F462468
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 550 | 253 | 549 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100060842|Ga0068857_1000608422 |
| Length | 255 |
| Sequence | MNPRLRSYLLPLARSNKFREMSKTPDVARPRAVLFDAYGTLFDVYSVALLAEQLFPGFGERLSVLWRDKQIEYTRLTSMSGHYKPFWELTRAGLRYAALRLGLALDATAEDRLMNQYRHLSSFPENREVLVELKERGVSAGILSNGDPDMLGVAVKSAGFSGLLAHVISVHPLRKFKTDPATYALGTQALDLPARDILFVSSNCWDAIGATWFGYTTLWVNRFGLPIEQLDTSPTRTGTSLRDVLSFLEPGVHQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 156 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 157 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 161 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 174 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 177 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 227 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 231 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 232 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 235 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 239 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 241 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 242 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 243 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 244 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 246 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 247 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 248 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 249 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 250 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 252 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 253 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.45 |
| Nodule | 0 |
| Rhizoplane | 3.09 |
| Rhizosphere | 78.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10078152 | 3300003320 | Bacteria | 1200 |
| 2 | rootL2_10064200 | 3300003322 | Bacteria | 4643 |
| 3 | rootH1_10062634 | 3300003323 | Bacteria | 1251 |
| 4 | Ga0070676_10020284 | 3300005328 | Bacteria | 3708 |
| 5 | Ga0070690_100082135 | 3300005330 | Bacteria | 2109 |
| 6 | Ga0070670_100066652 | 3300005331 | Bacteria | 3089 |
| 7 | Ga0070670_100095561 | 3300005331 | Bacteria | 2556 |
| 8 | Ga0070670_100107247 | 3300005331 | Bacteria | 2407 |
| 9 | Ga0070670_100656111 | 3300005331 | Bacteria | 941 |
| 10 | Ga0070677_10004539 | 3300005333 | Bacteria | 4534 |
| 11 | Ga0070677_10019937 | 3300005333 | Bacteria | 2436 |
| 12 | Ga0068869_100002991 | 3300005334 | Bacteria | 10269 |
| 13 | Ga0068869_100005288 | 3300005334 | Bacteria | 8110 |
| 14 | Ga0068869_100021512 | 3300005334 | Bacteria | 4439 |
| 15 | Ga0068869_100141070 | 3300005334 | Bacteria | 1860 |
| 16 | Ga0070666_10006136 | 3300005335 | Bacteria | 7388 |
| 17 | Ga0070666_10064923 | 3300005335 | Bacteria | 2476 |
| 18 | Ga0070680_100007042 | 3300005336 | Bacteria | 8572 |
| 19 | Ga0068868_100055816 | 3300005338 | Bacteria | 3118 |
| 20 | Ga0068868_100118010 | 3300005338 | Bacteria | 2162 |
| 21 | Ga0068868_100212205 | 3300005338 | Bacteria | 1618 |
| 22 | Ga0068868_100513869 | 3300005338 | Bacteria | 1051 |
| 23 | Ga0070660_100208172 | 3300005339 | Bacteria | 1587 |
| 24 | Ga0070689_100043064 | 3300005340 | Bacteria | 3468 |
| 25 | Ga0070689_100354494 | 3300005340 | Bacteria | 1231 |
| 26 | Ga0070689_100575896 | 3300005340 | Bacteria | 973 |
| 27 | Ga0070668_100006321 | 3300005347 | Bacteria | 8772 |
| 28 | Ga0070668_100042554 | 3300005347 | Bacteria | 3482 |
| 29 | Ga0070669_100002253 | 3300005353 | Bacteria | 13987 |
| 30 | Ga0070669_100136449 | 3300005353 | Bacteria | 1887 |
| 31 | Ga0070669_100171547 | 3300005353 | Bacteria | 1691 |
| 32 | Ga0070669_100269499 | 3300005353 | Bacteria | 1361 |
| 33 | Ga0070675_100086401 | 3300005354 | Bacteria | 2621 |
| 34 | Ga0070675_100117013 | 3300005354 | Bacteria | 2261 |
| 35 | Ga0070675_100212377 | 3300005354 | Bacteria | 1682 |
| 36 | Ga0070671_100005065 | 3300005355 | Bacteria | 10509 |
| 37 | Ga0070671_100052136 | 3300005355 | Bacteria | 3402 |
| 38 | Ga0070671_100074057 | 3300005355 | Bacteria | 2845 |
| 39 | Ga0070671_100145790 | 3300005355 | Bacteria | 1998 |
| 40 | Ga0070671_100744408 | 3300005355 | Bacteria | 852 |
| 41 | Ga0070674_100001063 | 3300005356 | Bacteria | 14368 |
| 42 | Ga0070674_100096706 | 3300005356 | Bacteria | 2143 |
| 43 | Ga0070673_100023835 | 3300005364 | Bacteria | 4477 |
| 44 | Ga0070673_100042709 | 3300005364 | Bacteria | 3497 |
| 45 | Ga0070673_100089519 | 3300005364 | Bacteria | 2512 |
| 46 | Ga0070659_100172482 | 3300005366 | Bacteria | 1772 |
| 47 | Ga0070659_100358490 | 3300005366 | Bacteria | 1225 |
| 48 | Ga0070659_100871255 | 3300005366 | Bacteria | 786 |
| 49 | Ga0070667_100008398 | 3300005367 | Bacteria | 8563 |
| 50 | Ga0070667_100016134 | 3300005367 | Bacteria | 6179 |
| 51 | Ga0070667_100034647 | 3300005367 | Bacteria | 4225 |
| 52 | Ga0070667_100155903 | 3300005367 | Bacteria | 2009 |
| 53 | Ga0070667_100203674 | 3300005367 | Bacteria | 1756 |
| 54 | Ga0070700_100085315 | 3300005441 | Bacteria | 2049 |
| 55 | Ga0070708_101038685 | 3300005445 | Bacteria | 768 |
| 56 | Ga0070678_100002787 | 3300005456 | Bacteria | 9654 |
| 57 | Ga0070678_100006378 | 3300005456 | Bacteria | 6920 |
| 58 | Ga0070678_100036945 | 3300005456 | Bacteria | 3424 |
| 59 | Ga0070678_100044816 | 3300005456 | Bacteria | 3160 |
| 60 | Ga0070678_100167182 | 3300005456 | Bacteria | 1788 |
| 61 | Ga0070678_100225574 | 3300005456 | Bacteria | 1559 |
| 62 | Ga0070662_100004630 | 3300005457 | Bacteria | 8716 |
| 63 | Ga0070662_100048071 | 3300005457 | Bacteria | 3072 |
| 64 | Ga0070662_100083588 | 3300005457 | Bacteria | 2383 |
| 65 | Ga0068867_100001822 | 3300005459 | Bacteria | 14856 |
| 66 | Ga0068867_100049765 | 3300005459 | Bacteria | 3085 |
| 67 | Ga0068867_100060327 | 3300005459 | Bacteria | 2813 |
| 68 | Ga0068867_100145206 | 3300005459 | Bacteria | 1858 |
| 69 | Ga0068867_100375697 | 3300005459 | Bacteria | 1193 |
| 70 | Ga0070685_10053740 | 3300005466 | Bacteria | 2334 |
| 71 | Ga0070706_100034688 | 3300005467 | Bacteria | 4661 |
| 72 | Ga0070707_100073029 | 3300005468 | Bacteria | 3307 |
| 73 | Ga0070698_100117874 | 3300005471 | Bacteria | 2617 |
| 74 | Ga0070679_100121949 | 3300005530 | Bacteria | 2591 |
| 75 | Ga0070679_100200368 | 3300005530 | Bacteria | 1963 |
| 76 | Ga0068853_100019903 | 3300005539 | Bacteria | 5574 |
| 77 | Ga0068853_100117387 | 3300005539 | Bacteria | 2370 |
| 78 | Ga0070672_100016969 | 3300005543 | Bacteria | 5227 |
| 79 | Ga0070672_100059823 | 3300005543 | Bacteria | 2998 |
| 80 | Ga0070672_100108780 | 3300005543 | Bacteria | 2257 |
| 81 | Ga0070672_100122088 | 3300005543 | Bacteria | 2133 |
| 82 | Ga0070686_100263643 | 3300005544 | Bacteria | 1264 |
| 83 | Ga0070693_100055809 | 3300005547 | Bacteria | 2277 |
| 84 | Ga0070665_100009344 | 3300005548 | Bacteria | 9924 |
| 85 | Ga0070665_100241288 | 3300005548 | Bacteria | 1808 |
| 86 | Ga0070665_100542896 | 3300005548 | Bacteria | 1174 |
| 87 | Ga0070664_100192046 | 3300005564 | Bacteria | 1820 |
| 88 | Ga0070664_100437425 | 3300005564 | Bacteria | 1199 |
| 89 | Ga0070664_100439270 | 3300005564 | Bacteria | 1197 |
| 90 | Ga0068857_100013289 | 3300005577 | Bacteria | 7171 |
| 91 | Ga0068857_100060842 | 3300005577 | Bacteria | 3354 |
| 92 | Ga0068857_100448608 | 3300005577 | Bacteria | 1206 |
| 93 | Ga0068854_100049126 | 3300005578 | Bacteria | 3012 |
| 94 | Ga0068854_100095511 | 3300005578 | Bacteria | 2219 |
| 95 | Ga0068856_100100886 | 3300005614 | Bacteria | 2879 |
| 96 | Ga0068856_100239508 | 3300005614 | Bacteria | 1830 |
| 97 | Ga0070702_100050540 | 3300005615 | Bacteria | 2375 |
| 98 | Ga0068852_100021495 | 3300005616 | Bacteria | 5154 |
| 99 | Ga0068852_100044489 | 3300005616 | Bacteria | 3771 |
| 100 | Ga0068852_100099245 | 3300005616 | Bacteria | 2624 |
| 101 | Ga0068852_100217233 | 3300005616 | Bacteria | 1817 |
| 102 | Ga0068852_100501464 | 3300005616 | Bacteria | 1209 |
| 103 | Ga0068859_100031777 | 3300005617 | Bacteria | 5303 |
| 104 | Ga0068859_100040006 | 3300005617 | Bacteria | 4705 |
| 105 | Ga0068864_100007367 | 3300005618 | Bacteria | 9056 |
| 106 | Ga0068864_100013078 | 3300005618 | Bacteria | 6874 |
| 107 | Ga0068864_100047641 | 3300005618 | Bacteria | 3682 |
| 108 | Ga0068864_100110469 | 3300005618 | Bacteria | 2448 |
| 109 | Ga0068864_100603072 | 3300005618 | Bacteria | 1066 |
| 110 | Ga0068866_10000966 | 3300005718 | Bacteria | 12638 |
| 111 | Ga0068861_100001733 | 3300005719 | Bacteria | 13987 |
| 112 | Ga0068861_100028491 | 3300005719 | Bacteria | 4075 |
| 113 | Ga0068861_100104449 | 3300005719 | Bacteria | 2260 |
| 114 | Ga0068861_100325141 | 3300005719 | Bacteria | 1340 |
| 115 | Ga0068851_10235861 | 3300005834 | Bacteria | 1033 |
| 116 | Ga0068851_10317969 | 3300005834 | Bacteria | 899 |
| 117 | Ga0068870_10119906 | 3300005840 | Bacteria | 1514 |
| 118 | Ga0068863_100012061 | 3300005841 | Bacteria | 8349 |
| 119 | Ga0068863_100017050 | 3300005841 | Bacteria | 6965 |
