0265340_10060884 3300031247 Bacteria 1807
178 Ga0265339_10174718 3300031249 Bacteria 1073
179 Ga0265331_10001553 3300031250 Bacteria 16838
180 Ga0265316_10197185 3300031344 Bacteria 1494
181 Ga0265316_10363821 3300031344 Bacteria 1046
182 Ga0265313_10005157 3300031595 Bacteria 9710
183 Ga0265314_10135964 3300031711 Bacteria 1526
184 Ga0265342_10009077 3300031712 Bacteria 7053
185 Ga0373926_0087640 3300035083 Bacteria 1156
186 Ga0373934_0001652 3300035086 Bacteria 8181
187 Ga0373934_0084237 3300035086 Bacteria 1279
188 Ga0373923_0001101 3300035111 Bacteria 7438
189 Ga0373941_0093316 3300035115 Bacteria 1036
190 Ga0373953_0000106 3300035117 Bacteria 20249
191 Ga0373954_0024028 3300035118 Bacteria 2776
192 Ga0373954_0106795 3300035118 Bacteria 1353
193 Ga0373956_0000632 3300035119 Bacteria 14438
194 Ga0373957_0041791 3300035120 Bacteria 1727
195 Ga0373955_0000206 3300035172 Bacteria 24511
196 Ga0373935_0101583 3300035692 Bacteria 1897
197 Ga0373927_0260970 3300035695 Bacteria 1139
198 Ga0373933_0000689 3300035724 Bacteria 20809
199 Ga0373947_0085065 3300035725 Bacteria 1964
200 Ga0373947_0086960 3300035725 Bacteria 1944
201 Ga0373937_0005497 3300036401 Bacteria 10859
202 Ga0373937_0031952 3300036401 Bacteria 4772
203 Ga0373937_0279574 3300036401 Bacteria 1576
204 Ga0373937_0427174 3300036401 Bacteria 1258
205 Ga0373925_0014527 3300037068 Bacteria 5690
206 Ga0373925_0409644 3300037068 Bacteria 1106
207 Ga0395900_0646855 3300037418 Bacteria 994
208 Ga0395905_0028166 3300037471 Bacteria 5295
209 Ga0395905_0440669 3300037471 Bacteria 1200
210 Ga0436364_0647678 3300037853 Bacteria 4559
211 Ga0436364_1470644 3300037853 Bacteria 674
212 Ga0395901_0422429 3300038443 Bacteria 1367
213 Ga0436365_0209384 3300039437 Bacteria 794
214 Ga0436365_1297917 3300039437 Bacteria 1279
215 Ga0436360_0178551 3300039438 Bacteria 13175
216 Ga0436360_0817652 3300039438 Bacteria 4743
217 Ga0436360_1106769 3300039438 Bacteria 7832
218 Ga0436360_1200043 3300039438 Bacteria 1286
219 Ga0436361_0076716 3300039447 Bacteria 1830
220 Ga0436361_0385509 3300039447 Bacteria 4676
221 Ga0436361_0440670 3300039447 Unclassified 1394
222 Ga0436361_0450255 3300039447 Bacteria 6345
223 Ga0436361_0549620 3300039447 Bacteria 5813
224 Ga0436361_0557849 3300039447 Bacteria 4756
225 Ga0436361_0566243 3300039447 Bacteria 17128
226 Ga0436361_0721784 3300039447 Bacteria 2725
227 Ga0436361_1099237 3300039447 Bacteria 748
228 Ga0436361_1126813 3300039447 Bacteria 868
229 Ga0436362_0207531 3300039453 Bacteria 2893
230 Ga0439438_008697 3300041405 Bacteria 3342
231 Ga0439447_004331 3300041407 Bacteria 4912
232 Ga0451841_0055569 3300041498 Bacteria 868
233 Ga0439432_005135 3300042006 Bacteria 4734
234 Ga0439434_0002438 3300042435 Bacteria 5407
235 Ga0466968_0043768 3300044735 Bacteria 1896
236 Ga0466968_0128530 3300044735 Bacteria 1151
237 Ga0466967_0215363 3300045976 Bacteria 1823
238 Ga0495592_0006594 3300046454 Bacteria 8650
239 Ga0495603_0001457 3300046455 Bacteria 13766
240 Ga0495590_0000643 3300046457 Bacteria 16186
241 Ga0495629_0000142 3300046459 Bacteria 63219
242 Ga0495629_0005382 3300046459 Bacteria 9551
243 Ga0495629_0051735 3300046459 Bacteria 2875
244 Ga0495629_0053127 3300046459 Bacteria 2835
245 Ga0495638_0001453 3300046460 Bacteria 21399
246 Ga0495638_0068633 3300046460 Bacteria 2173
247 Ga0495651_0355099 3300046462 Bacteria 967
248 Ga0495653_0001787 3300046463 Bacteria 16950
249 Ga0495653_0005981 3300046463 Bacteria 9961
250 Ga0495653_0063009 3300046463 Bacteria 2800
251 Ga0495650_0001866 3300046471 Bacteria 18843
252 Ga0495580_0007962 3300046472 Bacteria 8473
253 Ga0495580_0081961 3300046472 Bacteria 2248
254 Ga0495580_0323146 3300046472 Bacteria 1049
255 Ga0495605_0031060 3300046474 Bacteria 2731
256 Ga0495605_0052213 3300046474 Bacteria 1987
257 Ga0495664_0022229 3300046477 Bacteria 3674
258 Ga0495664_0213206 3300046477 Bacteria 1169
259 Ga0495584_0154773 3300046491 Bacteria 1165
260 Ga0495584_0197958 3300046491 Bacteria 1021
261 Ga0495585_0286549 3300046492 Bacteria 813
262 Ga0495596_0027740 3300046500 Bacteria 2275
263 Ga0495596_0031734 3300046500 Bacteria 2108
264 Ga0495607_0137718 3300046501 Bacteria 1263
265 Ga0495607_0161417 3300046501 Bacteria 1138
266 Ga0495583_0106198 3300046506 Bacteria 1193
267 Ga0495606_0007129 3300046507 Bacteria 10103
268 Ga0495606_0024575 3300046507 Bacteria 4337
269 Ga0495606_0029142 3300046507 Bacteria 3880
270 Ga0495608_0005300 3300046511 Bacteria 9214
271 Ga0495608_0092846 3300046511 Bacteria 1950
272 Ga0495608_0293413 3300046511 Bacteria 1008
273 Ga0495610_0072846 3300046512 Bacteria 1598
274 Ga0495616_0170780 3300046513 Bacteria 972
275 Ga0495620_0012640 3300046515 Bacteria 4351
276 Ga0495628_0029599 3300046516 Bacteria 4438
277 Ga0495628_0132038 3300046516 Bacteria 1909
278 Ga0495628_0647625 3300046516 Bacteria 750
279 Ga0495631_0226703 3300046518 Bacteria 797
280 Ga0495644_0090321 3300046523 Bacteria 1156
281 Ga0495648_0043952 3300046524 Bacteria 2793
282 Ga0495648_0094889 3300046524 Bacteria 1661
283 Ga0495648_0423182 3300046524 Bacteria 589
284 Ga0495652_0003407 3300046529 Bacteria 15721
285 Ga0495652_0004209 3300046529 Bacteria 13847
286 Ga0495652_0132845 3300046529 Bacteria 1968
287 Ga0495652_0328084 3300046529 Bacteria 1103
288 Ga0495652_0468069 3300046529 Bacteria 879
289 Ga0495654_0008213 3300046530 Bacteria 5779
290 Ga0495665_0001887 3300046531 Bacteria 11318
291 Ga0495665_0186952 3300046531 Bacteria 1075
292 Ga0495586_0010237 3300046535 Bacteria 4987
293 Ga0495587_0017344 3300046536 Bacteria 4472
294 Ga0495587_0213477 3300046536 Bacteria 1089
295 Ga0495587_0465113 3300046536 Bacteria 700
296 Ga0495597_0003063 3300046542 Bacteria 10069
297 Ga0495597_0086428 3300046542 Bacteria 1335
298 Ga0495645_0003042 3300046543 Bacteria 11350
299 Ga0495645_0030074 3300046543 Bacteria 3956
300 Ga0495645_0046042 3300046543 Bacteria 3180
301 Ga0495645_0082441 3300046543 Bacteria 2306
302 Ga0495645_0275382 3300046543 Bacteria 1109
303 Ga0495645_0352771 3300046543 Bacteria 947
304 Ga0495667_0010389 3300046559 Bacteria 6300
305 Ga0495667_0011236 3300046559 Bacteria 6061
306 Ga0495656_0046434 3300046615 Bacteria 1838
307 Ga0495634_0002768 3300046642 Bacteria 14396
308 Ga0495634_0211487 3300046642 Bacteria 1200
309 Ga0495634_0439353 3300046642 Bacteria 771
310 Ga0495611_0231972 3300046648 Bacteria 857
311 Ga0495625_0578561 3300046660 Bacteria 677
312 Ga0495635_0000334 3300046663 Bacteria 30145
313 Ga0495635_0010193 3300046663 Bacteria 6569
314 Ga0495635_0083639 3300046663 Bacteria 2184