| 120 | Ga0068863_100021461 | 3300005841 | Bacteria | 6163 |
| 121 | Ga0068863_100099046 | 3300005841 | Bacteria | 2769 |
| 122 | Ga0068863_100490113 | 3300005841 | Bacteria | 1209 |
| 123 | Ga0068858_100003483 | 3300005842 | Bacteria | 15604 |
| 124 | Ga0068858_100008836 | 3300005842 | Bacteria | 9662 |
| 125 | Ga0068858_100196274 | 3300005842 | Bacteria | 1908 |
| 126 | Ga0068860_100007136 | 3300005843 | Bacteria | 11181 |
| 127 | Ga0068860_100149037 | 3300005843 | Bacteria | 2252 |
| 128 | Ga0068860_100300025 | 3300005843 | Bacteria | 1574 |
| 129 | Ga0068860_100417893 | 3300005843 | Bacteria | 1329 |
| 130 | Ga0068862_100051143 | 3300005844 | Bacteria | 3533 |
| 131 | Ga0068862_100186179 | 3300005844 | Bacteria | 1866 |
| 132 | Ga0068862_100556370 | 3300005844 | Bacteria | 1096 |
| 133 | Ga0070717_10515221 | 3300006028 | Bacteria | 1082 |
| 134 | Ga0075365_10146547 | 3300006038 | Bacteria | 1641 |
| 135 | Ga0075368_10049291 | 3300006042 | Bacteria | 1670 |
| 136 | Ga0075363_100013183 | 3300006048 | Bacteria | 3999 |
| 137 | Ga0075363_100140266 | 3300006048 | Bacteria | 1360 |
| 138 | Ga0075364_10039132 | 3300006051 | Bacteria | 3073 |
| 139 | Ga0075364_10290512 | 3300006051 | Bacteria | 1112 |
| 140 | Ga0070716_100113244 | 3300006173 | Bacteria | 1685 |
| 141 | Ga0070716_100514352 | 3300006173 | Bacteria | 886 |
| 142 | Ga0075362_10014664 | 3300006177 | Bacteria | 3168 |
| 143 | Ga0075362_10031158 | 3300006177 | Bacteria | 2307 |
| 144 | Ga0075367_10019680 | 3300006178 | Bacteria | 3747 |
| 145 | Ga0075369_10041977 | 3300006186 | Bacteria | 1959 |
| 146 | Ga0075366_10002222 | 3300006195 | Bacteria | 9907 |
| 147 | Ga0075366_10006978 | 3300006195 | Bacteria | 6219 |
| 148 | Ga0075366_10014619 | 3300006195 | Bacteria | 4485 |
| 149 | Ga0075366_10030670 | 3300006195 | Bacteria | 3162 |
| 150 | Ga0075366_10062213 | 3300006195 | Bacteria | 2219 |
| 151 | Ga0075366_10100621 | 3300006195 | Bacteria | 1734 |
| 152 | Ga0075366_10133956 | 3300006195 | Bacteria | 1496 |
| 153 | Ga0097621_100077972 | 3300006237 | Bacteria | 2751 |
| 154 | Ga0097621_100169744 | 3300006237 | Bacteria | 1880 |
| 155 | Ga0097621_100313600 | 3300006237 | Bacteria | 1388 |
| 156 | Ga0075370_10001175 | 3300006353 | Bacteria | 11030 |
| 157 | Ga0075370_10002004 | 3300006353 | Bacteria | 9237 |
| 158 | Ga0075370_10010857 | 3300006353 | Bacteria | 4774 |
| 159 | Ga0075370_10031532 | 3300006353 | Bacteria | 2959 |
| 160 | Ga0075370_10084283 | 3300006353 | Bacteria | 1829 |
| 161 | Ga0068871_100030830 | 3300006358 | Bacteria | 4226 |
| 162 | Ga0068871_100135067 | 3300006358 | Bacteria | 2094 |
| 163 | Ga0068865_100063511 | 3300006881 | Bacteria | 2596 |
| 164 | Ga0075436_100350251 | 3300006914 | Bacteria | 1064 |
| 165 | Ga0097620_100031777 | 3300006931 | Bacteria | 5303 |
| 166 | Ga0097620_100040006 | 3300006931 | Bacteria | 4705 |
| 167 | Ga0105240_10003510 | 3300009093 | Bacteria | 24318 |
| 168 | Ga0105240_10167581 | 3300009093 | Bacteria | 2604 |
| 169 | Ga0105240_10251903 | 3300009093 | Bacteria | 2042 |
| 170 | Ga0111539_10158084 | 3300009094 | Bacteria | 2652 |
| 171 | Ga0105245_10105158 | 3300009098 | Bacteria | 2618 |
| 172 | Ga0105245_10655743 | 3300009098 | Bacteria | 1080 |
| 173 | Ga0105247_10349232 | 3300009101 | Bacteria | 1040 |
| 174 | Ga0105243_10049805 | 3300009148 | Bacteria | 3306 |
| 175 | Ga0105243_10050828 | 3300009148 | Bacteria | 3276 |
| 176 | Ga0105243_10157318 | 3300009148 | Bacteria | 1956 |
| 177 | Ga0105242_10034077 | 3300009176 | Bacteria | 4081 |
| 178 | Ga0105242_10459847 | 3300009176 | Bacteria | 1201 |
| 179 | Ga0105242_11287253 | 3300009176 | Bacteria | 754 |
| 180 | Ga0105248_10004886 | 3300009177 | Bacteria | 14816 |
| 181 | Ga0105248_10177454 | 3300009177 | Bacteria | 2401 |
| 182 | Ga0105248_10797149 | 3300009177 | Bacteria | 1066 |
| 183 | Ga0105237_10001543 | 3300009545 | Bacteria | 30087 |
| 184 | Ga0105237_10012060 | 3300009545 | Bacteria | 9129 |
| 185 | Ga0105237_10289327 | 3300009545 | Bacteria | 1641 |
| 186 | Ga0105238_10081700 | 3300009551 | Bacteria | 3221 |
| 187 | Ga0105238_10097608 | 3300009551 | Bacteria | 2923 |
| 188 | Ga0105239_10002318 | 3300010375 | Bacteria | 24311 |
| 189 | Ga0105239_10133619 | 3300010375 | Bacteria | 2762 |
| 190 | Ga0105239_10226444 | 3300010375 | Bacteria | 2098 |
| 191 | Ga0105239_10248180 | 3300010375 | Bacteria | 1999 |
| 192 | Ga0157326_1003608 | 3300012513 | Bacteria | 1626 |
| 193 | Ga0157371_10110797 | 3300013102 | Bacteria | 1948 |
| 194 | Ga0157371_10454020 | 3300013102 | Bacteria | 942 |
| 195 | Ga0157374_10010165 | 3300013296 | Bacteria | 8087 |
| 196 | Ga0157374_10131485 | 3300013296 | Bacteria | 2422 |
| 197 | Ga0157374_10380157 | 3300013296 | Bacteria | 1407 |
| 198 | Ga0157374_10387565 | 3300013296 | Bacteria | 1393 |
| 199 | Ga0157378_10123242 | 3300013297 | Bacteria | 2391 |
| 200 | Ga0157378_10437106 | 3300013297 | Bacteria | 1296 |
| 201 | Ga0163162_10024388 | 3300013306 | Bacteria | 5969 |
| 202 | Ga0163162_10349262 | 3300013306 | Bacteria | 1612 |
| 203 | Ga0163162_10354913 | 3300013306 | Bacteria | 1599 |
| 204 | Ga0157372_10112639 | 3300013307 | Bacteria | 3117 |
| 205 | Ga0157375_10001495 | 3300013308 | Bacteria | 20075 |
| 206 | Ga0157375_10018437 | 3300013308 | Bacteria | 6329 |
| 207 | Ga0157375_10157464 | 3300013308 | Bacteria | 2411 |
| 208 | Ga0157375_10308886 | 3300013308 | Bacteria | 1746 |
| 209 | Ga0157375_10673183 | 3300013308 | Bacteria | 1190 |
| 210 | Ga0163163_10116347 | 3300014325 | Bacteria | 2705 |
| 211 | Ga0163163_10193097 | 3300014325 | Bacteria | 2084 |
| 212 | Ga0163163_10362688 | 3300014325 | Bacteria | 1505 |
| 213 | Ga0157380_10001259 | 3300014326 | Bacteria | 16460 |
| 214 | Ga0182008_10110264 | 3300014497 | Bacteria | 1364 |
| 215 | Ga0157379_10004464 | 3300014968 | Bacteria | 12002 |
| 216 | Ga0157379_10008970 | 3300014968 | Bacteria | 8716 |
| 217 | Ga0157379_10053994 | 3300014968 | Bacteria | 3590 |
| 218 | Ga0157379_10078842 | 3300014968 | Bacteria | 2950 |
| 219 | Ga0157379_10079954 | 3300014968 | Bacteria | 2928 |
| 220 | Ga0157379_10290375 | 3300014968 | Bacteria | 1489 |
| 221 | Ga0157376_10124349 | 3300014969 | Bacteria | 2291 |
| 222 | Ga0157376_10187061 | 3300014969 | Bacteria | 1897 |
| 223 | Ga0157376_10603019 | 3300014969 | Bacteria | 1093 |
| 224 | Ga0163161_10037576 | 3300017792 | Bacteria | 3472 |
| 225 | Ga0163161_10336538 | 3300017792 | Bacteria | 1196 |
| 226 | Ga0213872_10007252 | 3300021361 | Bacteria | 5477 |
| 227 | Ga0207666_1021328 | 3300025271 | Bacteria | 955 |
| 228 | Ga0207697_10017948 | 3300025315 | Bacteria | 2905 |
| 229 | Ga0207682_10008363 | 3300025893 | Bacteria | 4093 |
| 230 | Ga0207682_10011228 | 3300025893 | Bacteria | 3501 |
| 231 | Ga0207682_10020195 | 3300025893 | Bacteria | 2614 |
| 232 | Ga0207642_10036666 | 3300025899 | Bacteria | 2106 |
| 233 | Ga0207688_10263939 | 3300025901 | Bacteria | 1046 |
| 234 | Ga0207688_10335554 | 3300025901 | Bacteria | 929 |
| 235 | Ga0207680_10006180 | 3300025903 | Bacteria | 5778 |
| 236 | Ga0207680_10021819 | 3300025903 | Bacteria | 3472 |
| 237 | Ga0207645_10005248 | 3300025907 | Bacteria | 9437 |
| 238 | Ga0207645_10017896 | 3300025907 | Bacteria | 4674 |
| 239 | Ga0207645_10028050 | 3300025907 | Bacteria | 3634 |
| 240 | Ga0207645_10047337 | 3300025907 | Bacteria | 2746 |
| 241 | Ga0207645_10068425 | 3300025907 | Bacteria | 2271 |
| 242 | Ga0207645_10229645 | 3300025907 | Bacteria | 1225 |
| 243 | Ga0207643_10262814 | 3300025908 | Bacteria | 1066 |
| 244 | Ga0207705_10146168 | 3300025909 | Bacteria | 1769 |
| 245 | Ga0207705_10297833 | 3300025909 | Bacteria | 1237 |
| 246 | Ga0207684_10067747 | 3300025910 | Bacteria | 3033 |
| 247 | Ga0207707_10180268 | 3300025912 | Bacteria | 1844 |
| 248 | Ga0207695_10008769 | 3300025913 | Bacteria | 12610 |
| 249 | Ga0207695_10280749 | 3300025913 | Bacteria | 1559 |
| 250 | Ga0207671_10005989 | 3300025914 | Bacteria | 11002 |
| 251 | Ga0207671_10009937 | 3300025914 | Bacteria | 7907 |
| 252 | Ga0207660_10051622 | 3300025917 | Bacteria | 2924 |
| 253 | Ga0207662_10028087 | 3300025918 | Bacteria | 3250 |
| 254 | Ga0207652_10026613 | 3300025921 | Bacteria | 4819 |
| 255 | Ga0207646_10028126 | 3300025922 | Bacteria | 5121 |
| 256 | Ga0207681_10000367 | 3300025923 | Bacteria | 32064 |
| 257 | Ga0207681_10190646 | 3300025923 | Bacteria | 1568 |
| 258 | Ga0207681_10381663 | 3300025923 | Bacteria | 1134 |
| 259 | Ga0207694_10069930 | 3300025924 | Bacteria | 2743 |
| 260 | Ga0207650_10059316 | 3300025925 | Bacteria | 2852 |
| 261 | Ga0207650_10079924 | 3300025925 | Bacteria | 2478 |
| 262 | Ga0207650_10097983 | 3300025925 | Bacteria | 2252 |
| 263 | Ga0207650_10486515 | 3300025925 | Bacteria | 1030 |
| 264 | Ga0207650_10582017 | 3300025925 | Bacteria | 940 |
| 265 | Ga0207659_10003915 | 3300025926 | Bacteria | 8981 |
| 266 | Ga0207659_10065085 | 3300025926 | Bacteria | 2641 |
| 267 | Ga0207687_10107801 | 3300025927 | Bacteria | 2062 |
| 268 | Ga0207687_10355813 | 3300025927 | Bacteria | 1194 |
| 269 | Ga0207644_10001664 | 3300025931 | Bacteria | 14316 |
| 270 | Ga0207644_10071743 | 3300025931 | Bacteria | 2534 |
| 271 | Ga0207644_10144602 | 3300025931 | Bacteria | 1834 |
| 272 | Ga0207644_10170985 | 3300025931 | Bacteria | 1696 |
| 273 | Ga0207644_10208899 | 3300025931 | Bacteria | 1543 |
| 274 | Ga0207644_10242313 | 3300025931 | Bacteria | 1436 |
| 275 | Ga0207644_10392153 | 3300025931 | Bacteria | 1134 |
| 276 | Ga0207706_10015077 | 3300025933 | Bacteria | 6995 |
| 277 | Ga0207706_10053026 | 3300025933 | Bacteria | 3580 |
| 278 | Ga0207706_10070767 | 3300025933 | Bacteria | 3068 |
| 279 | Ga0207706_10072960 | 3300025933 | Bacteria | 3018 |
| 280 | Ga0207686_10024829 | 3300025934 | Bacteria | 3478 |
| 281 | Ga0207709_10017657 | 3300025935 | Bacteria | 3985 |
| 282 | Ga0207709_10118208 | 3300025935 | Bacteria | 1785 |
| 283 | Ga0207670_10004979 | 3300025936 | Bacteria | 7231 |
| 284 | Ga0207670_10387601 | 3300025936 | Bacteria | 1114 |
| 285 | Ga0207669_10003090 | 3300025937 | Bacteria | 7168 |
| 286 | Ga0207669_10346775 | 3300025937 | Bacteria | 1145 |
| 287 | Ga0207704_10003682 | 3300025938 | Bacteria | 6969 |
| 288 | Ga0207691_10009805 | 3300025940 | Bacteria | 9197 |
| 289 | Ga0207691_10010398 | 3300025940 | Bacteria | 8927 |
| 290 | Ga0207691_10053338 | 3300025940 | Bacteria | 3691 |
| 291 | Ga0207691_10197505 | 3300025940 | Bacteria | 1752 |
| 292 | Ga0207691_10233306 | 3300025940 | Bacteria | 1593 |
| 293 | Ga0207691_10760093 | 3300025940 | Bacteria | 816 |
| 294 | Ga0207711_10217656 | 3300025941 | Bacteria | 1746 |
| 295 | Ga0207711_10239343 | 3300025941 | Bacteria | 1664 |
| 296 | Ga0207711_10552324 | 3300025941 | Bacteria | 1074 |
| 297 | Ga0207711_10567630 | 3300025941 | Bacteria | 1058 |
| 298 | Ga0207689_10005885 | 3300025942 | Bacteria | 10863 |
| 299 | Ga0207689_10006473 | 3300025942 | Bacteria | 10350 |
| 300 | Ga0207689_10041303 | 3300025942 | Bacteria | 3817 |
| 301 | Ga0207689_10063299 | 3300025942 | Bacteria | 3043 |
| 302 | Ga0207689_10156604 | 3300025942 | Bacteria | 1878 |
| 303 | Ga0207689_10408544 | 3300025942 | Bacteria | 1132 |
| 304 | Ga0207679_10045101 | 3300025945 | Bacteria | 3186 |
| 305 | Ga0207679_10219992 | 3300025945 | Bacteria | 1597 |
| 306 | Ga0207679_10249459 | 3300025945 | Bacteria | 1508 |
| 307 | Ga0207679_10257686 | 3300025945 | Bacteria | 1486 |
| 308 | Ga0207679_10302425 | 3300025945 | Bacteria | 1379 |
| 309 | Ga0207679_10331788 | 3300025945 | Bacteria | 1320 |
| 310 | Ga0207679_10482791 | 3300025945 | Bacteria | 1103 |
| 311 | Ga0207651_10001537 | 3300025960 | Bacteria | 10531 |
| 312 | Ga0207651_10036336 | 3300025960 | Bacteria | 3214 |
| 313 | Ga0207651_10265869 | 3300025960 | Bacteria | 1410 |
| 314 | Ga0207651_10317427 | 3300025960 | Bacteria | 1301 |
| 315 | Ga0207712_10003631 | 3300025961 | Bacteria | 9730 |
| 316 | Ga0207712_10421431 | 3300025961 | Bacteria | 1126 |
| 317 | Ga0207668_10007182 | 3300025972 | Bacteria | 6616 |
| 318 | Ga0207668_10039984 | 3300025972 | Bacteria | 3161 |
| 319 | Ga0207640_10047575 | 3300025981 | Bacteria | 2768 |
| 320 | Ga0207640_10291096 | 3300025981 | Bacteria | 1287 |
| 321 | Ga0207640_10419401 | 3300025981 | Bacteria | 1095 |
| 322 | Ga0207658_10000767 | 3300025986 | Bacteria | 27431 |
| 323 | Ga0207658_10007546 | 3300025986 | Bacteria | 7409 |
| 324 | Ga0207658_10012010 | 3300025986 | Bacteria | 5907 |
| 325 | Ga0207658_10174648 | 3300025986 | Bacteria | 1773 |
| 326 | Ga0207677_10004355 | 3300026023 | Bacteria | 7585 |
| 327 | Ga0207677_10024944 | 3300026023 | Bacteria | 3723 |
| 328 | Ga0207677_10116563 | 3300026023 | Bacteria | 2000 |
| 329 | Ga0207677_10691196 | 3300026023 | Bacteria | 904 |
| 330 | Ga0207703_10001725 | 3300026035 | Bacteria | 19651 |
| 331 | Ga0207703_10001947 | 3300026035 | Bacteria | 18258 |
| 332 | Ga0207703_10168066 | 3300026035 | Bacteria | 1927 |
| 333 | Ga0207639_10051313 | 3300026041 | Bacteria | 3137 |
| 334 | Ga0207639_10166902 | 3300026041 | Bacteria | 1861 |
| 335 | Ga0207639_10569091 | 3300026041 | Bacteria | 1042 |
| 336 | Ga0207678_10074354 | 3300026067 | Bacteria | 2912 |
| 337 | Ga0207708_10007760 | 3300026075 | Bacteria | 7946 |
| 338 | Ga0207708_10114660 | 3300026075 | Bacteria | 2095 |
| 339 | Ga0207702_10017891 | 3300026078 | Bacteria | 5865 |
| 340 | Ga0207702_10132541 | 3300026078 | Bacteria | 2244 |
| 341 | Ga0207641_10000960 | 3300026088 | Bacteria | 29558 |
| 342 | Ga0207641_10042184 | 3300026088 | Bacteria | 3826 |
| 343 | Ga0207641_10120271 | 3300026088 | Bacteria | 2342 |
| 344 | Ga0207641_10136245 | 3300026088 | Bacteria | 2210 |
| 345 | Ga0207641_10588319 | 3300026088 | Bacteria | 1088 |
| 346 | Ga0207648_10024642 | 3300026089 | Bacteria | 5367 |
| 347 | Ga0207648_10026596 | 3300026089 | Bacteria | 5140 |
| 348 | Ga0207648_10029103 | 3300026089 | Bacteria | 4898 |
| 349 | Ga0207648_11017972 | 3300026089 | Bacteria | 776 |
| 350 | Ga0207676_10000778 | 3300026095 | Bacteria | 24842 |
| 351 | Ga0207676_10009337 | 3300026095 | Bacteria | 6979 |
| 352 | Ga0207676_10055762 | 3300026095 | Bacteria | 3104 |
| 353 | Ga0207674_10069070 | 3300026116 | Bacteria | 3554 |
| 354 | Ga0207674_10075742 | 3300026116 | Bacteria | 3374 |
| 355 | Ga0207674_10087317 | 3300026116 | Bacteria | 3112 |
| 356 | Ga0207674_10350109 | 3300026116 | Bacteria | 1428 |
| 357 | Ga0207675_100016108 | 3300026118 | Bacteria | 6982 |
| 358 | Ga0207675_100116647 | 3300026118 | Bacteria | 2523 |
| 359 | Ga0207675_100120487 | 3300026118 | Bacteria | 2482 |
| 360 | Ga0207683_10052227 | 3300026121 | Bacteria | 3581 |
| 361 | Ga0207683_10060942 | 3300026121 | Bacteria | 3319 |
| 362 | Ga0207683_10107086 | 3300026121 | Bacteria | 2500 |
| 363 | Ga0207683_10175918 | 3300026121 | Bacteria | 1939 |
| 364 | Ga0207683_10248345 | 3300026121 | Bacteria | 1623 |
| 365 | Ga0207683_10281002 | 3300026121 | Bacteria | 1521 |
| 366 | Ga0207698_10017876 | 3300026142 | Bacteria | 4819 |
| 367 | Ga0207698_10031156 | 3300026142 | Bacteria | 3846 |
| 368 | Ga0207698_10325986 | 3300026142 | Bacteria | 1440 |
| 369 | Ga0207698_10345835 | 3300026142 | Bacteria | 1403 |
| 370 | Ga0268266_10070331 | 3300028379 | Bacteria | 3032 |
| 371 | Ga0268266_10209304 | 3300028379 | Bacteria | 1788 |
| 372 | Ga0268266_10354671 | 3300028379 | Bacteria | 1379 |
| 373 | Ga0268265_10047909 | 3300028380 | Bacteria | 3205 |
| 374 | Ga0268265_10154785 | 3300028380 | Bacteria | 1938 |
| 375 | Ga0268265_10386052 | 3300028380 | Bacteria | 1290 |
| 376 | Ga0268264_10001133 | 3300028381 | Bacteria | 26125 |
| 377 | Ga0268264_10043438 | 3300028381 | Bacteria | 3724 |
| 378 | Ga0268264_10047978 | 3300028381 | Bacteria | 3551 |
| 379 | Ga0268264_10075831 | 3300028381 | Bacteria | 2860 |
| 380 | Ga0268264_10120455 | 3300028381 | Bacteria | 2312 |
| 381 | Ga0307517_10004277 | 3300028786 | Bacteria | 22001 |
| 382 | Ga0307517_10096806 | 3300028786 | Bacteria | 2361 |
| 383 | Ga0307517_10111453 | 3300028786 | Bacteria | 2079 |
| 384 | Ga0307515_10000058 | 3300028794 | Bacteria | 259680 |
| 385 | Ga0307515_10000283 | 3300028794 | Bacteria | 124822 |
| 386 | Ga0307515_10026725 | 3300028794 | Bacteria | 9914 |
| 387 | Ga0307515_10032592 | 3300028794 | Bacteria | 8624 |
| 388 | Ga0307515_10238061 | 3300028794 | Bacteria | 1597 |
| 389 | Ga0307515_10307460 | 3300028794 | Bacteria | 1264 |
| 390 | Ga0307515_10360262 | 3300028794 | Bacteria | 1096 |
| 391 | Ga0265324_10106066 | 3300029957 | Bacteria | 954 |
| 392 | Ga0307512_10131715 | 3300030522 | Bacteria | 1565 |
| 393 | Ga0307513_10024066 | 3300031456 | Bacteria | 7092 |
| 394 | Ga0307513_10275921 | 3300031456 | Bacteria | 1461 |
| 395 | Ga0307509_10000157 | 3300031507 | Bacteria | 106022 |
| 396 | Ga0307509_10018280 | 3300031507 | Bacteria | 8040 |
| 397 | Ga0307509_10077774 | 3300031507 | Bacteria | 3440 |
| 398 | Ga0307509_10113102 | 3300031507 | Bacteria | 2713 |
| 399 | Ga0307509_10166424 | 3300031507 | Bacteria | 2092 |
| 400 | Ga0307508_10014979 | 3300031616 | Bacteria | 7069 |
| 401 | Ga0307508_10026666 | 3300031616 | Bacteria | 5237 |
| 402 | Ga0307508_10157246 | 3300031616 | Bacteria | 1877 |
| 403 | Ga0307514_10113353 | 3300031649 | Bacteria | 1914 |
| 404 | Ga0307516_10001791 | 3300031730 | Bacteria | 29495 |
| 405 | Ga0307516_10084634 | 3300031730 | Bacteria | 3010 |
| 406 | Ga0307516_10447819 | 3300031730 | Bacteria | 948 |
| 407 | Ga0307518_10178036 | 3300031838 | Bacteria | 1441 |
| 408 | Ga0307412_10322357 | 3300031911 | Bacteria | 1230 |
| 409 | Ga0307416_100036273 | 3300032002 | Bacteria | 3779 |
| 410 | Ga0307411_10115453 | 3300032005 | Bacteria | 1931 |
| 411 | Ga0307411_10149626 | 3300032005 | Bacteria | 1733 |
| 412 | Ga0307411_10239720 | 3300032005 | Bacteria | 1419 |
| 413 | Ga0307510_10000870 | 3300033180 | Bacteria | 31736 |
| 414 | Ga0307510_10028393 | 3300033180 | Bacteria | 6390 |
| 415 | Ga0307510_10116890 | 3300033180 | Bacteria | 2386 |
| 416 | Ga0373943_0059936 | 3300035170 | Bacteria | 1899 |
| 417 | Ga0373955_0041282 | 3300035172 | Bacteria | 2472 |
| 418 | Ga0373961_0026705 | 3300035241 | Bacteria | 1580 |