315 Ga0495635_0585339 3300046663 Bacteria 730
316 Ga0495661_0379982 3300046665 Bacteria 690
317 Ga0495657_0295127 3300046675 Bacteria 967
318 Ga0495599_0009794 3300046678 Bacteria 5865
319 Ga0495623_0004813 3300046679 Bacteria 8854
320 Ga0495623_0016491 3300046679 Bacteria 4773
321 Ga0495646_0001934 3300046680 Bacteria 12469
322 Ga0495646_0011371 3300046680 Bacteria 5652
323 Ga0495646_0059785 3300046680 Bacteria 2275
324 Ga0495669_0012590 3300046684 Bacteria 3602
325 Ga0495669_0019863 3300046684 Bacteria 2902
326 Ga0495669_0056373 3300046684 Bacteria 1771
327 Ga0495613_0000606 3300046689 Bacteria 28653
328 Ga0495613_0063576 3300046689 Bacteria 2700
329 Ga0495613_0220195 3300046689 Bacteria 1333
330 Ga0495624_0001471 3300046690 Bacteria 18292
331 Ga0495624_0465269 3300046690 Bacteria 757
332 Ga0495670_0095175 3300046691 Bacteria 1528
333 Ga0495671_0063823 3300046692 Bacteria 1814
334 Ga0495671_0299918 3300046692 Bacteria 773
335 Ga0495649_0004884 3300046694 Bacteria 8653
336 Ga0495649_0046826 3300046694 Bacteria 2354
337 Ga0495649_0048752 3300046694 Bacteria 2302
338 Ga0495649_0504582 3300046694 Bacteria 601
339 Ga0495589_0007870 3300046794 Bacteria 5579
340 Ga0495589_0019676 3300046794 Bacteria 3456
341 Ga0495589_0039484 3300046794 Bacteria 2358
342 Ga0495589_0044669 3300046794 Bacteria 2203
343 Ga0495589_0162346 3300046794 Bacteria 1064
344 Ga0495600_0084849 3300046809 Bacteria 2066
345 Ga0495600_0097899 3300046809 Bacteria 1912
346 Ga0495581_0000245 3300047315 Bacteria 25810
347 Ga0495604_0009795 3300047317 Bacteria 7579
348 Ga0495604_0439815 3300047317 Bacteria 853
349 Ga0495636_0014586 3300047318 Bacteria 3126
350 Ga0495674_0003457 3300047319 Bacteria 15344
351 Ga0495674_0024123 3300047319 Bacteria 5597
352 Ga0495674_0027393 3300047319 Bacteria 5208
353 Ga0495674_0286990 3300047319 Bacteria 1347
354 Ga0495674_0407343 3300047319 Bacteria 1097
355 Ga0495674_0771557 3300047319 Bacteria 750
356 Ga0495672_0056891 3300047320 Bacteria 2273
357 Ga0495672_0062864 3300047320 Bacteria 2133
358 Ga0495672_0223860 3300047320 Bacteria 927
359 Ga0495676_0617841 3300047321 Bacteria 705
360 Ga0495680_0000270 3300047322 Bacteria 57629
361 Ga0495680_0004481 3300047322 Bacteria 13353
362 Ga0495680_0095738 3300047322 Bacteria 2219
363 Ga0495680_0097790 3300047322 Bacteria 2191
364 Ga0495683_0019915 3300047323 Bacteria 3461
365 Ga0495683_0025332 3300047323 Bacteria 3042
366 Ga0495683_0034827 3300047323 Bacteria 2559
367 Ga0495683_0235307 3300047323 Bacteria 810
368 Ga0495687_025397 3300047443 Bacteria 2802
369 Ga0495687_033450 3300047443 Bacteria 2332
370 Ga0495687_074287 3300047443 Bacteria 1352
371 Ga0495675_0026901 3300047444 Bacteria 3667
372 Ga0495675_0042332 3300047444 Bacteria 2901
373 Ga0495675_0043202 3300047444 Bacteria 2871
374 Ga0495675_0124043 3300047444 Bacteria 1607
375 Ga0495677_0086994 3300047445 Bacteria 1175
376 Ga0495679_086005 3300047446 Bacteria 887
377 Ga0495673_0077159 3300047469 Bacteria 1388
378 Ga0495684_0001788 3300047471 Bacteria 17256
379 Ga0495684_0091116 3300047471 Bacteria 2309
380 Ga0495684_0624854 3300047471 Bacteria 724
381 Ga0495686_0002263 3300047472 Bacteria 18564
382 Ga0495593_0001163 3300047673 Bacteria 15381
383 Ga0495593_0004023 3300047673 Bacteria 8761
384 Ga0495593_0046562 3300047673 Bacteria 2310
385 Ga0495602_0003373 3300048088 Bacteria 16500
386 Ga0495602_0015458 3300048088 Bacteria 7700
387 Ga0495602_0110373 3300048088 Bacteria 2236
388 Ga0495602_0719755 3300048088 Bacteria 676
389 Ga0495602_0884685 3300048088 Bacteria 595
390 Ga0495614_0013426 3300048089 Bacteria 3593
391 Ga0495626_0067174 3300048091 Bacteria 1620
392 Ga0496100_0000365 3300048903 Bacteria 22019
393 Ga0496100_0023762 3300048903 Bacteria 3729
394 Ga0496100_0120747 3300048903 Bacteria 1833
395 Ga0496100_0159606 3300048903 Bacteria 1615
396 Ga0496100_0300038 3300048903 Bacteria 1202
397 Ga0496101_0000587 3300048904 Bacteria 22180
398 Ga0496101_0057807 3300048904 Bacteria 2806
399 Ga0496101_0140590 3300048904 Bacteria 1840
400 Ga0496101_0668385 3300048904 Bacteria 820
401 Ga0496101_0831127 3300048904 Bacteria 728
402 Ga0496102_0000486 3300048905 Bacteria 43958
403 Ga0496102_0011313 3300048905 Bacteria 7688
404 Ga0496102_0018591 3300048905 Bacteria 6110
405 Ga0496102_0111528 3300048905 Bacteria 2550
406 Ga0496102_0435838 3300048905 Bacteria 1230
407 Ga0496103_0001878 3300048906 Bacteria 13661
408 Ga0496103_0005678 3300048906 Bacteria 7455
409 Ga0496103_0183410 3300048906 Bacteria 1345
410 Ga0496103_0203934 3300048906 Bacteria 1272
411 Ga0496104_0018419 3300048907 Bacteria 6370
412 Ga0496104_0052801 3300048907 Bacteria 3839
413 Ga0496104_0057053 3300048907 Bacteria 3695
414 Ga0496104_0173870 3300048907 Bacteria 2064
415 Ga0496104_0188697 3300048907 Bacteria 1972
416 Ga0496104_0193080 3300048907 Bacteria 1948
417 Ga0496104_0196647 3300048907 Bacteria 1928
418 Ga0496104_0277398 3300048907 Bacteria 1589
419 Ga0496105_0004025 3300048908 Bacteria 10996
420 Ga0496105_0027712 3300048908 Bacteria 4630
421 Ga0496105_0134493 3300048908 Bacteria 2037
422 Ga0496106_0014872 3300048909 Bacteria 5757
423 Ga0496106_0023474 3300048909 Bacteria 4582
424 Ga0496106_0024434 3300048909 Bacteria 4493
425 Ga0496106_0051271 3300048909 Bacteria 3111
426 Ga0496106_0159369 3300048909 Bacteria 1784
427 Ga0496106_0363216 3300048909 Bacteria 1163
428 Ga0496107_0002398 3300048910 Bacteria 12132
429 Ga0496107_0080519 3300048910 Bacteria 2375
430 Ga0496107_0174595 3300048910 Bacteria 1595
431 Ga0496108_0600854 3300048911 Bacteria 959
432 Ga0496108_0663495 3300048911 Bacteria 906
433 Ga0496108_0973926 3300048911 Bacteria 725
434 Ga0496110_0134094 3300048913 Bacteria 2237
435 Ga0496110_0410040 3300048913 Bacteria 1235
436 Ga0496111_0013900 3300048914 Bacteria 5490
437 Ga0496111_0870085 3300048914 Bacteria 650
438 Ga0496112_0032460 3300048915 Bacteria 5070
439 Ga0496112_0059442 3300048915 Bacteria 3766
440 Ga0496112_0315434 3300048915 Bacteria 1508
441 Ga0496112_0371727 3300048915 Bacteria 1371
442 Ga0496113_0001207 3300048916 Bacteria 14164
443 Ga0496113_0104159 3300048916 Bacteria 2201
444 Ga0496113_0175178 3300048916 Bacteria 1700
445 Ga0496113_0286690 3300048916 Bacteria 1317
446 Ga0496114_0002720 3300048917 Bacteria 13501
447 Ga0496114_0120191 3300048917 Bacteria 2259
448 Ga0496114_0484082 3300048917 Bacteria 1095
449 Ga0496115_0133583 3300048918 Bacteria 2046
450 Ga0496115_0146450 3300048918 Bacteria 1949
451 Ga0496115_0213863 3300048918 Bacteria 1592
452 Ga0496116_0316756 3300048919 Bacteria 733