| 419 | Ga0373924_0022957 | 3300035410 | Bacteria | 2442 |
| 420 | Ga0373931_0004243 | 3300035691 | Bacteria | 6521 |
| 421 | Ga0373931_0047762 | 3300035691 | Bacteria | 2266 |
| 422 | Ga0373935_0214064 | 3300035692 | Bacteria | 1336 |
| 423 | Ga0373927_0211246 | 3300035695 | Bacteria | 1275 |
| 424 | Ga0373927_0371536 | 3300035695 | Bacteria | 943 |
| 425 | Ga0373947_0396840 | 3300035725 | Bacteria | 930 |
| 426 | Ga0373947_0489465 | 3300035725 | Bacteria | 835 |
| 427 | Ga0373937_0047084 | 3300036401 | Bacteria | 3945 |
| 428 | Ga0373937_0083917 | 3300036401 | Bacteria | 2948 |
| 429 | Ga0373925_0086694 | 3300037068 | Bacteria | 2389 |
| 430 | Ga0373925_0218783 | 3300037068 | Bacteria | 1519 |
| 431 | Ga0436365_1087719 | 3300039437 | Bacteria | 4747 |
| 432 | Ga0436361_0063474 | 3300039447 | Bacteria | 40373 |
| 433 | Ga0451793_0211455 | 3300041452 | Bacteria | 959 |
| 434 | Ga0451853_1771025 | 3300041512 | Bacteria | 984 |
| 435 | Ga0451853_2036237 | 3300041512 | Bacteria | 972 |
| 436 | Ga0451853_3364572 | 3300041512 | Bacteria | 1961 |
| 437 | Ga0439455_0113445 | 3300042012 | Bacteria | 755 |
| 438 | Ga0450898_002506 | 3300042134 | Bacteria | 2566 |
| 439 | Ga0466972_0025081 | 3300044658 | Bacteria | 2958 |
| 440 | Ga0466965_0043772 | 3300044683 | Bacteria | 2211 |
| 441 | Ga0466965_0073062 | 3300044683 | Bacteria | 1726 |
| 442 | Ga0466964_0053794 | 3300044706 | Bacteria | 1658 |
| 443 | Ga0453684_0097053 | 3300044712 | Bacteria | 3618 |
| 444 | Ga0453684_0264180 | 3300044712 | Bacteria | 1970 |
| 445 | Ga0466971_0071183 | 3300044719 | Bacteria | 1579 |
| 446 | Ga0466971_0167791 | 3300044719 | Bacteria | 1029 |
| 447 | Ga0466957_0096186 | 3300044842 | Bacteria | 1861 |
| 448 | Ga0466959_0135069 | 3300045049 | Bacteria | 1746 |
| 449 | Ga0495592_0000058 | 3300046454 | Bacteria | 101492 |
| 450 | Ga0495603_0162602 | 3300046455 | Bacteria | 1295 |
| 451 | Ga0495629_0242850 | 3300046459 | Bacteria | 1240 |
| 452 | Ga0495629_0385573 | 3300046459 | Bacteria | 953 |
| 453 | Ga0495638_0183347 | 3300046460 | Bacteria | 1193 |
| 454 | Ga0495582_0082359 | 3300046473 | Bacteria | 1788 |
| 455 | Ga0495605_0237502 | 3300046474 | Bacteria | 783 |
| 456 | Ga0495610_0111799 | 3300046512 | Bacteria | 1209 |
| 457 | Ga0495620_0080807 | 3300046515 | Bacteria | 1315 |
| 458 | Ga0495630_0053886 | 3300046517 | Bacteria | 3013 |
| 459 | Ga0495632_0009594 | 3300046519 | Bacteria | 5820 |
| 460 | Ga0495666_0107764 | 3300046526 | Bacteria | 1310 |
| 461 | Ga0495642_0193160 | 3300046528 | Bacteria | 887 |
| 462 | Ga0495597_0060297 | 3300046542 | Bacteria | 1655 |
| 463 | Ga0495645_0038465 | 3300046543 | Bacteria | 3489 |
| 464 | Ga0495645_0080535 | 3300046543 | Bacteria | 2337 |
| 465 | Ga0495622_0090507 | 3300046557 | Bacteria | 1406 |
| 466 | Ga0495622_0213969 | 3300046557 | Bacteria | 855 |
| 467 | Ga0495668_0222901 | 3300046616 | Bacteria | 1032 |
| 468 | Ga0495625_0043514 | 3300046660 | Bacteria | 3256 |
| 469 | Ga0495635_0387865 | 3300046663 | Bacteria | 929 |
| 470 | Ga0495647_0062407 | 3300046681 | Bacteria | 1473 |
| 471 | Ga0495658_0100457 | 3300046683 | Bacteria | 1726 |
| 472 | Ga0495658_0227849 | 3300046683 | Bacteria | 1168 |
| 473 | Ga0495613_0060017 | 3300046689 | Bacteria | 2787 |
| 474 | Ga0495624_0053558 | 3300046690 | Bacteria | 2547 |
| 475 | Ga0495671_0053495 | 3300046692 | Bacteria | 2004 |
| 476 | Ga0495649_0027389 | 3300046694 | Bacteria | 3163 |
| 477 | Ga0495649_0157220 | 3300046694 | Bacteria | 1193 |
| 478 | Ga0495676_0328157 | 3300047321 | Bacteria | 1027 |
| 479 | Ga0495687_004677 | 3300047443 | Bacteria | 9120 |
| 480 | Ga0495684_0247432 | 3300047471 | Bacteria | 1298 |
| 481 | Ga0495686_0040543 | 3300047472 | Bacteria | 2969 |
| 482 | Ga0495686_0149187 | 3300047472 | Bacteria | 1374 |
| 483 | Ga0495593_0014213 | 3300047673 | Bacteria | 4528 |
| 484 | Ga0496100_0692731 | 3300048903 | Bacteria | 795 |
| 485 | Ga0496101_0233302 | 3300048904 | Bacteria | 1431 |
| 486 | Ga0496104_0266622 | 3300048907 | Bacteria | 1625 |
| 487 | Ga0496104_0484827 | 3300048907 | Bacteria | 1148 |
| 488 | Ga0496106_0063823 | 3300048909 | Bacteria | 2800 |
| 489 | Ga0496106_0114183 | 3300048909 | Bacteria | 2106 |
| 490 | Ga0496107_0057678 | 3300048910 | Bacteria | 2807 |
| 491 | Ga0496108_0196660 | 3300048911 | Bacteria | 1749 |
| 492 | Ga0496108_0341271 | 3300048911 | Bacteria | 1307 |
| 493 | Ga0496109_0239920 | 3300048912 | Bacteria | 1706 |
| 494 | Ga0496111_0157423 | 3300048914 | Bacteria | 1686 |
| 495 | Ga0496112_0177543 | 3300048915 | Bacteria | 2094 |
| 496 | Ga0496112_0508009 | 3300048915 | Bacteria | 1140 |
| 497 | Ga0496113_0168688 | 3300048916 | Bacteria | 1733 |
| 498 | Ga0496114_0572281 | 3300048917 | Bacteria | 997 |
| 499 | Ga0496114_0700442 | 3300048917 | Bacteria | 888 |
| 500 | Ga0495682_0057697 | 3300049460 | Bacteria | 1405 |
| 501 | Ga0495682_0128928 | 3300049460 | Bacteria | 905 |
| 502 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 503 | Ga0501222_000014 | 3300049662 | Bacteria | 83609 |
| 504 | Ga0501035_0182549 | 3300049822 | Bacteria | 1807 |
| 505 | nmdc:mga03683_127560_c1 | 3300050489 | Bacteria | 1136 |
| 506 | nmdc:mga03683_27419_c1 | 3300050489 | Bacteria | 2256 |
| 507 | nmdc:mga03683_31327_c1 | 3300050489 | Bacteria | 2133 |
| 508 | nmdc:mga03683_59562_c1 | 3300050489 | Bacteria | 1611 |
| 509 | nmdc:mga00v17_14933_c1 | 3300050491 | Bacteria | 4348 |
| 510 | nmdc:mga0yw44_265547_c1 | 3300050492 | Bacteria | 1145 |
| 511 | nmdc:mga0k408_157975_c1 | 3300050493 | Bacteria | 1351 |
| 512 | nmdc:mga0k408_1630_c1 | 3300050493 | Bacteria | 12144 |
| 513 | nmdc:mga0k408_19589_c1 | 3300050493 | Bacteria | 3784 |
| 514 | nmdc:mga0k408_2442_c1 | 3300050493 | Bacteria | 9875 |
| 515 | nmdc:mga0k408_272977_c1 | 3300050493 | Bacteria | 1010 |
| 516 | nmdc:mga0k408_2896_c1 | 3300050493 | Bacteria | 9095 |
| 517 | nmdc:mga0k408_38999_c1 | 3300050493 | Bacteria | 2728 |
| 518 | nmdc:mga0k408_66880_c1 | 3300050493 | Bacteria | 2094 |
| 519 | nmdc:mga0k408_8882_c1 | 3300050493 | Bacteria | 5406 |
| 520 | nmdc:mga06z11_42151_c1 | 3300050494 | Bacteria | 2288 |
| 521 | nmdc:mga07m45_13053_c1 | 3300050496 | Bacteria | 4398 |
| 522 | nmdc:mga07m45_1758_c1 | 3300050496 | Bacteria | 9985 |
| 523 | nmdc:mga07m45_34272_c1 | 3300050496 | Bacteria | 2822 |
| 524 | nmdc:mga07m45_46051_c1 | 3300050496 | Bacteria | 1888 |
| 525 | nmdc:mga07m45_48364_c1 | 3300050496 | Bacteria | 2392 |
| 526 | nmdc:mga07m45_56802_c1 | 3300050496 | Bacteria | 2213 |
| 527 | nmdc:mga07m45_65477_c1 | 3300050496 | Bacteria | 2064 |
| 528 | nmdc:mga0sz30_11556_c1 | 3300050516 | Bacteria | 3413 |
| 529 | nmdc:mga0sz30_42730_c1 | 3300050516 | Bacteria | 1907 |
| 530 | Ga0495601_0065298 | 3300053077 | Bacteria | 2316 |
| 531 | Ga0495601_0124579 | 3300053077 | Bacteria | 1676 |
| 532 | Ga0495619_0235889 | 3300053085 | Bacteria | 1268 |
| 533 | Ga0500578_0263531 | 3300053086 | Bacteria | 1034 |
| 534 | Ga0500644_0002955 | 3300053088 | Bacteria | 4220 |
| 535 | Ga0500583_0025193 | 3300053092 | Bacteria | 2537 |
| 536 | Ga0500651_0049716 | 3300053093 | Bacteria | 2633 |
| 537 | Ga0500651_0072819 | 3300053093 | Bacteria | 2136 |
| 538 | Ga0500594_0021278 | 3300053118 | Bacteria | 1624 |
| 539 | Ga0500652_123037 | 3300053131 | Bacteria | 1084 |
| 540 | Ga0500658_0002643 | 3300053134 | Bacteria | 6901 |
| 541 | Ga0500559_0000089 | 3300053136 | Bacteria | 72681 |
| 542 | Ga0500568_0035636 | 3300053139 | Bacteria | 2029 |
| 543 | Ga0500616_0093336 | 3300053153 | Bacteria | 1486 |
| 544 | Ga0500619_052343 | 3300053154 | Bacteria | 1324 |
| 545 | Ga0500622_0063439 | 3300053156 | Bacteria | 1880 |
| 546 | Ga0500627_0099660 | 3300053158 | Bacteria | 1304 |
| 547 | Ga0500645_004599 | 3300053730 | Bacteria | 5254 |
| 548 | Ga0500587_002067 | 3300053739 | Bacteria | 2867 |
| 549 | Ga0466962_0046206 | 3300061719 | Bacteria | 2080 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025945 | Ga0207679_10219992 | Ga0207679_102199922 | 202 |
| 2 | 3300046694 | Ga0495649_0157220 | Ga0495649_0157220_165_788 | 202 |
| 3 | 3300030522 | Ga0307512_10131715 | Ga0307512_101317152 | 207 |
| 4 | 3300025908 | Ga0207643_10262814 | Ga0207643_102628142 | 215 |
| 5 | 3300005338 | Ga0068868_100513869 | Ga0068868_1005138692 | 216 |
| 6 | 3300005539 | Ga0068853_100019903 | Ga0068853_1000199034 | 216 |
| 7 | 3300028794 | Ga0307515_10307460 | Ga0307515_103074602 | 216 |
| 8 | 3300039447 | Ga0436361_0063474 | Ga0436361_0063474_37518_38186 | 216 |
| 9 | 3300046557 | Ga0495622_0090507 | Ga0495622_0090507_34_690 | 216 |
| 10 | 3300050496 | nmdc:mga07m45_65477_c1 | nmdc:mga07m45_65477_c1_1180_1851 | 216 |
| 11 | 3300053154 | Ga0500619_052343 | Ga0500619_052343_657_1313 | 216 |
| 12 | 3300025945 | Ga0207679_10331788 | Ga0207679_103317882 | 219 |
| 13 | 3300014497 | Ga0182008_10110264 | Ga0182008_101102641 | 220 |
| 14 | 3300025271 | Ga0207666_1021328 | Ga0207666_10213282 | 220 |
| 15 | 3300028794 | Ga0307515_10000058 | Ga0307515_1000005875 | 220 |
| 16 | 3300028794 | Ga0307515_10000283 | Ga0307515_1000028386 | 220 |
| 17 | 3300049822 | Ga0501035_0182549 | Ga0501035_0182549_1045_1713 | 220 |
| 18 | 3300005347 | Ga0070668_100042554 | Ga0070668_1000425543 | 221 |
| 19 | 3300005843 | Ga0068860_100300025 | Ga0068860_1003000252 | 221 |
| 20 | 3300006358 | Ga0068871_100135067 | Ga0068871_1001350673 | 221 |
| 21 | 3300025918 | Ga0207662_10028087 | Ga0207662_100280872 | 221 |
| 22 | 3300025972 | Ga0207668_10039984 | Ga0207668_100399842 | 221 |
| 23 | 3300028381 | Ga0268264_10120455 | Ga0268264_101204552 | 221 |
| 24 | 3300035241 | Ga0373961_0026705 | Ga0373961_0026705_399_1109 | 221 |
| 25 | 3300035691 | Ga0373931_0004243 | Ga0373931_0004243_2368_3078 | 221 |
| 26 | 3300041512 | Ga0451853_2036237 | Ga0451853_2036237_128_817 | 221 |
| 27 | iso_pu_bacteria | 2643221654 | 2644303786 | 221 |
| 28 | 3300005616 | Ga0068852_100044489 | Ga0068852_1000444894 | 222 |
| 29 | 3300006195 | Ga0075366_10133956 | Ga0075366_101339563 | 222 |
| 30 | 3300026142 | Ga0207698_10031156 | Ga0207698_100311562 | 222 |
| 31 | 3300031911 | Ga0307412_10322357 | Ga0307412_103223572 | 222 |
| 32 | 3300032002 | Ga0307416_100036273 | Ga0307416_1000362732 | 222 |
| 33 | 3300032005 | Ga0307411_10149626 | Ga0307411_101496262 | 222 |
| 34 | 3300041452 | Ga0451793_0211455 | Ga0451793_0211455_167_862 | 222 |
| 35 | 3300041512 | Ga0451853_3364572 | Ga0451853_3364572_445_1140 | 222 |
| 36 | 3300042134 | Ga0450898_002506 | Ga0450898_002506_211_894 | 222 |
| 37 | 3300049649 | Ga0501198_000003 | Ga0501198_000003_28954_29649 | 222 |
| 38 | 3300049662 | Ga0501222_000014 | Ga0501222_000014_28954_29649 | 222 |
| 39 | 3300050493 | nmdc:mga0k408_66880_c1 | nmdc:mga0k408_66880_c1_1317_1994 | 222 |
| 40 | 3300005331 | Ga0070670_100095561 | Ga0070670_1000955612 | 223 |
| 41 | 3300005333 | Ga0070677_10004539 | Ga0070677_100045395 | 223 |
| 42 | 3300005364 | Ga0070673_100089519 | Ga0070673_1000895193 | 223 |
| 43 | 3300005445 | Ga0070708_101038685 | Ga0070708_1010386851 | 223 |
| 44 | 3300005456 | Ga0070678_100002787 | Ga0070678_1000027873 | 223 |
| 45 | 3300005457 | Ga0070662_100048071 | Ga0070662_1000480713 | 223 |
| 46 | 3300005459 | Ga0068867_100060327 | Ga0068867_1000603272 | 223 |
| 47 | 3300005459 | Ga0068867_100375697 | Ga0068867_1003756972 | 223 |
| 48 | 3300005543 | Ga0070672_100122088 | Ga0070672_1001220882 | 223 |
| 49 | 3300005616 | Ga0068852_100501464 | Ga0068852_1005014642 | 223 |
| 50 | 3300005719 | Ga0068861_100028491 | Ga0068861_1000284914 | 223 |
| 51 | 3300005844 | Ga0068862_100051143 | Ga0068862_1000511432 | 223 |
| 52 | 3300009148 | Ga0105243_10050828 | Ga0105243_100508282 | 223 |
| 53 | 3300009176 | Ga0105242_10459847 | Ga0105242_104598472 | 223 |
| 54 | 3300013306 | Ga0163162_10349262 | Ga0163162_103492622 | 223 |
| 55 | 3300025893 | Ga0207682_10020195 | Ga0207682_100201953 | 223 |
| 56 | 3300025925 | Ga0207650_10486515 | Ga0207650_104865152 | 223 |
| 57 | 3300025931 | Ga0207644_10392153 | Ga0207644_103921532 | 223 |
| 58 | 3300025940 | Ga0207691_10233306 | Ga0207691_102333062 | 223 |
| 59 | 3300025945 | Ga0207679_10257686 | Ga0207679_102576862 | 223 |
| 60 | 3300026075 | Ga0207708_10114660 | Ga0207708_101146602 | 223 |
| 61 | 3300026118 | Ga0207675_100116647 | Ga0207675_1001166472 | 223 |
| 62 | 3300026121 | Ga0207683_10107086 | Ga0207683_101070861 | 223 |
| 63 | 3300028380 | Ga0268265_10154785 | Ga0268265_101547853 | 223 |
| 64 | 3300005330 | Ga0070690_100082135 | Ga0070690_1000821353 | 224 |
| 65 | 3300005331 | Ga0070670_100066652 | Ga0070670_1000666523 | 224 |
| 66 | 3300005331 | Ga0070670_100107247 | Ga0070670_1001072472 | 224 |
| 67 | 3300005331 | Ga0070670_100656111 | Ga0070670_1006561112 | 224 |
| 68 | 3300005333 | Ga0070677_10019937 | Ga0070677_100199372 | 224 |
| 69 | 3300005334 | Ga0068869_100002991 | Ga0068869_1000029913 | 224 |
| 70 | 3300005334 | Ga0068869_100005288 | Ga0068869_1000052882 | 224 |
| 71 | 3300005335 | Ga0070666_10006136 | Ga0070666_100061364 | 224 |
| 72 | 3300005335 | Ga0070666_10064923 | Ga0070666_100649232 | 224 |
| 73 | 3300005336 | Ga0070680_100007042 | Ga0070680_1000070422 | 224 |
| 74 | 3300005338 | Ga0068868_100055816 | Ga0068868_1000558162 | 224 |
| 75 | 3300005338 | Ga0068868_100212205 | Ga0068868_1002122051 | 224 |
| 76 | 3300005339 | Ga0070660_100208172 | Ga0070660_1002081722 | 224 |
| 77 | 3300005340 | Ga0070689_100043064 | Ga0070689_1000430643 | 224 |
| 78 | 3300005340 | Ga0070689_100354494 | Ga0070689_1003544942 | 224 |
| 79 | 3300005340 | Ga0070689_100575896 | Ga0070689_1005758962 | 224 |
| 80 | 3300005347 | Ga0070668_100006321 | Ga0070668_1000063213 | 224 |
| 81 | 3300005353 | Ga0070669_100002253 | Ga0070669_1000022534 | 224 |
| 82 | 3300005353 | Ga0070669_100136449 | Ga0070669_1001364491 | 224 |
| 83 | 3300005353 | Ga0070669_100171547 | Ga0070669_1001715473 | 224 |
| 84 | 3300005354 | Ga0070675_100086401 | Ga0070675_1000864012 | 224 |
| 85 | 3300005354 | Ga0070675_100117013 | Ga0070675_1001170133 | 224 |
| 86 | 3300005355 | Ga0070671_100052136 | Ga0070671_1000521362 | 224 |
| 87 | 3300005355 | Ga0070671_100145790 | Ga0070671_1001457902 | 224 |
| 88 | 3300005355 | Ga0070671_100744408 | Ga0070671_1007444081 | 224 |
| 89 | 3300005356 | Ga0070674_100001063 | Ga0070674_1000010637 | 224 |
| 90 | 3300005356 | Ga0070674_100096706 | Ga0070674_1000967062 | 224 |
| 91 | 3300005364 | Ga0070673_100023835 | Ga0070673_1000238353 | 224 |
| 92 | 3300005364 | Ga0070673_100042709 | Ga0070673_1000427093 | 224 |
| 93 | 3300005366 | Ga0070659_100172482 | Ga0070659_1001724822 | 224 |
| 94 | 3300005366 | Ga0070659_100358490 | Ga0070659_1003584902 | 224 |
| 95 | 3300005367 | Ga0070667_100008398 | Ga0070667_1000083982 | 224 |
| 96 | 3300005367 | Ga0070667_100016134 | Ga0070667_1000161343 | 224 |
| 97 | 3300005367 | Ga0070667_100203674 | Ga0070667_1002036743 | 224 |
| 98 | 3300005441 | Ga0070700_100085315 | Ga0070700_1000853151 | 224 |
| 99 | 3300005456 | Ga0070678_100006378 | Ga0070678_1000063787 | 224 |
| 100 | 3300005456 | Ga0070678_100036945 | Ga0070678_1000369452 | 224 |
| 101 | 3300005456 | Ga0070678_100044816 | Ga0070678_1000448162 | 224 |
| 102 | 3300005456 | Ga0070678_100225574 | Ga0070678_1002255742 | 224 |
| 103 | 3300005457 | Ga0070662_100083588 | Ga0070662_1000835882 | 224 |
| 104 | 3300005459 | Ga0068867_100001822 | Ga0068867_1000018224 | 224 |
| 105 | 3300005459 | Ga0068867_100145206 | Ga0068867_1001452062 | 224 |
| 106 | 3300005466 | Ga0070685_10053740 | Ga0070685_100537403 | 224 |
| 107 | 3300005530 | Ga0070679_100121949 | Ga0070679_1001219492 | 224 |
| 108 | 3300005530 | Ga0070679_100200368 | Ga0070679_1002003683 | 224 |
| 109 | 3300005543 | Ga0070672_100016969 | Ga0070672_1000169692 | 224 |
| 110 | 3300005543 | Ga0070672_100059823 | Ga0070672_1000598233 | 224 |
| 111 | 3300005543 | Ga0070672_100108780 | Ga0070672_1001087802 | 224 |
| 112 | 3300005544 | Ga0070686_100263643 | Ga0070686_1002636432 | 224 |
| 113 | 3300005547 | Ga0070693_100055809 | Ga0070693_1000558093 | 224 |
| 114 | 3300005548 | Ga0070665_100241288 | Ga0070665_1002412883 | 224 |
| 115 | 3300005548 | Ga0070665_100542896 | Ga0070665_1005428961 | 224 |
| 116 | 3300005564 | Ga0070664_100192046 | Ga0070664_1001920462 | 224 |
| 117 | 3300005564 | Ga0070664_100437425 | Ga0070664_1004374252 | 224 |
| 118 | 3300005578 | Ga0068854_100049126 | Ga0068854_1000491263 | 224 |
| 119 | 3300005578 | Ga0068854_100095511 | Ga0068854_1000955112 | 224 |
| 120 | 3300005614 | Ga0068856_100100886 | Ga0068856_1001008862 | 224 |
| 121 | 3300005614 | Ga0068856_100239508 | Ga0068856_1002395082 | 224 |
| 122 | 3300005615 | Ga0070702_100050540 | Ga0070702_1000505402 | 224 |
| 123 | 3300005616 | Ga0068852_100021495 | Ga0068852_1000214954 | 224 |
| 124 | 3300005616 | Ga0068852_100099245 | Ga0068852_1000992452 | 224 |
| 125 | 3300005616 | Ga0068852_100217233 | Ga0068852_1002172332 | 224 |
| 126 | 3300005617 | Ga0068859_100031777 | Ga0068859_1000317772 | 224 |
| 127 | 3300005617 | Ga0068859_100040006 | Ga0068859_1000400062 | 224 |
| 128 | 3300005618 | Ga0068864_100007367 | Ga0068864_1000073673 | 224 |
| 129 | 3300005618 | Ga0068864_100047641 | Ga0068864_1000476413 | 224 |
| 130 | 3300005618 | Ga0068864_100110469 | Ga0068864_1001104692 | 224 |
| 131 | 3300005618 | Ga0068864_100603072 | Ga0068864_1006030721 | 224 |
| 132 | 3300005718 | Ga0068866_10000966 | Ga0068866_100009664 | 224 |
| 133 | 3300005719 | Ga0068861_100001733 | Ga0068861_1000017339 | 224 |
| 134 | 3300005719 | Ga0068861_100104449 | Ga0068861_1001044493 | 224 |
| 135 | 3300005719 | Ga0068861_100325141 | Ga0068861_1003251412 | 224 |
| 136 | 3300005834 | Ga0068851_10235861 | Ga0068851_102358612 | 224 |
| 137 | 3300005834 | Ga0068851_10317969 | Ga0068851_103179691 | 224 |
| 138 | 3300005840 | Ga0068870_10119906 | Ga0068870_101199063 | 224 |
| 139 | 3300005841 | Ga0068863_100012061 | Ga0068863_1000120612 | 224 |
| 140 | 3300005841 | Ga0068863_100021461 | Ga0068863_1000214614 | 224 |
| 141 | 3300005841 | Ga0068863_100099046 | Ga0068863_1000990462 | 224 |