453 Ga0496116_0390165 3300048919 Bacteria 620
454 Ga0496117_0000448 3300048920 Bacteria 68514
455 Ga0496117_0019457 3300048920 Bacteria 5574
456 Ga0496118_0001502 3300048921 Bacteria 34760
457 Ga0496118_0016214 3300048921 Bacteria 6846
458 Ga0496118_0063145 3300048921 Bacteria 2727
459 Ga0496118_0115029 3300048921 Bacteria 1772
460 Ga0496119_0001637 3300048922 Bacteria 26393
461 Ga0496119_0106373 3300048922 Bacteria 1566
462 Ga0496119_0260731 3300048922 Bacteria 870
463 Ga0496120_0267282 3300048923 Bacteria 796
464 Ga0496121_0006521 3300048924 Bacteria 14427
465 Ga0496121_0008483 3300048924 Bacteria 12057
466 Ga0496121_0017495 3300048924 Bacteria 7318
467 Ga0496121_0023731 3300048924 Bacteria 5895
468 Ga0496121_0028810 3300048924 Bacteria 5158
469 Ga0496121_0109491 3300048924 Bacteria 2111
470 Ga0496121_0262776 3300048924 Bacteria 1190
471 Ga0496121_0577371 3300048924 Bacteria 698
472 Ga0496122_0000634 3300048925 Bacteria 71553
473 Ga0496122_0014719 3300048925 Bacteria 7542
474 Ga0496122_0038248 3300048925 Bacteria 3848
475 Ga0496122_0444231 3300048925 Bacteria 645
476 Ga0496123_0000736 3300048926 Bacteria 53090
477 Ga0496123_0013233 3300048926 Bacteria 6952
478 Ga0496124_0127661 3300048927 Bacteria 2024
479 Ga0496124_0356761 3300048927 Bacteria 1032
480 Ga0496125_0020626 3300048928 Bacteria 6182
481 Ga0496125_0048917 3300048928 Bacteria 3519
482 Ga0496126_0026655 3300048929 Bacteria 5538
483 Ga0496126_0039310 3300048929 Bacteria 4390
484 Ga0496126_0114078 3300048929 Bacteria 2351
485 Ga0496126_0125316 3300048929 Bacteria 2224
486 Ga0496126_0273863 3300048929 Bacteria 1400
487 Ga0495678_081379 3300049459 Bacteria 1162
488 Ga0495682_0224254 3300049460 Bacteria 666
489 Ga0495682_0243957 3300049460 Bacteria 635
490 nmdc:mga03683_96259_c1 3300050489 Bacteria 1296
491 nmdc:mga03n38_43715_c1 3300050490 Bacteria 1964
492 nmdc:mga03n38_97774_c1 3300050490 Bacteria 1410
493 nmdc:mga00v17_197417_c1 3300050491 Bacteria 1300
494 nmdc:mga0yw44_17500_c2 3300050492 Bacteria 3571
495 nmdc:mga0k408_46265_c1 3300050493 Bacteria 2512
496 nmdc:mga07m45_23751_c1 3300050496 Bacteria 3353
497 nmdc:mga05p37_102155_c1 3300050507 Bacteria 3531
498 nmdc:mga05p37_706018_c1 3300050507 Bacteria 1119
499 nmdc:mga06r32_30333_c1 3300050510 Bacteria 5073
500 nmdc:mga08y16_237_c1 3300050511 Bacteria 49310
501 nmdc:mga0n895_445976_c1 3300050512 Bacteria 1307
502 nmdc:mga0n895_825716_c1 3300050512 Bacteria 916
503 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
504 nmdc:mga0sz30_7351_c1 3300050516 Bacteria 4126
505 nmdc:mga0sz30_96440_c1 3300050516 Bacteria 1290
506 Ga0495601_0577371 3300053077 Unclassified 722
507 Ga0495595_0000945 3300053084 Bacteria 11189
508 Ga0495619_0000855 3300053085 Bacteria 19964
509 Ga0500651_0002849 3300053093 Bacteria 9291
510 Ga0500651_0343849 3300053093 Bacteria 848
511 Ga0500556_0000023 3300053104 Bacteria 168755
512 Ga0500562_014565 3300053108 Bacteria 2013
513 Ga0500592_018051 3300053116 Bacteria 1132
514 Ga0500595_000614 3300053119 Bacteria 21291
515 Ga0500595_016201 3300053119 Bacteria 2781
516 Ga0500595_016992 3300053119 Bacteria 2698
517 Ga0500655_068137 3300053133 Bacteria 723
518 Ga0500559_0358202 3300053136 Bacteria 682
519 Ga0500604_0000628 3300053151 Bacteria 9706
520 Ga0500604_0000833 3300053151 Bacteria 8517
521 Ga0500604_0037935 3300053151 Bacteria 1443
522 Ga0500616_0103420 3300053153 Bacteria 1388
523 Ga0500619_000107 3300053154 Bacteria 22570
524 Ga0500620_000352 3300053155 Bacteria 8582
525 Ga0500622_0018640 3300053156 Bacteria 3688
526 Ga0500638_219382 3300053162 Bacteria 790
527 Ga0500645_161325 3300053730 Bacteria 615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0277398 Ga0496104_0277398_1081_1569 145
2 3300003354 JGI25160J50197_1000196 JGI25160J50197_100019652 152
3 3300005262 Ga0065165_1000729 Ga0065165_100072914 152
4 3300009093 Ga0105240_10519250 Ga0105240_105192502 152
5 3300021441 Ga0213871_10059435 Ga0213871_100594351 152
6 3300025284 Ga0209130_1009423 Ga0209130_10094232 152
7 3300025302 Ga0207426_1000014 Ga0207426_1000014554 152
8 3300025913 Ga0207695_10214663 Ga0207695_102146632 152
9 3300046491 Ga0495584_0197958 Ga0495584_0197958_11_469 152
10 3300048925 Ga0496122_0444231 Ga0496122_0444231_13_528 152
11 3300053077 Ga0495601_0577371 Ga0495601_0577371_40_528 152
12 3300053136 Ga0500559_0358202 Ga0500559_0358202_179_667 152
13 3300053730 Ga0500645_161325 Ga0500645_161325_18_506 152
14 3300010159 Ga0099796_10179191 Ga0099796_101791912 153
15 3300009092 Ga0105250_10363546 Ga0105250_103635461 154
16 3300046472 Ga0495580_0081961 Ga0495580_0081961_1318_1851 154
17 3300046474 Ga0495605_0052213 Ga0495605_0052213_1036_1569 154
18 3300046491 Ga0495584_0154773 Ga0495584_0154773_622_1155 154
19 3300046501 Ga0495607_0137718 Ga0495607_0137718_542_1075 154
20 3300046513 Ga0495616_0170780 Ga0495616_0170780_244_777 154
21 3300046524 Ga0495648_0043952 Ga0495648_0043952_1781_2314 154
22 3300046660 Ga0495625_0578561 Ga0495625_0578561_18_551 154
23 3300046692 Ga0495671_0299918 Ga0495671_0299918_33_566 154
24 3300046694 Ga0495649_0046826 Ga0495649_0046826_259_792 154
25 3300046794 Ga0495589_0044669 Ga0495589_0044669_1528_2061 154
26 3300047319 Ga0495674_0003457 Ga0495674_0003457_464_997 154
27 3300047323 Ga0495683_0034827 Ga0495683_0034827_424_957 154
28 3300047443 Ga0495687_074287 Ga0495687_074287_380_913 154
29 3300047445 Ga0495677_0086994 Ga0495677_0086994_433_966 154
30 3300048905 Ga0496102_0435838 Ga0496102_0435838_358_891 154
31 3300048907 Ga0496104_0188697 Ga0496104_0188697_93_626 154
32 3300048908 Ga0496105_0027712 Ga0496105_0027712_3637_4170 154
33 3300048909 Ga0496106_0159369 Ga0496106_0159369_1074_1607 154
34 3300048915 Ga0496112_0032460 Ga0496112_0032460_2151_2684 154
35 3300048916 Ga0496113_0001207 Ga0496113_0001207_651_1184 154
36 3300048918 Ga0496115_0213863 Ga0496115_0213863_812_1345 154
37 3300048923 Ga0496120_0267282 Ga0496120_0267282_14_547 154
38 3300048924 Ga0496121_0006521 Ga0496121_0006521_13646_14179 154
39 3300049459 Ga0495678_081379 Ga0495678_081379_358_891 154
40 3300049460 Ga0495682_0243957 Ga0495682_0243957_10_543 154
41 3300003322 rootL2_10007828 rootL2_100078282 155
42 3300003354 JGI25160J50197_1001255 JGI25160J50197_10012559 155
43 3300025273 Ga0209673_1066503 Ga0209673_10665032 155
44 3300025295 Ga0209564_1009460 Ga0209564_10094603 155
45 3300025302 Ga0207426_1000237 Ga0207426_100023717 155
46 3300044735 Ga0466968_0043768 Ga0466968_0043768_53_613 155
47 iso_pu_bacteria 8019648815 8019659101 155
48 3300048903 Ga0496100_0000365 Ga0496100_0000365_6797_7330 157
49 3300048904 Ga0496101_0000587 Ga0496101_0000587_14690_15223 157
50 3300048905 Ga0496102_0000486 Ga0496102_0000486_27235_27768 157
51 3300048906 Ga0496103_0001878 Ga0496103_0001878_872_1405 157
52 3300048907 Ga0496104_0196647 Ga0496104_0196647_716_1249 157
53 3300048909 Ga0496106_0051271 Ga0496106_0051271_863_1396 157
54 3300048916 Ga0496113_0286690 Ga0496113_0286690_769_1302 157
55 3300048920 Ga0496117_0000448 Ga0496117_0000448_66943_67476 157
56 3300048921 Ga0496118_0001502 Ga0496118_0001502_1053_1586 157
57 3300048924 Ga0496121_0008483 Ga0496121_0008483_1274_1807 157
58 3300048925 Ga0496122_0038248 Ga0496122_0038248_750_1283 157
59 3300005439 Ga0070711_100874940 Ga0070711_1008749401 159
60 3300009551 Ga0105238_10708045 Ga0105238_107080452 159
61 3300037853 Ga0436364_0647678 Ga0436364_0647678_3766_4281 159
62 3300039437 Ga0436365_0209384 Ga0436365_0209384_116_625 159
63 3300039447 Ga0436361_0385509 Ga0436361_0385509_2726_3250 159
64 3300039447 Ga0436361_1099237 Ga0436361_1099237_215_712 159
65 3300046543 Ga0495645_0275382 Ga0495645_0275382_583_1098 159
66 3300046648 Ga0495611_0231972 Ga0495611_0231972_15_494 159
67 3300046663 Ga0495635_0585339 Ga0495635_0585339_158_682 159
68 3300047321 Ga0495676_0617841 Ga0495676_0617841_28_507 159
69 3300047472 Ga0495686_0002263 Ga0495686_0002263_3092_3583 159
70 3300048088 Ga0495602_0884685 Ga0495602_0884685_23_538 159
71 3300005614 Ga0068856_101542240 Ga0068856_1015422401 160
72 3300048915 Ga0496112_0371727 Ga0496112_0371727_432_980 160
73 3300005455 Ga0070663_100862434 Ga0070663_1008624341 161
74 3300006178 Ga0075367_10036498 Ga0075367_100364984 161
75 3300009545 Ga0105237_10130473 Ga0105237_101304732 161
76 3300010375 Ga0105239_10048793 Ga0105239_100487933 161
77 3300026067 Ga0207678_10693553 Ga0207678_106935532 161
78 3300048928 Ga0496125_0020626 Ga0496125_0020626_4972_5535 161
79 3300050516 nmdc:mga0sz30_96440_c1 nmdc:mga0sz30_96440_c1_35_598 161
80 3300003320 rootH2_10324905 rootH2_103249052 162
81 3300013296 Ga0157374_10903351 Ga0157374_109033512 162
82 3300044735 Ga0466968_0128530 Ga0466968_0128530_505_1065 163
83 3300003322 rootL2_10231946 rootL2_102319465 164
84 3300025304 Ga0209257_1033817 Ga0209257_10338172 164
85 3300041407 Ga0439447_004331 Ga0439447_004331_3816_4376 164
86 3300042006 Ga0439432_005135 Ga0439432_005135_187_747 164
87 3300042435 Ga0439434_0002438 Ga0439434_0002438_232_792 164
88 3300005458 Ga0070681_10267672 Ga0070681_102676722 166
89 3300025912 Ga0207707_10142537 Ga0207707_101425371 166
90 3300025924 Ga0207694_10097081 Ga0207694_100970813 167
91 3300049460 Ga0495682_0224254 Ga0495682_0224254_115_651 167
92 3300011119 Ga0105246_10238829 Ga0105246_102388293 168
93 3300014326 Ga0157380_10606656 Ga0157380_106066561 168
94 3300041405 Ga0439438_008697 Ga0439438_008697_2407_2967 168
95 3300047471 Ga0495684_0624854 Ga0495684_0624854_152_706 168
96 3300006844 Ga0075428_100601140 Ga0075428_1006011401 169
97 3300048927 Ga0496124_0356761 Ga0496124_0356761_177_767 170
98 3300003794 Ga0055531_10019326 Ga0055531_100193262 171
99 3300025302 Ga0207426_1030339 Ga0207426_10303392 171
100 iso_pu_bacteria 8055909800 8055913896 171
101 3300047320 Ga0495672_0056891 Ga0495672_0056891_1521_2069 172
102 3300006163 Ga0070715_10275596 Ga0070715_102755961 173
103 iso_pu_bacteria 2508501128 2509146935 173
104 iso_pu_bacteria 2510917028 2511182603 173
105 iso_pu_bacteria 2524023210 2524464661 173
106 iso_pu_bacteria 2534681796 2535516980 173
107 iso_pu_bacteria 2562617112 2563057422 173
108 iso_pu_bacteria 2643221599 2644007156 173
109 iso_pu_bacteria 2643221643 2644241798 173
110 iso_pu_bacteria 2711768613 2713473882 173
111 iso_pu_bacteria 2824704595 2824707727 173
112 iso_pu_bacteria 2824753945 2824757916 173
113 iso_pu_bacteria 2824763712 2824766952 173
114 iso_pu_bacteria 2842694124 2842698033 173
115 iso_pu_bacteria 2857357740 2857359384 173
116 iso_pu_bacteria 2881364244 2881368259 173
117 iso_pu_bacteria 2883291878 2883295266 173
118 iso_pu_bacteria 2904711408 2904712480 173
119 iso_pu_bacteria 2928963466 2928964192 173
120 iso_pu_bacteria 642555112 642597205 173
121 iso_pu_bacteria 8005542996 8005545791 173
122 3300013297 Ga0157378_11295234 Ga0157378_112952342 174
123 3300039438 Ga0436360_0817652 Ga0436360_0817652_639_1199 174
124 3300046492 Ga0495585_0286549 Ga0495585_0286549_174_701 174
125 3300005439 Ga0070711_100538709 Ga0070711_1005387091 175
126 3300005445 Ga0070708_100101624 Ga0070708_1001016243 175
127 3300005467 Ga0070706_100011756 Ga0070706_1000117564 175
128 3300005468 Ga0070707_100014295 Ga0070707_1000142954 175
129 3300005471 Ga0070698_100008312 Ga0070698_1000083127 175
130 3300005518 Ga0070699_100036758 Ga0070699_1000367582 175
131 3300005548 Ga0070665_101620736 Ga0070665_1016207361 175
132 3300006173 Ga0070716_100314320 Ga0070716_1003143202 175
133 3300006175 Ga0070712_100003254 Ga0070712_1000032548 175
134 3300006177 Ga0075362_10089958 Ga0075362_100899582 175
135 3300014968 Ga0157379_11133255 Ga0157379_111332552 175
136 3300025898 Ga0207692_10436895 Ga0207692_104368951 175
137 3300025906 Ga0207699_10276461 Ga0207699_102764611 175
138 3300025910 Ga0207684_10054407 Ga0207684_100544072 175
139 3300025915 Ga0207693_10005600 Ga0207693_100056008 175
140 3300025915 Ga0207693_10445311 Ga0207693_104453112 175
141 3300025922 Ga0207646_10016883 Ga0207646_100168837 175
142 3300037853 Ga0436364_1470644 Ga0436364_1470644_85_621 175
143 3300039437 Ga0436365_1297917 Ga0436365_1297917_674_1231 175
144 3300039447 Ga0436361_0549620 Ga0436361_0549620_2180_2758 175
145 3300046472 Ga0495580_0323146 Ga0495580_0323146_467_1015 175
146 3300048924 Ga0496121_0023731 Ga0496121_0023731_1072_1629 175
147 3300048929 Ga0496126_0125316 Ga0496126_0125316_122_670 175
148 3300053093 Ga0500651_0343849 Ga0500651_0343849_251_781 175
149 3300053151 Ga0500604_0000628 Ga0500604_0000628_4031_4561 175
150 3300053151 Ga0500604_0037935 Ga0500604_0037935_679_1209 175
151 3300006175 Ga0070712_100062639 Ga0070712_1000626394 176
152 3300009177 Ga0105248_10148508 Ga0105248_101485084 176
153 3300021361 Ga0213872_10021693 Ga0213872_100216932 176
154 3300021361 Ga0213872_10078066 Ga0213872_100780662 176
155 3300025941 Ga0207711_10076229 Ga0207711_100762292 176
156 3300035115 Ga0373941_0093316 Ga0373941_0093316_346_927 176
157 3300039438 Ga0436360_1200043 Ga0436360_1200043_253_813 176
158 3300039447 Ga0436361_0076716 Ga0436361_0076716_961_1509 176