| 142 | 3300005841 | Ga0068863_100490113 | Ga0068863_1004901132 | 224 |
| 143 | 3300005842 | Ga0068858_100003483 | Ga0068858_1000034839 | 224 |
| 144 | 3300005842 | Ga0068858_100008836 | Ga0068858_1000088363 | 224 |
| 145 | 3300005842 | Ga0068858_100196274 | Ga0068858_1001962742 | 224 |
| 146 | 3300005843 | Ga0068860_100007136 | Ga0068860_1000071363 | 224 |
| 147 | 3300005844 | Ga0068862_100186179 | Ga0068862_1001861792 | 224 |
| 148 | 3300006028 | Ga0070717_10515221 | Ga0070717_105152211 | 224 |
| 149 | 3300006173 | Ga0070716_100113244 | Ga0070716_1001132442 | 224 |
| 150 | 3300006173 | Ga0070716_100514352 | Ga0070716_1005143521 | 224 |
| 151 | 3300006237 | Ga0097621_100077972 | Ga0097621_1000779722 | 224 |
| 152 | 3300006237 | Ga0097621_100169744 | Ga0097621_1001697442 | 224 |
| 153 | 3300006358 | Ga0068871_100030830 | Ga0068871_1000308303 | 224 |
| 154 | 3300006881 | Ga0068865_100063511 | Ga0068865_1000635113 | 224 |
| 155 | 3300006914 | Ga0075436_100350251 | Ga0075436_1003502512 | 224 |
| 156 | 3300006931 | Ga0097620_100031777 | Ga0097620_1000317772 | 224 |
| 157 | 3300006931 | Ga0097620_100040006 | Ga0097620_1000400062 | 224 |
| 158 | 3300009093 | Ga0105240_10251903 | Ga0105240_102519032 | 224 |
| 159 | 3300009094 | Ga0111539_10158084 | Ga0111539_101580842 | 224 |
| 160 | 3300009098 | Ga0105245_10655743 | Ga0105245_106557432 | 224 |
| 161 | 3300009148 | Ga0105243_10049805 | Ga0105243_100498054 | 224 |
| 162 | 3300009176 | Ga0105242_10034077 | Ga0105242_100340772 | 224 |
| 163 | 3300009177 | Ga0105248_10004886 | Ga0105248_100048869 | 224 |
| 164 | 3300009177 | Ga0105248_10177454 | Ga0105248_101774542 | 224 |
| 165 | 3300009177 | Ga0105248_10797149 | Ga0105248_107971491 | 224 |
| 166 | 3300009551 | Ga0105238_10097608 | Ga0105238_100976082 | 224 |
| 167 | 3300010375 | Ga0105239_10226444 | Ga0105239_102264443 | 224 |
| 168 | 3300013102 | Ga0157371_10110797 | Ga0157371_101107972 | 224 |
| 169 | 3300013102 | Ga0157371_10454020 | Ga0157371_104540201 | 224 |
| 170 | 3300013296 | Ga0157374_10010165 | Ga0157374_100101657 | 224 |
| 171 | 3300013296 | Ga0157374_10131485 | Ga0157374_101314853 | 224 |
| 172 | 3300013296 | Ga0157374_10387565 | Ga0157374_103875652 | 224 |
| 173 | 3300013297 | Ga0157378_10437106 | Ga0157378_104371062 | 224 |
| 174 | 3300013306 | Ga0163162_10024388 | Ga0163162_100243883 | 224 |
| 175 | 3300013307 | Ga0157372_10112639 | Ga0157372_101126393 | 224 |
| 176 | 3300013308 | Ga0157375_10001495 | Ga0157375_1000149511 | 224 |
| 177 | 3300013308 | Ga0157375_10157464 | Ga0157375_101574643 | 224 |
| 178 | 3300013308 | Ga0157375_10308886 | Ga0157375_103088863 | 224 |
| 179 | 3300014325 | Ga0163163_10116347 | Ga0163163_101163472 | 224 |
| 180 | 3300014325 | Ga0163163_10193097 | Ga0163163_101930973 | 224 |
| 181 | 3300014326 | Ga0157380_10001259 | Ga0157380_100012593 | 224 |
| 182 | 3300014968 | Ga0157379_10008970 | Ga0157379_100089707 | 224 |
| 183 | 3300014968 | Ga0157379_10078842 | Ga0157379_100788423 | 224 |
| 184 | 3300014968 | Ga0157379_10079954 | Ga0157379_100799543 | 224 |
| 185 | 3300014969 | Ga0157376_10124349 | Ga0157376_101243492 | 224 |
| 186 | 3300014969 | Ga0157376_10187061 | Ga0157376_101870613 | 224 |
| 187 | 3300014969 | Ga0157376_10603019 | Ga0157376_106030192 | 224 |
| 188 | 3300017792 | Ga0163161_10037576 | Ga0163161_100375764 | 224 |
| 189 | 3300025315 | Ga0207697_10017948 | Ga0207697_100179482 | 224 |
| 190 | 3300025893 | Ga0207682_10008363 | Ga0207682_100083633 | 224 |
| 191 | 3300025893 | Ga0207682_10011228 | Ga0207682_100112283 | 224 |
| 192 | 3300025899 | Ga0207642_10036666 | Ga0207642_100366662 | 224 |
| 193 | 3300025901 | Ga0207688_10335554 | Ga0207688_103355542 | 224 |
| 194 | 3300025903 | Ga0207680_10006180 | Ga0207680_100061803 | 224 |
| 195 | 3300025903 | Ga0207680_10021819 | Ga0207680_100218194 | 224 |
| 196 | 3300025907 | Ga0207645_10017896 | Ga0207645_100178963 | 224 |
| 197 | 3300025907 | Ga0207645_10028050 | Ga0207645_100280503 | 224 |
| 198 | 3300025907 | Ga0207645_10047337 | Ga0207645_100473372 | 224 |
| 199 | 3300025907 | Ga0207645_10068425 | Ga0207645_100684253 | 224 |
| 200 | 3300025909 | Ga0207705_10146168 | Ga0207705_101461682 | 224 |
| 201 | 3300025909 | Ga0207705_10297833 | Ga0207705_102978332 | 224 |
| 202 | 3300025912 | Ga0207707_10180268 | Ga0207707_101802682 | 224 |
| 203 | 3300025913 | Ga0207695_10280749 | Ga0207695_102807492 | 224 |
| 204 | 3300025917 | Ga0207660_10051622 | Ga0207660_100516223 | 224 |
| 205 | 3300025921 | Ga0207652_10026613 | Ga0207652_100266133 | 224 |
| 206 | 3300025923 | Ga0207681_10000367 | Ga0207681_1000036723 | 224 |
| 207 | 3300025923 | Ga0207681_10381663 | Ga0207681_103816632 | 224 |
| 208 | 3300025924 | Ga0207694_10069930 | Ga0207694_100699302 | 224 |
| 209 | 3300025925 | Ga0207650_10079924 | Ga0207650_100799242 | 224 |
| 210 | 3300025925 | Ga0207650_10097983 | Ga0207650_100979832 | 224 |
| 211 | 3300025925 | Ga0207650_10582017 | Ga0207650_105820172 | 224 |
| 212 | 3300025926 | Ga0207659_10003915 | Ga0207659_100039153 | 224 |
| 213 | 3300025926 | Ga0207659_10065085 | Ga0207659_100650852 | 224 |
| 214 | 3300025931 | Ga0207644_10001664 | Ga0207644_100016646 | 224 |
| 215 | 3300025931 | Ga0207644_10071743 | Ga0207644_100717432 | 224 |
| 216 | 3300025931 | Ga0207644_10144602 | Ga0207644_101446022 | 224 |
| 217 | 3300025931 | Ga0207644_10208899 | Ga0207644_102088991 | 224 |
| 218 | 3300025933 | Ga0207706_10015077 | Ga0207706_100150773 | 224 |
| 219 | 3300025933 | Ga0207706_10053026 | Ga0207706_100530263 | 224 |
| 220 | 3300025933 | Ga0207706_10070767 | Ga0207706_100707672 | 224 |
| 221 | 3300025934 | Ga0207686_10024829 | Ga0207686_100248292 | 224 |
| 222 | 3300025935 | Ga0207709_10017657 | Ga0207709_100176572 | 224 |
| 223 | 3300025936 | Ga0207670_10004979 | Ga0207670_100049792 | 224 |
| 224 | 3300025936 | Ga0207670_10387601 | Ga0207670_103876011 | 224 |
| 225 | 3300025937 | Ga0207669_10003090 | Ga0207669_100030902 | 224 |
| 226 | 3300025937 | Ga0207669_10346775 | Ga0207669_103467751 | 224 |
| 227 | 3300025938 | Ga0207704_10003682 | Ga0207704_100036822 | 224 |
| 228 | 3300025940 | Ga0207691_10010398 | Ga0207691_100103982 | 224 |
| 229 | 3300025940 | Ga0207691_10053338 | Ga0207691_100533382 | 224 |
| 230 | 3300025940 | Ga0207691_10197505 | Ga0207691_101975052 | 224 |
| 231 | 3300025940 | Ga0207691_10760093 | Ga0207691_107600931 | 224 |
| 232 | 3300025941 | Ga0207711_10217656 | Ga0207711_102176563 | 224 |
| 233 | 3300025941 | Ga0207711_10239343 | Ga0207711_102393432 | 224 |
| 234 | 3300025941 | Ga0207711_10552324 | Ga0207711_105523241 | 224 |
| 235 | 3300025941 | Ga0207711_10567630 | Ga0207711_105676302 | 224 |
| 236 | 3300025942 | Ga0207689_10006473 | Ga0207689_100064738 | 224 |
| 237 | 3300025942 | Ga0207689_10041303 | Ga0207689_100413033 | 224 |
| 238 | 3300025942 | Ga0207689_10063299 | Ga0207689_100632993 | 224 |
| 239 | 3300025945 | Ga0207679_10045101 | Ga0207679_100451012 | 224 |
| 240 | 3300025945 | Ga0207679_10249459 | Ga0207679_102494592 | 224 |
| 241 | 3300025945 | Ga0207679_10302425 | Ga0207679_103024252 | 224 |
| 242 | 3300025960 | Ga0207651_10001537 | Ga0207651_100015373 | 224 |
| 243 | 3300025960 | Ga0207651_10036336 | Ga0207651_100363363 | 224 |
| 244 | 3300025960 | Ga0207651_10317427 | Ga0207651_103174271 | 224 |
| 245 | 3300025961 | Ga0207712_10003631 | Ga0207712_100036313 | 224 |
| 246 | 3300025972 | Ga0207668_10007182 | Ga0207668_100071824 | 224 |
| 247 | 3300025981 | Ga0207640_10291096 | Ga0207640_102910962 | 224 |
| 248 | 3300025981 | Ga0207640_10419401 | Ga0207640_104194011 | 224 |
| 249 | 3300025986 | Ga0207658_10000767 | Ga0207658_1000076718 | 224 |
| 250 | 3300025986 | Ga0207658_10007546 | Ga0207658_100075467 | 224 |
| 251 | 3300025986 | Ga0207658_10174648 | Ga0207658_101746482 | 224 |
| 252 | 3300026023 | Ga0207677_10004355 | Ga0207677_100043553 | 224 |
| 253 | 3300026023 | Ga0207677_10024944 | Ga0207677_100249443 | 224 |
| 254 | 3300026035 | Ga0207703_10001725 | Ga0207703_100017256 | 224 |
| 255 | 3300026035 | Ga0207703_10001947 | Ga0207703_1000194710 | 224 |
| 256 | 3300026035 | Ga0207703_10168066 | Ga0207703_101680662 | 224 |
| 257 | 3300026041 | Ga0207639_10166902 | Ga0207639_101669022 | 224 |
| 258 | 3300026041 | Ga0207639_10569091 | Ga0207639_105690911 | 224 |
| 259 | 3300026075 | Ga0207708_10007760 | Ga0207708_100077603 | 224 |
| 260 | 3300026078 | Ga0207702_10017891 | Ga0207702_100178913 | 224 |
| 261 | 3300026078 | Ga0207702_10132541 | Ga0207702_101325413 | 224 |
| 262 | 3300026088 | Ga0207641_10000960 | Ga0207641_100009608 | 224 |
| 263 | 3300026088 | Ga0207641_10042184 | Ga0207641_100421844 | 224 |
| 264 | 3300026088 | Ga0207641_10120271 | Ga0207641_101202713 | 224 |
| 265 | 3300026088 | Ga0207641_10588319 | Ga0207641_105883192 | 224 |
| 266 | 3300026089 | Ga0207648_10024642 | Ga0207648_100246423 | 224 |
| 267 | 3300026089 | Ga0207648_11017972 | Ga0207648_110179721 | 224 |
| 268 | 3300026095 | Ga0207676_10000778 | Ga0207676_1000077817 | 224 |
| 269 | 3300026095 | Ga0207676_10009337 | Ga0207676_100093374 | 224 |