159 3300039447 Ga0436361_0440670 Ga0436361_0440670_735_1283 176
160 3300039447 Ga0436361_0557849 Ga0436361_0557849_1975_2520 176
161 3300039447 Ga0436361_0566243 Ga0436361_0566243_8895_9455 176
162 3300039447 Ga0436361_0721784 Ga0436361_0721784_2004_2552 176
163 3300039447 Ga0436361_1126813 Ga0436361_1126813_106_651 176
164 3300048088 Ga0495602_0719755 Ga0495602_0719755_62_622 176
165 3300048919 Ga0496116_0390165 Ga0496116_0390165_39_572 176
166 3300048921 Ga0496118_0063145 Ga0496118_0063145_960_1493 176
167 3300048922 Ga0496119_0260731 Ga0496119_0260731_151_699 176
168 3300048924 Ga0496121_0109491 Ga0496121_0109491_422_970 176
169 3300048924 Ga0496121_0262776 Ga0496121_0262776_617_1150 176
170 3300053155 Ga0500620_000352 Ga0500620_000352_269_829 176
171 3300001990 JGI24737J22298_10027846 JGI24737J22298_100278462 177
172 3300002067 JGI24735J21928_10005967 JGI24735J21928_100059673 177
173 3300002737 JGI25162J39368_1000822 JGI25162J39368_100082221 177
174 3300003322 rootL2_10063704 rootL2_100637049 177
175 3300003323 rootH1_10186144 rootH1_101861441 177
176 3300003762 Ga0055542_1000552 Ga0055542_100055215 177
177 3300005262 Ga0065165_1031330 Ga0065165_10313302 177
178 3300005334 Ga0068869_101377329 Ga0068869_1013773291 177
179 3300005335 Ga0070666_10029744 Ga0070666_100297443 177
180 3300005338 Ga0068868_100295356 Ga0068868_1002953562 177
181 3300005347 Ga0070668_101037187 Ga0070668_1010371872 177
182 3300005367 Ga0070667_100074229 Ga0070667_1000742293 177
183 3300005435 Ga0070714_100045288 Ga0070714_1000452882 177
184 3300005436 Ga0070713_100064128 Ga0070713_1000641283 177
185 3300005436 Ga0070713_100069983 Ga0070713_1000699832 177
186 3300005436 Ga0070713_100280749 Ga0070713_1002807493 177
187 3300005436 Ga0070713_101199450 Ga0070713_1011994501 177
188 3300005437 Ga0070710_10442113 Ga0070710_104421132 177
189 3300005439 Ga0070711_100506093 Ga0070711_1005060932 177
190 3300005445 Ga0070708_100020731 Ga0070708_1000207313 177
191 3300005455 Ga0070663_100102466 Ga0070663_1001024664 177
192 3300005456 Ga0070678_101037933 Ga0070678_1010379331 177
193 3300005456 Ga0070678_101380884 Ga0070678_1013808841 177
194 3300005458 Ga0070681_10487372 Ga0070681_104873722 177
195 3300005467 Ga0070706_100041523 Ga0070706_1000415234 177
196 3300005468 Ga0070707_100014146 Ga0070707_1000141465 177
197 3300005471 Ga0070698_100366618 Ga0070698_1003666183 177
198 3300005518 Ga0070699_100038939 Ga0070699_1000389393 177
199 3300005518 Ga0070699_100089204 Ga0070699_1000892041 177
200 3300005536 Ga0070697_100103678 Ga0070697_1001036781 177
201 3300005546 Ga0070696_100171769 Ga0070696_1001717692 177
202 3300005548 Ga0070665_100129659 Ga0070665_1001296592 177
203 3300005564 Ga0070664_100438915 Ga0070664_1004389152 177
204 3300005616 Ga0068852_100131042 Ga0068852_1001310423 177
205 3300005937 Ga0081455_10001113 Ga0081455_100011134 177
206 3300005983 Ga0081540_1003844 Ga0081540_10038449 177
207 3300006028 Ga0070717_10428393 Ga0070717_104283932 177
208 3300006038 Ga0075365_10002266 Ga0075365_100022665 177
209 3300006051 Ga0075364_10331746 Ga0075364_103317462 177
210 3300006163 Ga0070715_10002984 Ga0070715_100029842 177
211 3300006175 Ga0070712_100172184 Ga0070712_1001721842 177
212 3300006177 Ga0075362_10000368 Ga0075362_1000036811 177
213 3300006177 Ga0075362_10132813 Ga0075362_101328133 177
214 3300006178 Ga0075367_10020416 Ga0075367_100204162 177
215 3300006186 Ga0075369_10001885 Ga0075369_100018856 177
216 3300006186 Ga0075369_10006759 Ga0075369_100067594 177
217 3300006353 Ga0075370_10032035 Ga0075370_100320353 177
218 3300006847 Ga0075431_100060328 Ga0075431_1000603284 177
219 3300006871 Ga0075434_100458078 Ga0075434_1004580782 177
220 3300006871 Ga0075434_100830998 Ga0075434_1008309982 177
221 3300007076 Ga0075435_100280063 Ga0075435_1002800632 177
222 3300009011 Ga0105251_10007738 Ga0105251_100077384 177
223 3300009092 Ga0105250_10053894 Ga0105250_100538942 177
224 3300009093 Ga0105240_10148765 Ga0105240_101487652 177
225 3300009094 Ga0111539_10000051 Ga0111539_1000005179 177
226 3300009094 Ga0111539_10443807 Ga0111539_104438072 177
227 3300009101 Ga0105247_10188735 Ga0105247_101887351 177
228 3300009147 Ga0114129_12170535 Ga0114129_121705351 177
229 3300009148 Ga0105243_10371918 Ga0105243_103719182 177
230 3300009148 Ga0105243_10938400 Ga0105243_109384001 177
231 3300009177 Ga0105248_10026929 Ga0105248_100269295 177
232 3300009545 Ga0105237_10112710 Ga0105237_101127102 177
233 3300009545 Ga0105237_10168887 Ga0105237_101688872 177
234 3300009551 Ga0105238_10135648 Ga0105238_101356482 177
235 3300009553 Ga0105249_11410913 Ga0105249_114109131 177
236 3300010375 Ga0105239_10567116 Ga0105239_105671162 177
237 3300013104 Ga0157370_10493317 Ga0157370_104933172 177
238 3300013296 Ga0157374_10015881 Ga0157374_100158814 177
239 3300013306 Ga0163162_10002427 Ga0163162_100024274 177
240 3300013308 Ga0157375_10576731 Ga0157375_105767311 177
241 3300017792 Ga0163161_10294020 Ga0163161_102940202 177
242 3300017792 Ga0163161_10546132 Ga0163161_105461323 177
243 3300021358 Ga0213873_10002357 Ga0213873_100023571 177
244 3300021361 Ga0213872_10010188 Ga0213872_100101883 177
245 3300025206 Ga0209435_112311 Ga0209435_1123112 177
246 3300025231 Ga0207427_101883 Ga0207427_1018835 177
247 3300025233 Ga0209437_100106 Ga0209437_10010613 177
248 3300025242 Ga0209258_109587 Ga0209258_1095871 177
249 3300025250 Ga0209026_1001198 Ga0209026_10011982 177
250 3300025254 Ga0209148_1000002 Ga0209148_10000021917 177
251 3300025261 Ga0209233_1008437 Ga0209233_10084373 177
252 3300025297 Ga0209758_1000858 Ga0209758_100085817 177
253 3300025302 Ga0207426_1005073 Ga0207426_10050732 177
254 3300025303 Ga0209051_1013446 Ga0209051_10134463 177
255 3300025735 Ga0207713_1014486 Ga0207713_10144864 177
256 3300025898 Ga0207692_10013921 Ga0207692_100139212 177
257 3300025898 Ga0207692_10303427 Ga0207692_103034272 177
258 3300025900 Ga0207710_10116457 Ga0207710_101164572 177
259 3300025903 Ga0207680_10063061 Ga0207680_100630612 177
260 3300025904 Ga0207647_10023243 Ga0207647_100232433 177
261 3300025905 Ga0207685_10347206 Ga0207685_103472061 177
262 3300025906 Ga0207699_10207222 Ga0207699_102072222 177
263 3300025906 Ga0207699_10446189 Ga0207699_104461892 177
264 3300025914 Ga0207671_10332112 Ga0207671_103321122 177
265 3300025914 Ga0207671_10654694 Ga0207671_106546942 177
266 3300025915 Ga0207693_10089079 Ga0207693_100890792 177
267 3300025915 Ga0207693_10338825 Ga0207693_103388252 177
268 3300025915 Ga0207693_10456606 Ga0207693_104566061 177
269 3300025916 Ga0207663_10275354 Ga0207663_102753542 177
270 3300025922 Ga0207646_10015149 Ga0207646_100151495 177
271 3300025924 Ga0207694_10206707 Ga0207694_102067072 177
272 3300025928 Ga0207700_10124168 Ga0207700_101241682 177
273 3300025928 Ga0207700_10192568 Ga0207700_101925682 177
274 3300025928 Ga0207700_10603554 Ga0207700_106035542 177
275 3300025929 Ga0207664_10063349 Ga0207664_100633492 177
276 3300025935 Ga0207709_10425532 Ga0207709_104255322 177
277 3300025939 Ga0207665_10005349 Ga0207665_100053497 177
278 3300025939 Ga0207665_10637551 Ga0207665_106375512 177
279 3300025941 Ga0207711_10032405 Ga0207711_100324053 177
280 3300025972 Ga0207668_10264160 Ga0207668_102641602 177
281 3300025986 Ga0207658_10102968 Ga0207658_101029682 177
282 3300026067 Ga0207678_10146714 Ga0207678_101467143 177
283 3300026075 Ga0207708_10119224 Ga0207708_101192242 177
284 3300026121 Ga0207683_10278308 Ga0207683_102783082 177
285 3300026121 Ga0207683_10888019 Ga0207683_108880192 177
286 3300027907 Ga0207428_10000376 Ga0207428_1000037637 177
287 3300028380 Ga0268265_10593697 Ga0268265_105936972 177
288 3300028573 Ga0265334_10032467 Ga0265334_100324671 177
289 3300031247 Ga0265340_10060884 Ga0265340_100608841 177
290 3300031249 Ga0265339_10174718 Ga0265339_101747181 177
291 3300031250 Ga0265331_10001553 Ga0265331_1000155314 177
292 3300031344 Ga0265316_10197185 Ga0265316_101971852 177
293 3300031344 Ga0265316_10363821 Ga0265316_103638211 177
294 3300031595 Ga0265313_10005157 Ga0265313_100051575 177
295 3300031711 Ga0265314_10135964 Ga0265314_101359642 177
296 3300031712 Ga0265342_10009077 Ga0265342_100090772 177
297 3300035083 Ga0373926_0087640 Ga0373926_0087640_568_1131 177
298 3300035086 Ga0373934_0001652 Ga0373934_0001652_6328_6918 177
299 3300035086 Ga0373934_0084237 Ga0373934_0084237_546_1115 177
300 3300035111 Ga0373923_0001101 Ga0373923_0001101_5225_5815 177
301 3300035117 Ga0373953_0000106 Ga0373953_0000106_924_1514 177
302 3300035118 Ga0373954_0024028 Ga0373954_0024028_1177_1767 177
303 3300035118 Ga0373954_0106795 Ga0373954_0106795_722_1297 177
304 3300035119 Ga0373956_0000632 Ga0373956_0000632_10376_10966 177
305 3300035120 Ga0373957_0041791 Ga0373957_0041791_1037_1627 177
306 3300035172 Ga0373955_0000206 Ga0373955_0000206_15378_15968 177
307 3300035692 Ga0373935_0101583 Ga0373935_0101583_1261_1851 177
308 3300035695 Ga0373927_0260970 Ga0373927_0260970_523_1086 177
309 3300035724 Ga0373933_0000689 Ga0373933_0000689_17542_18132 177
310 3300035725 Ga0373947_0085065 Ga0373947_0085065_1101_1670 177
311 3300035725 Ga0373947_0086960 Ga0373947_0086960_186_749 177
312 3300036401 Ga0373937_0005497 Ga0373937_0005497_3448_4038 177
313 3300036401 Ga0373937_0031952 Ga0373937_0031952_3567_4136 177
314 3300036401 Ga0373937_0279574 Ga0373937_0279574_71_646 177
315 3300036401 Ga0373937_0427174 Ga0373937_0427174_447_1016 177
316 3300037068 Ga0373925_0014527 Ga0373925_0014527_76_645 177
317 3300037068 Ga0373925_0409644 Ga0373925_0409644_378_941 177
318 3300037418 Ga0395900_0646855 Ga0395900_0646855_429_962 177
319 3300037471 Ga0395905_0028166 Ga0395905_0028166_2027_2560 177
320 3300037471 Ga0395905_0440669 Ga0395905_0440669_266_829 177
321 3300038443 Ga0395901_0422429 Ga0395901_0422429_155_754 177
322 3300039438 Ga0436360_0178551 Ga0436360_0178551_3588_4157 177
323 3300039438 Ga0436360_1106769 Ga0436360_1106769_3887_4450 177
324 3300039447 Ga0436361_0450255 Ga0436361_0450255_2483_3052 177
325 3300039453 Ga0436362_0207531 Ga0436362_0207531_501_1064 177
326 3300041498 Ga0451841_0055569 Ga0451841_0055569_25_588 177
327 3300045976 Ga0466967_0215363 Ga0466967_0215363_187_720 177
328 3300046454 Ga0495592_0006594 Ga0495592_0006594_1112_1702 177
329 3300046455 Ga0495603_0001457 Ga0495603_0001457_6345_6878 177
330 3300046457 Ga0495590_0000643 Ga0495590_0000643_15085_15618 177
331 3300046459 Ga0495629_0000142 Ga0495629_0000142_16353_16886 177
332 3300046459 Ga0495629_0005382 Ga0495629_0005382_8392_8982 177
333 3300046459 Ga0495629_0051735 Ga0495629_0051735_853_1386 177
334 3300046459 Ga0495629_0053127 Ga0495629_0053127_1767_2300 177
335 3300046460 Ga0495638_0001453 Ga0495638_0001453_13211_13774 177
336 3300046460 Ga0495638_0068633 Ga0495638_0068633_343_876 177
337 3300046462 Ga0495651_0355099 Ga0495651_0355099_289_879 177
338 3300046463 Ga0495653_0001787 Ga0495653_0001787_4061_4594 177
339 3300046463 Ga0495653_0005981 Ga0495653_0005981_6950_7540 177
340 3300046463 Ga0495653_0063009 Ga0495653_0063009_2133_2666 177
341 3300046471 Ga0495650_0001866 Ga0495650_0001866_11386_11919 177
342 3300046472 Ga0495580_0007962 Ga0495580_0007962_3026_3559 177
343 3300046474 Ga0495605_0031060 Ga0495605_0031060_926_1459 177
344 3300046477 Ga0495664_0022229 Ga0495664_0022229_2552_3085 177
345 3300046477 Ga0495664_0213206 Ga0495664_0213206_272_805 177
346 3300046500 Ga0495596_0027740 Ga0495596_0027740_1345_1878 177
347 3300046500 Ga0495596_0031734 Ga0495596_0031734_323_856 177
348 3300046501 Ga0495607_0161417 Ga0495607_0161417_505_1038 177
349 3300046506 Ga0495583_0106198 Ga0495583_0106198_346_879 177
350 3300046507 Ga0495606_0007129 Ga0495606_0007129_9110_9643 177
351 3300046507 Ga0495606_0024575 Ga0495606_0024575_3639_4172 177
352 3300046507 Ga0495606_0029142 Ga0495606_0029142_3282_3815 177
353 3300046511 Ga0495608_0005300 Ga0495608_0005300_1224_1814 177
354 3300046511 Ga0495608_0092846 Ga0495608_0092846_84_617 177
355 3300046511 Ga0495608_0293413 Ga0495608_0293413_17_586 177
356 3300046512 Ga0495610_0072846 Ga0495610_0072846_169_702 177
357 3300046515 Ga0495620_0012640 Ga0495620_0012640_3059_3592 177
358 3300046516 Ga0495628_0029599 Ga0495628_0029599_113_703 177
359 3300046516 Ga0495628_0132038 Ga0495628_0132038_1084_1617 177
360 3300046516 Ga0495628_0647625 Ga0495628_0647625_170_739 177
361 3300046518 Ga0495631_0226703 Ga0495631_0226703_98_631 177
362 3300046523 Ga0495644_0090321 Ga0495644_0090321_344_877 177
363 3300046524 Ga0495648_0094889 Ga0495648_0094889_823_1386 177
364 3300046524 Ga0495648_0423182 Ga0495648_0423182_25_558 177
365 3300046529 Ga0495652_0003407 Ga0495652_0003407_570_1160 177
366 3300046529 Ga0495652_0004209 Ga0495652_0004209_5939_6472 177
367 3300046529 Ga0495652_0132845 Ga0495652_0132845_1164_1697 177
368 3300046529 Ga0495652_0328084 Ga0495652_0328084_465_1055 177
369 3300046529 Ga0495652_0468069 Ga0495652_0468069_131_664 177
370 3300046530 Ga0495654_0008213 Ga0495654_0008213_988_1521 177
371 3300046531 Ga0495665_0001887 Ga0495665_0001887_2843_3376 177
372 3300046531 Ga0495665_0186952 Ga0495665_0186952_202_735 177