| 270 | 3300026116 | Ga0207674_10350109 | Ga0207674_103501092 | 224 |
| 271 | 3300026118 | Ga0207675_100016108 | Ga0207675_1000161086 | 224 |
| 272 | 3300026118 | Ga0207675_100120487 | Ga0207675_1001204872 | 224 |
| 273 | 3300026121 | Ga0207683_10060942 | Ga0207683_100609422 | 224 |
| 274 | 3300026121 | Ga0207683_10175918 | Ga0207683_101759182 | 224 |
| 275 | 3300026121 | Ga0207683_10281002 | Ga0207683_102810022 | 224 |
| 276 | 3300026142 | Ga0207698_10017876 | Ga0207698_100178763 | 224 |
| 277 | 3300026142 | Ga0207698_10325986 | Ga0207698_103259863 | 224 |
| 278 | 3300026142 | Ga0207698_10345835 | Ga0207698_103458351 | 224 |
| 279 | 3300028379 | Ga0268266_10209304 | Ga0268266_102093043 | 224 |
| 280 | 3300028380 | Ga0268265_10047909 | Ga0268265_100479094 | 224 |
| 281 | 3300028380 | Ga0268265_10386052 | Ga0268265_103860521 | 224 |
| 282 | 3300028381 | Ga0268264_10001133 | Ga0268264_1000113317 | 224 |
| 283 | 3300028381 | Ga0268264_10047978 | Ga0268264_100479783 | 224 |
| 284 | 3300031730 | Ga0307516_10084634 | Ga0307516_100846343 | 224 |
| 285 | 3300035170 | Ga0373943_0059936 | Ga0373943_0059936_666_1367 | 224 |
| 286 | 3300035172 | Ga0373955_0041282 | Ga0373955_0041282_263_967 | 224 |
| 287 | 3300035410 | Ga0373924_0022957 | Ga0373924_0022957_693_1397 | 224 |
| 288 | 3300035692 | Ga0373935_0214064 | Ga0373935_0214064_469_1173 | 224 |
| 289 | 3300035725 | Ga0373947_0396840 | Ga0373947_0396840_139_843 | 224 |
| 290 | 3300035725 | Ga0373947_0489465 | Ga0373947_0489465_121_825 | 224 |
| 291 | 3300036401 | Ga0373937_0047084 | Ga0373937_0047084_3230_3934 | 224 |
| 292 | 3300036401 | Ga0373937_0083917 | Ga0373937_0083917_2140_2844 | 224 |
| 293 | 3300039437 | Ga0436365_1087719 | Ga0436365_1087719_290_994 | 224 |
| 294 | 3300044683 | Ga0466965_0043772 | Ga0466965_0043772_924_1613 | 224 |
| 295 | 3300044706 | Ga0466964_0053794 | Ga0466964_0053794_414_1139 | 224 |
| 296 | 3300044719 | Ga0466971_0071183 | Ga0466971_0071183_540_1265 | 224 |
| 297 | 3300044842 | Ga0466957_0096186 | Ga0466957_0096186_752_1477 | 224 |
| 298 | 3300045049 | Ga0466959_0135069 | Ga0466959_0135069_23_748 | 224 |
| 299 | 3300046455 | Ga0495603_0162602 | Ga0495603_0162602_54_758 | 224 |
| 300 | 3300046459 | Ga0495629_0242850 | Ga0495629_0242850_436_1140 | 224 |
| 301 | 3300046459 | Ga0495629_0385573 | Ga0495629_0385573_31_735 | 224 |
| 302 | 3300046543 | Ga0495645_0038465 | Ga0495645_0038465_416_1120 | 224 |
| 303 | 3300046543 | Ga0495645_0080535 | Ga0495645_0080535_406_1110 | 224 |
| 304 | 3300046663 | Ga0495635_0387865 | Ga0495635_0387865_13_717 | 224 |
| 305 | 3300046681 | Ga0495647_0062407 | Ga0495647_0062407_417_1121 | 224 |
| 306 | 3300046683 | Ga0495658_0100457 | Ga0495658_0100457_386_1090 | 224 |
| 307 | 3300046683 | Ga0495658_0227849 | Ga0495658_0227849_345_1049 | 224 |
| 308 | 3300046689 | Ga0495613_0060017 | Ga0495613_0060017_1749_2453 | 224 |
| 309 | 3300047471 | Ga0495684_0247432 | Ga0495684_0247432_547_1251 | 224 |
| 310 | 3300048903 | Ga0496100_0692731 | Ga0496100_0692731_34_747 | 224 |
| 311 | 3300048904 | Ga0496101_0233302 | Ga0496101_0233302_230_943 | 224 |
| 312 | 3300048907 | Ga0496104_0266622 | Ga0496104_0266622_383_1087 | 224 |
| 313 | 3300048909 | Ga0496106_0114183 | Ga0496106_0114183_679_1386 | 224 |
| 314 | 3300048910 | Ga0496107_0057678 | Ga0496107_0057678_1292_1996 | 224 |
| 315 | 3300048911 | Ga0496108_0196660 | Ga0496108_0196660_33_740 | 224 |
| 316 | 3300048911 | Ga0496108_0341271 | Ga0496108_0341271_472_1176 | 224 |
| 317 | 3300048912 | Ga0496109_0239920 | Ga0496109_0239920_273_980 | 224 |
| 318 | 3300048914 | Ga0496111_0157423 | Ga0496111_0157423_939_1643 | 224 |
| 319 | 3300048915 | Ga0496112_0177543 | Ga0496112_0177543_745_1449 | 224 |
| 320 | 3300048916 | Ga0496113_0168688 | Ga0496113_0168688_300_1004 | 224 |
| 321 | 3300048917 | Ga0496114_0572281 | Ga0496114_0572281_231_944 | 224 |
| 322 | 3300048917 | Ga0496114_0700442 | Ga0496114_0700442_91_795 | 224 |
| 323 | 3300050489 | nmdc:mga03683_127560_c1 | nmdc:mga03683_127560_c1_200_925 | 224 |
| 324 | 3300050493 | nmdc:mga0k408_2442_c1 | nmdc:mga0k408_2442_c1_1884_2609 | 224 |
| 325 | 3300053077 | Ga0495601_0065298 | Ga0495601_0065298_802_1506 | 224 |
| 326 | 3300053077 | Ga0495601_0124579 | Ga0495601_0124579_950_1654 | 224 |
| 327 | 3300053085 | Ga0495619_0235889 | Ga0495619_0235889_83_787 | 224 |
| 328 | 3300061719 | Ga0466962_0046206 | Ga0466962_0046206_775_1500 | 224 |
| 329 | 3300003320 | rootH2_10078152 | rootH2_100781522 | 225 |
| 330 | 3300003322 | rootL2_10064200 | rootL2_100642005 | 225 |
| 331 | 3300003323 | rootH1_10062634 | rootH1_100626341 | 225 |
| 332 | 3300005328 | Ga0070676_10020284 | Ga0070676_100202842 | 225 |
| 333 | 3300005334 | Ga0068869_100021512 | Ga0068869_1000215123 | 225 |
| 334 | 3300005334 | Ga0068869_100141070 | Ga0068869_1001410702 | 225 |
| 335 | 3300005338 | Ga0068868_100118010 | Ga0068868_1001180102 | 225 |
| 336 | 3300005353 | Ga0070669_100269499 | Ga0070669_1002694991 | 225 |
| 337 | 3300005354 | Ga0070675_100212377 | Ga0070675_1002123772 | 225 |
| 338 | 3300005355 | Ga0070671_100005065 | Ga0070671_1000050655 | 225 |
| 339 | 3300005355 | Ga0070671_100074057 | Ga0070671_1000740572 | 225 |
| 340 | 3300005366 | Ga0070659_100871255 | Ga0070659_1008712551 | 225 |
| 341 | 3300005367 | Ga0070667_100034647 | Ga0070667_1000346472 | 225 |
| 342 | 3300005367 | Ga0070667_100155903 | Ga0070667_1001559032 | 225 |
| 343 | 3300005456 | Ga0070678_100167182 | Ga0070678_1001671822 | 225 |
| 344 | 3300005457 | Ga0070662_100004630 | Ga0070662_1000046301 | 225 |
| 345 | 3300005459 | Ga0068867_100049765 | Ga0068867_1000497652 | 225 |
| 346 | 3300005467 | Ga0070706_100034688 | Ga0070706_1000346883 | 225 |
| 347 | 3300005468 | Ga0070707_100073029 | Ga0070707_1000730292 | 225 |
| 348 | 3300005471 | Ga0070698_100117874 | Ga0070698_1001178742 | 225 |
| 349 | 3300005539 | Ga0068853_100117387 | Ga0068853_1001173872 | 225 |
| 350 | 3300005548 | Ga0070665_100009344 | Ga0070665_1000093445 | 225 |
| 351 | 3300005564 | Ga0070664_100439270 | Ga0070664_1004392702 | 225 |
| 352 | 3300005577 | Ga0068857_100013289 | Ga0068857_1000132892 | 225 |
| 353 | 3300005577 | Ga0068857_100060842 | Ga0068857_1000608422 | 225 |
| 354 | 3300005577 | Ga0068857_100448608 | Ga0068857_1004486081 | 225 |
| 355 | 3300005618 | Ga0068864_100013078 | Ga0068864_1000130785 | 225 |
| 356 | 3300005841 | Ga0068863_100017050 | Ga0068863_1000170502 | 225 |
| 357 | 3300005843 | Ga0068860_100149037 | Ga0068860_1001490372 | 225 |
| 358 | 3300005843 | Ga0068860_100417893 | Ga0068860_1004178932 | 225 |
| 359 | 3300005844 | Ga0068862_100556370 | Ga0068862_1005563702 | 225 |
| 360 | 3300006038 | Ga0075365_10146547 | Ga0075365_101465472 | 225 |
| 361 | 3300006042 | Ga0075368_10049291 | Ga0075368_100492912 | 225 |
| 362 | 3300006048 | Ga0075363_100013183 | Ga0075363_1000131832 | 225 |
| 363 | 3300006048 | Ga0075363_100140266 | Ga0075363_1001402662 | 225 |
| 364 | 3300006051 | Ga0075364_10039132 | Ga0075364_100391322 | 225 |
| 365 | 3300006051 | Ga0075364_10290512 | Ga0075364_102905122 | 225 |
| 366 | 3300006177 | Ga0075362_10014664 | Ga0075362_100146644 | 225 |
| 367 | 3300006177 | Ga0075362_10031158 | Ga0075362_100311582 | 225 |
| 368 | 3300006178 | Ga0075367_10019680 | Ga0075367_100196803 | 225 |
| 369 | 3300006186 | Ga0075369_10041977 | Ga0075369_100419772 | 225 |
| 370 | 3300006195 | Ga0075366_10002222 | Ga0075366_100022228 | 225 |
| 371 | 3300006195 | Ga0075366_10006978 | Ga0075366_100069782 | 225 |
| 372 | 3300006195 | Ga0075366_10014619 | Ga0075366_100146195 | 225 |
| 373 | 3300006195 | Ga0075366_10030670 | Ga0075366_100306702 | 225 |
| 374 | 3300006195 | Ga0075366_10062213 | Ga0075366_100622132 | 225 |
| 375 | 3300006195 | Ga0075366_10100621 | Ga0075366_101006212 | 225 |
| 376 | 3300006237 | Ga0097621_100313600 | Ga0097621_1003136002 | 225 |
| 377 | 3300006353 | Ga0075370_10001175 | Ga0075370_100011758 | 225 |
| 378 | 3300006353 | Ga0075370_10002004 | Ga0075370_100020042 | 225 |
| 379 | 3300006353 | Ga0075370_10010857 | Ga0075370_100108572 | 225 |
| 380 | 3300006353 | Ga0075370_10031532 | Ga0075370_100315322 | 225 |
| 381 | 3300006353 | Ga0075370_10084283 | Ga0075370_100842832 | 225 |
| 382 | 3300009093 | Ga0105240_10003510 | Ga0105240_1000351016 | 225 |
| 383 | 3300009093 | Ga0105240_10167581 | Ga0105240_101675812 | 225 |
| 384 | 3300009098 | Ga0105245_10105158 | Ga0105245_101051582 | 225 |
| 385 | 3300009101 | Ga0105247_10349232 | Ga0105247_103492322 | 225 |
| 386 | 3300009148 | Ga0105243_10157318 | Ga0105243_101573182 | 225 |
| 387 | 3300009176 | Ga0105242_11287253 | Ga0105242_112872531 | 225 |
| 388 | 3300009545 | Ga0105237_10001543 | Ga0105237_1000154312 | 225 |
| 389 | 3300009545 | Ga0105237_10012060 | Ga0105237_100120606 | 225 |
| 390 | 3300009545 | Ga0105237_10289327 | Ga0105237_102893272 | 225 |
| 391 | 3300009551 | Ga0105238_10081700 | Ga0105238_100817004 | 225 |
| 392 | 3300010375 | Ga0105239_10002318 | Ga0105239_1000231813 | 225 |
| 393 | 3300010375 | Ga0105239_10133619 | Ga0105239_101336192 | 225 |