373 3300046535 Ga0495586_0010237 Ga0495586_0010237_4232_4765 177
374 3300046536 Ga0495587_0017344 Ga0495587_0017344_1178_1768 177
375 3300046536 Ga0495587_0213477 Ga0495587_0213477_414_947 177
376 3300046536 Ga0495587_0465113 Ga0495587_0465113_100_669 177
377 3300046542 Ga0495597_0003063 Ga0495597_0003063_4808_5341 177
378 3300046542 Ga0495597_0086428 Ga0495597_0086428_206_739 177
379 3300046543 Ga0495645_0003042 Ga0495645_0003042_4115_4648 177
380 3300046543 Ga0495645_0030074 Ga0495645_0030074_3349_3939 177
381 3300046543 Ga0495645_0046042 Ga0495645_0046042_2599_3132 177
382 3300046543 Ga0495645_0082441 Ga0495645_0082441_715_1248 177
383 3300046543 Ga0495645_0352771 Ga0495645_0352771_337_879 177
384 3300046559 Ga0495667_0010389 Ga0495667_0010389_5446_5979 177
385 3300046559 Ga0495667_0011236 Ga0495667_0011236_417_1007 177
386 3300046615 Ga0495656_0046434 Ga0495656_0046434_387_920 177
387 3300046642 Ga0495634_0002768 Ga0495634_0002768_10218_10808 177
388 3300046642 Ga0495634_0211487 Ga0495634_0211487_226_759 177
389 3300046642 Ga0495634_0439353 Ga0495634_0439353_160_693 177
390 3300046663 Ga0495635_0000334 Ga0495635_0000334_19683_20273 177
391 3300046663 Ga0495635_0010193 Ga0495635_0010193_4501_5034 177
392 3300046663 Ga0495635_0083639 Ga0495635_0083639_627_1196 177
393 3300046665 Ga0495661_0379982 Ga0495661_0379982_130_663 177
394 3300046675 Ga0495657_0295127 Ga0495657_0295127_89_679 177
395 3300046678 Ga0495599_0009794 Ga0495599_0009794_1224_1814 177
396 3300046679 Ga0495623_0004813 Ga0495623_0004813_864_1454 177
397 3300046679 Ga0495623_0016491 Ga0495623_0016491_3205_3738 177
398 3300046680 Ga0495646_0001934 Ga0495646_0001934_1608_2141 177
399 3300046680 Ga0495646_0011371 Ga0495646_0011371_719_1309 177
400 3300046680 Ga0495646_0059785 Ga0495646_0059785_280_813 177
401 3300046684 Ga0495669_0012590 Ga0495669_0012590_390_923 177
402 3300046684 Ga0495669_0019863 Ga0495669_0019863_45_578 177
403 3300046684 Ga0495669_0056373 Ga0495669_0056373_663_1196 177
404 3300046689 Ga0495613_0000606 Ga0495613_0000606_19935_20477 177
405 3300046689 Ga0495613_0063576 Ga0495613_0063576_1151_1684 177
406 3300046689 Ga0495613_0220195 Ga0495613_0220195_26_559 177
407 3300046690 Ga0495624_0001471 Ga0495624_0001471_8135_8668 177
408 3300046690 Ga0495624_0465269 Ga0495624_0465269_199_732 177
409 3300046691 Ga0495670_0095175 Ga0495670_0095175_956_1489 177
410 3300046692 Ga0495671_0063823 Ga0495671_0063823_1157_1690 177
411 3300046694 Ga0495649_0004884 Ga0495649_0004884_8041_8574 177
412 3300046694 Ga0495649_0048752 Ga0495649_0048752_1455_1988 177
413 3300046694 Ga0495649_0504582 Ga0495649_0504582_15_548 177
414 3300046794 Ga0495589_0007870 Ga0495589_0007870_3489_4022 177
415 3300046794 Ga0495589_0019676 Ga0495589_0019676_20_553 177
416 3300046794 Ga0495589_0039484 Ga0495589_0039484_895_1428 177
417 3300046794 Ga0495589_0162346 Ga0495589_0162346_394_927 177
418 3300046809 Ga0495600_0084849 Ga0495600_0084849_89_679 177
419 3300046809 Ga0495600_0097899 Ga0495600_0097899_667_1200 177
420 3300047315 Ga0495581_0000245 Ga0495581_0000245_23589_24122 177
421 3300047317 Ga0495604_0009795 Ga0495604_0009795_289_879 177
422 3300047317 Ga0495604_0439815 Ga0495604_0439815_264_797 177
423 3300047318 Ga0495636_0014586 Ga0495636_0014586_512_1075 177
424 3300047319 Ga0495674_0024123 Ga0495674_0024123_4422_5012 177
425 3300047319 Ga0495674_0027393 Ga0495674_0027393_2796_3329 177
426 3300047319 Ga0495674_0286990 Ga0495674_0286990_260_793 177
427 3300047319 Ga0495674_0407343 Ga0495674_0407343_140_673 177
428 3300047319 Ga0495674_0771557 Ga0495674_0771557_28_597 177
429 3300047320 Ga0495672_0062864 Ga0495672_0062864_1171_1704 177
430 3300047320 Ga0495672_0223860 Ga0495672_0223860_153_716 177
431 3300047322 Ga0495680_0000270 Ga0495680_0000270_25145_25735 177
432 3300047322 Ga0495680_0004481 Ga0495680_0004481_12694_13227 177
433 3300047322 Ga0495680_0095738 Ga0495680_0095738_338_871 177
434 3300047322 Ga0495680_0097790 Ga0495680_0097790_1172_1741 177
435 3300047323 Ga0495683_0019915 Ga0495683_0019915_2433_2966 177
436 3300047323 Ga0495683_0025332 Ga0495683_0025332_1017_1550 177
437 3300047323 Ga0495683_0235307 Ga0495683_0235307_233_766 177
438 3300047443 Ga0495687_025397 Ga0495687_025397_1450_1983 177
439 3300047443 Ga0495687_033450 Ga0495687_033450_37_570 177
440 3300047444 Ga0495675_0026901 Ga0495675_0026901_1464_1997 177
441 3300047444 Ga0495675_0042332 Ga0495675_0042332_475_1008 177
442 3300047444 Ga0495675_0043202 Ga0495675_0043202_1993_2583 177
443 3300047444 Ga0495675_0124043 Ga0495675_0124043_809_1342 177
444 3300047446 Ga0495679_086005 Ga0495679_086005_316_849 177
445 3300047469 Ga0495673_0077159 Ga0495673_0077159_324_857 177
446 3300047471 Ga0495684_0001788 Ga0495684_0001788_16250_16840 177
447 3300047471 Ga0495684_0091116 Ga0495684_0091116_1725_2294 177
448 3300047673 Ga0495593_0001163 Ga0495593_0001163_8090_8680 177
449 3300047673 Ga0495593_0004023 Ga0495593_0004023_4887_5420 177
450 3300047673 Ga0495593_0046562 Ga0495593_0046562_1646_2179 177
451 3300048088 Ga0495602_0003373 Ga0495602_0003373_8915_9448 177
452 3300048088 Ga0495602_0015458 Ga0495602_0015458_6822_7412 177
453 3300048088 Ga0495602_0110373 Ga0495602_0110373_1668_2201 177
454 3300048089 Ga0495614_0013426 Ga0495614_0013426_2761_3294 177
455 3300048091 Ga0495626_0067174 Ga0495626_0067174_120_653 177
456 3300048903 Ga0496100_0023762 Ga0496100_0023762_2056_2589 177
457 3300048903 Ga0496100_0120747 Ga0496100_0120747_1061_1594 177
458 3300048903 Ga0496100_0159606 Ga0496100_0159606_725_1258 177
459 3300048903 Ga0496100_0300038 Ga0496100_0300038_170_766 177
460 3300048904 Ga0496101_0057807 Ga0496101_0057807_1980_2513 177
461 3300048904 Ga0496101_0140590 Ga0496101_0140590_552_1133 177
462 3300048904 Ga0496101_0668385 Ga0496101_0668385_178_711 177
463 3300048904 Ga0496101_0831127 Ga0496101_0831127_61_645 177
464 3300048905 Ga0496102_0011313 Ga0496102_0011313_4576_5109 177
465 3300048905 Ga0496102_0018591 Ga0496102_0018591_5310_5843 177
466 3300048905 Ga0496102_0111528 Ga0496102_0111528_1210_1794 177
467 3300048906 Ga0496103_0005678 Ga0496103_0005678_6023_6556 177
468 3300048906 Ga0496103_0183410 Ga0496103_0183410_37_570 177
469 3300048906 Ga0496103_0203934 Ga0496103_0203934_215_778 177
470 3300048907 Ga0496104_0018419 Ga0496104_0018419_5232_5816 177
471 3300048907 Ga0496104_0052801 Ga0496104_0052801_2809_3405 177
472 3300048907 Ga0496104_0057053 Ga0496104_0057053_3036_3569 177
473 3300048907 Ga0496104_0173870 Ga0496104_0173870_1065_1598 177
474 3300048907 Ga0496104_0193080 Ga0496104_0193080_1160_1693 177
475 3300048908 Ga0496105_0004025 Ga0496105_0004025_4836_5432 177
476 3300048908 Ga0496105_0134493 Ga0496105_0134493_370_903 177
477 3300048909 Ga0496106_0014872 Ga0496106_0014872_1498_2079 177
478 3300048909 Ga0496106_0023474 Ga0496106_0023474_3883_4416 177
479 3300048909 Ga0496106_0024434 Ga0496106_0024434_3661_4194 177
480 3300048909 Ga0496106_0363216 Ga0496106_0363216_283_867 177
481 3300048910 Ga0496107_0002398 Ga0496107_0002398_1865_2398 177
482 3300048910 Ga0496107_0080519 Ga0496107_0080519_168_710 177
483 3300048910 Ga0496107_0174595 Ga0496107_0174595_150_683 177
484 3300048911 Ga0496108_0600854 Ga0496108_0600854_92_676 177
485 3300048911 Ga0496108_0663495 Ga0496108_0663495_211_744 177
486 3300048911 Ga0496108_0973926 Ga0496108_0973926_131_664 177
487 3300048913 Ga0496110_0134094 Ga0496110_0134094_1339_1872 177
488 3300048913 Ga0496110_0410040 Ga0496110_0410040_406_939 177
489 3300048914 Ga0496111_0013900 Ga0496111_0013900_994_1527 177
490 3300048914 Ga0496111_0870085 Ga0496111_0870085_49_582 177
491 3300048915 Ga0496112_0059442 Ga0496112_0059442_2080_2613 177
492 3300048915 Ga0496112_0315434 Ga0496112_0315434_452_1036 177
493 3300048916 Ga0496113_0104159 Ga0496113_0104159_292_825 177
494 3300048916 Ga0496113_0175178 Ga0496113_0175178_746_1330 177
495 3300048917 Ga0496114_0002720 Ga0496114_0002720_11746_12279 177
496 3300048917 Ga0496114_0120191 Ga0496114_0120191_908_1441 177
497 3300048917 Ga0496114_0484082 Ga0496114_0484082_457_990 177
498 3300048918 Ga0496115_0133583 Ga0496115_0133583_652_1233 177
499 3300048918 Ga0496115_0146450 Ga0496115_0146450_952_1542 177
500 3300048919 Ga0496116_0316756 Ga0496116_0316756_55_636 177
501 3300048920 Ga0496117_0019457 Ga0496117_0019457_4837_5370 177
502 3300048921 Ga0496118_0016214 Ga0496118_0016214_2530_3063 177
503 3300048921 Ga0496118_0115029 Ga0496118_0115029_182_763 177
504 3300048922 Ga0496119_0001637 Ga0496119_0001637_12676_13239 177
505 3300048922 Ga0496119_0106373 Ga0496119_0106373_881_1414 177
506 3300048924 Ga0496121_0017495 Ga0496121_0017495_2594_3127 177
507 3300048924 Ga0496121_0028810 Ga0496121_0028810_1661_2257 177
508 3300048924 Ga0496121_0577371 Ga0496121_0577371_98_631 177
509 3300048925 Ga0496122_0000634 Ga0496122_0000634_4943_5506 177
510 3300048925 Ga0496122_0014719 Ga0496122_0014719_4318_4851 177
511 3300048926 Ga0496123_0000736 Ga0496123_0000736_41354_41917 177
512 3300048926 Ga0496123_0013233 Ga0496123_0013233_3051_3584 177
513 3300048927 Ga0496124_0127661 Ga0496124_0127661_775_1308 177
514 3300048928 Ga0496125_0048917 Ga0496125_0048917_990_1523 177
515 3300048929 Ga0496126_0026655 Ga0496126_0026655_4135_4668 177
516 3300048929 Ga0496126_0039310 Ga0496126_0039310_2866_3444 177
517 3300048929 Ga0496126_0114078 Ga0496126_0114078_657_1229 177
518 3300048929 Ga0496126_0273863 Ga0496126_0273863_347_928 177
519 3300050489 nmdc:mga03683_96259_c1 nmdc:mga03683_96259_c1_253_828 177
520 3300050490 nmdc:mga03n38_43715_c1 nmdc:mga03n38_43715_c1_205_780 177
521 3300050490 nmdc:mga03n38_97774_c1 nmdc:mga03n38_97774_c1_87_641 177
522 3300050491 nmdc:mga00v17_197417_c1 nmdc:mga00v17_197417_c1_292_846 177
523 3300050492 nmdc:mga0yw44_17500_c2 nmdc:mga0yw44_17500_c2_531_1106 177
524 3300050493 nmdc:mga0k408_46265_c1 nmdc:mga0k408_46265_c1_1223_1777 177
525 3300050496 nmdc:mga07m45_23751_c1 nmdc:mga07m45_23751_c1_1244_1798 177
526 3300050507 nmdc:mga05p37_102155_c1 nmdc:mga05p37_102155_c1_353_934 177
527 3300050507 nmdc:mga05p37_706018_c1 nmdc:mga05p37_706018_c1_57_620 177
528 3300050510 nmdc:mga06r32_30333_c1 nmdc:mga06r32_30333_c1_4375_4956 177
529 3300050511 nmdc:mga08y16_237_c1 nmdc:mga08y16_237_c1_19503_20066 177
530 3300050512 nmdc:mga0n895_445976_c1 nmdc:mga0n895_445976_c1_383_964 177
531 3300050512 nmdc:mga0n895_825716_c1 nmdc:mga0n895_825716_c1_201_767 177
532 3300050516 nmdc:mga0sz30_15_c1 nmdc:mga0sz30_15_c1_20527_21081 177
533 3300050516 nmdc:mga0sz30_7351_c1 nmdc:mga0sz30_7351_c1_520_1095 177
534 3300053084 Ga0495595_0000945 Ga0495595_0000945_7961_8551 177
535 3300053085 Ga0495619_0000855 Ga0495619_0000855_14664_15254 177
536 3300053093 Ga0500651_0002849 Ga0500651_0002849_4670_5248 177
537 3300053104 Ga0500556_0000023 Ga0500556_0000023_104720_105283 177
538 3300053108 Ga0500562_014565 Ga0500562_014565_659_1222 177
539 3300053116 Ga0500592_018051 Ga0500592_018051_337_930 177
540 3300053119 Ga0500595_000614 Ga0500595_000614_8225_8818 177
541 3300053119 Ga0500595_016201 Ga0500595_016201_1389_1982 177
542 3300053119 Ga0500595_016992 Ga0500595_016992_1130_1699 177
543 3300053133 Ga0500655_068137 Ga0500655_068137_85_663 177
544 3300053151 Ga0500604_0000833 Ga0500604_0000833_979_1518 177
545 3300053153 Ga0500616_0103420 Ga0500616_0103420_677_1243 177
546 3300053154 Ga0500619_000107 Ga0500619_000107_16707_17246 177
547 3300053156 Ga0500622_0018640 Ga0500622_0018640_727_1290 177
548 3300053162 Ga0500638_219382 Ga0500638_219382_131_700 177
549 iso_pu_bacteria 2515154122 2515686238 177
550 iso_pu_bacteria 2902682994 2902689987 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

7

176

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.8931 5 177
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.8836 5 177
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.6608 8 162
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.6383 7 172
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.6131 12 150
ID Description Score Start End Superfamily
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.9139 7 176 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.9029 7 176 1.20.950.20
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8988 7 176 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8979 7 176 1.20.950.20
af_A0A2R8Q5I2_1_99_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.6854 8 101 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A158F487-F1-model_v4 Type-b cytochrome 0.989 1 177 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A1H4K6Z1-F1-model_v4 Cytochrome b561 0.9859 7 176 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A7Z2GMV5-F1-model_v4 Cytochrome b 0.985 1 177 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A4Q0T339-F1-model_v4 Cytochrome B561 0.9834 1 175 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A2I0FXZ1-F1-model_v4 Cytochrome B 0.9817 6 173 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.7 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map