| 394 | 3300010375 | Ga0105239_10248180 | Ga0105239_102481802 | 225 |
| 395 | 3300012513 | Ga0157326_1003608 | Ga0157326_10036082 | 225 |
| 396 | 3300013296 | Ga0157374_10380157 | Ga0157374_103801572 | 225 |
| 397 | 3300013297 | Ga0157378_10123242 | Ga0157378_101232422 | 225 |
| 398 | 3300013306 | Ga0163162_10354913 | Ga0163162_103549132 | 225 |
| 399 | 3300013308 | Ga0157375_10018437 | Ga0157375_100184372 | 225 |
| 400 | 3300013308 | Ga0157375_10673183 | Ga0157375_106731831 | 225 |
| 401 | 3300014325 | Ga0163163_10362688 | Ga0163163_103626882 | 225 |
| 402 | 3300014968 | Ga0157379_10004464 | Ga0157379_100044648 | 225 |
| 403 | 3300014968 | Ga0157379_10053994 | Ga0157379_100539944 | 225 |
| 404 | 3300014968 | Ga0157379_10290375 | Ga0157379_102903752 | 225 |
| 405 | 3300017792 | Ga0163161_10336538 | Ga0163161_103365382 | 225 |
| 406 | 3300021361 | Ga0213872_10007252 | Ga0213872_100072522 | 225 |
| 407 | 3300025901 | Ga0207688_10263939 | Ga0207688_102639392 | 225 |
| 408 | 3300025907 | Ga0207645_10005248 | Ga0207645_100052484 | 225 |
| 409 | 3300025907 | Ga0207645_10229645 | Ga0207645_102296452 | 225 |
| 410 | 3300025910 | Ga0207684_10067747 | Ga0207684_100677472 | 225 |
| 411 | 3300025913 | Ga0207695_10008769 | Ga0207695_100087694 | 225 |
| 412 | 3300025914 | Ga0207671_10005989 | Ga0207671_100059896 | 225 |
| 413 | 3300025914 | Ga0207671_10009937 | Ga0207671_100099374 | 225 |
| 414 | 3300025922 | Ga0207646_10028126 | Ga0207646_100281264 | 225 |
| 415 | 3300025923 | Ga0207681_10190646 | Ga0207681_101906462 | 225 |
| 416 | 3300025925 | Ga0207650_10059316 | Ga0207650_100593163 | 225 |
| 417 | 3300025927 | Ga0207687_10107801 | Ga0207687_101078012 | 225 |
| 418 | 3300025927 | Ga0207687_10355813 | Ga0207687_103558132 | 225 |
| 419 | 3300025931 | Ga0207644_10170985 | Ga0207644_101709852 | 225 |
| 420 | 3300025931 | Ga0207644_10242313 | Ga0207644_102423132 | 225 |
| 421 | 3300025933 | Ga0207706_10072960 | Ga0207706_100729602 | 225 |
| 422 | 3300025935 | Ga0207709_10118208 | Ga0207709_101182082 | 225 |
| 423 | 3300025940 | Ga0207691_10009805 | Ga0207691_100098058 | 225 |
| 424 | 3300025942 | Ga0207689_10005885 | Ga0207689_100058859 | 225 |
| 425 | 3300025942 | Ga0207689_10156604 | Ga0207689_101566042 | 225 |
| 426 | 3300025942 | Ga0207689_10408544 | Ga0207689_104085442 | 225 |
| 427 | 3300025945 | Ga0207679_10482791 | Ga0207679_104827911 | 225 |
| 428 | 3300025960 | Ga0207651_10265869 | Ga0207651_102658692 | 225 |
| 429 | 3300025961 | Ga0207712_10421431 | Ga0207712_104214312 | 225 |
| 430 | 3300025981 | Ga0207640_10047575 | Ga0207640_100475754 | 225 |
| 431 | 3300025986 | Ga0207658_10012010 | Ga0207658_100120102 | 225 |
| 432 | 3300026023 | Ga0207677_10116563 | Ga0207677_101165632 | 225 |
| 433 | 3300026023 | Ga0207677_10691196 | Ga0207677_106911961 | 225 |
| 434 | 3300026041 | Ga0207639_10051313 | Ga0207639_100513132 | 225 |
| 435 | 3300026067 | Ga0207678_10074354 | Ga0207678_100743542 | 225 |
| 436 | 3300026088 | Ga0207641_10136245 | Ga0207641_101362452 | 225 |
| 437 | 3300026089 | Ga0207648_10026596 | Ga0207648_100265964 | 225 |
| 438 | 3300026089 | Ga0207648_10029103 | Ga0207648_100291035 | 225 |
| 439 | 3300026095 | Ga0207676_10055762 | Ga0207676_100557622 | 225 |
| 440 | 3300026116 | Ga0207674_10069070 | Ga0207674_100690702 | 225 |
| 441 | 3300026116 | Ga0207674_10075742 | Ga0207674_100757423 | 225 |
| 442 | 3300026116 | Ga0207674_10087317 | Ga0207674_100873174 | 225 |
| 443 | 3300026121 | Ga0207683_10052227 | Ga0207683_100522271 | 225 |
| 444 | 3300026121 | Ga0207683_10248345 | Ga0207683_102483452 | 225 |
| 445 | 3300028379 | Ga0268266_10070331 | Ga0268266_100703312 | 225 |
| 446 | 3300028379 | Ga0268266_10354671 | Ga0268266_103546712 | 225 |
| 447 | 3300028381 | Ga0268264_10043438 | Ga0268264_100434384 | 225 |
| 448 | 3300028381 | Ga0268264_10075831 | Ga0268264_100758312 | 225 |
| 449 | 3300028786 | Ga0307517_10004277 | Ga0307517_1000427716 | 225 |
| 450 | 3300028786 | Ga0307517_10096806 | Ga0307517_100968062 | 225 |
| 451 | 3300028786 | Ga0307517_10111453 | Ga0307517_101114532 | 225 |
| 452 | 3300028794 | Ga0307515_10026725 | Ga0307515_100267257 | 225 |
| 453 | 3300028794 | Ga0307515_10032592 | Ga0307515_100325925 | 225 |
| 454 | 3300028794 | Ga0307515_10238061 | Ga0307515_102380612 | 225 |
| 455 | 3300028794 | Ga0307515_10360262 | Ga0307515_103602622 | 225 |
| 456 | 3300029957 | Ga0265324_10106066 | Ga0265324_101060661 | 225 |
| 457 | 3300031456 | Ga0307513_10024066 | Ga0307513_100240662 | 225 |
| 458 | 3300031456 | Ga0307513_10275921 | Ga0307513_102759212 | 225 |
| 459 | 3300031507 | Ga0307509_10000157 | Ga0307509_1000015739 | 225 |
| 460 | 3300031507 | Ga0307509_10018280 | Ga0307509_100182802 | 225 |
| 461 | 3300031507 | Ga0307509_10077774 | Ga0307509_100777742 | 225 |
| 462 | 3300031507 | Ga0307509_10113102 | Ga0307509_101131023 | 225 |
| 463 | 3300031507 | Ga0307509_10166424 | Ga0307509_101664242 | 225 |
| 464 | 3300031616 | Ga0307508_10014979 | Ga0307508_100149792 | 225 |
| 465 | 3300031616 | Ga0307508_10026666 | Ga0307508_100266663 | 225 |
| 466 | 3300031616 | Ga0307508_10157246 | Ga0307508_101572462 | 225 |
| 467 | 3300031649 | Ga0307514_10113353 | Ga0307514_101133532 | 225 |
| 468 | 3300031730 | Ga0307516_10001791 | Ga0307516_1000179119 | 225 |
| 469 | 3300031730 | Ga0307516_10447819 | Ga0307516_104478191 | 225 |
| 470 | 3300031838 | Ga0307518_10178036 | Ga0307518_101780362 | 225 |
| 471 | 3300032005 | Ga0307411_10115453 | Ga0307411_101154532 | 225 |
| 472 | 3300032005 | Ga0307411_10239720 | Ga0307411_102397202 | 225 |
| 473 | 3300033180 | Ga0307510_10000870 | Ga0307510_1000087013 | 225 |
| 474 | 3300033180 | Ga0307510_10028393 | Ga0307510_100283932 | 225 |
| 475 | 3300033180 | Ga0307510_10116890 | Ga0307510_101168902 | 225 |
| 476 | 3300035691 | Ga0373931_0047762 | Ga0373931_0047762_1505_2197 | 225 |
| 477 | 3300035695 | Ga0373927_0211246 | Ga0373927_0211246_46_753 | 225 |
| 478 | 3300035695 | Ga0373927_0371536 | Ga0373927_0371536_55_747 | 225 |
| 479 | 3300037068 | Ga0373925_0086694 | Ga0373925_0086694_1632_2336 | 225 |
| 480 | 3300037068 | Ga0373925_0218783 | Ga0373925_0218783_400_1092 | 225 |
| 481 | 3300041512 | Ga0451853_1771025 | Ga0451853_1771025_61_753 | 225 |
| 482 | 3300042012 | Ga0439455_0113445 | Ga0439455_0113445_52_738 | 225 |
| 483 | 3300044658 | Ga0466972_0025081 | Ga0466972_0025081_1918_2643 | 225 |
| 484 | 3300044683 | Ga0466965_0073062 | Ga0466965_0073062_624_1349 | 225 |
| 485 | 3300044712 | Ga0453684_0097053 | Ga0453684_0097053_335_1036 | 225 |
| 486 | 3300044712 | Ga0453684_0264180 | Ga0453684_0264180_124_825 | 225 |
| 487 | 3300044719 | Ga0466971_0167791 | Ga0466971_0167791_225_950 | 225 |
| 488 | 3300046454 | Ga0495592_0000058 | Ga0495592_0000058_31106_31798 | 225 |
| 489 | 3300046460 | Ga0495638_0183347 | Ga0495638_0183347_204_911 | 225 |
| 490 | 3300046473 | Ga0495582_0082359 | Ga0495582_0082359_921_1613 | 225 |
| 491 | 3300046474 | Ga0495605_0237502 | Ga0495605_0237502_82_768 | 225 |
| 492 | 3300046512 | Ga0495610_0111799 | Ga0495610_0111799_426_1118 | 225 |
| 493 | 3300046515 | Ga0495620_0080807 | Ga0495620_0080807_80_775 | 225 |
| 494 | 3300046517 | Ga0495630_0053886 | Ga0495630_0053886_445_1137 | 225 |
| 495 | 3300046519 | Ga0495632_0009594 | Ga0495632_0009594_4056_4763 | 225 |
| 496 | 3300046526 | Ga0495666_0107764 | Ga0495666_0107764_90_782 | 225 |
| 497 | 3300046528 | Ga0495642_0193160 | Ga0495642_0193160_131_838 | 225 |
| 498 | 3300046542 | Ga0495597_0060297 | Ga0495597_0060297_138_845 | 225 |
| 499 | 3300046557 | Ga0495622_0213969 | Ga0495622_0213969_28_720 | 225 |
| 500 | 3300046616 | Ga0495668_0222901 | Ga0495668_0222901_192_878 | 225 |
| 501 | 3300046660 | Ga0495625_0043514 | Ga0495625_0043514_519_1226 | 225 |
| 502 | 3300046690 | Ga0495624_0053558 | Ga0495624_0053558_153_845 | 225 |
| 503 | 3300046692 | Ga0495671_0053495 | Ga0495671_0053495_1098_1787 | 225 |
| 504 | 3300046694 | Ga0495649_0027389 | Ga0495649_0027389_1125_1832 | 225 |
| 505 | 3300047321 | Ga0495676_0328157 | Ga0495676_0328157_278_970 | 225 |
| 506 | 3300047443 | Ga0495687_004677 | Ga0495687_004677_7522_8229 | 225 |
| 507 | 3300047472 | Ga0495686_0040543 | Ga0495686_0040543_863_1555 | 225 |
| 508 | 3300047472 | Ga0495686_0149187 | Ga0495686_0149187_193_888 | 225 |
| 509 | 3300047673 | Ga0495593_0014213 | Ga0495593_0014213_71_763 | 225 |
| 510 | 3300048907 | Ga0496104_0484827 | Ga0496104_0484827_326_1012 | 225 |
| 511 | 3300048909 | Ga0496106_0063823 | Ga0496106_0063823_34_729 | 225 |
| 512 | 3300048915 | Ga0496112_0508009 | Ga0496112_0508009_188_889 | 225 |
| 513 | 3300049460 | Ga0495682_0057697 | Ga0495682_0057697_176_868 | 225 |
| 514 | 3300049460 | Ga0495682_0128928 | Ga0495682_0128928_180_887 | 225 |
| 515 | 3300050489 | nmdc:mga03683_27419_c1 | nmdc:mga03683_27419_c1_215_922 | 225 |
| 516 | 3300050489 | nmdc:mga03683_31327_c1 | nmdc:mga03683_31327_c1_941_1648 | 225 |
| 517 | 3300050489 | nmdc:mga03683_59562_c1 | nmdc:mga03683_59562_c1_243_950 | 225 |
| 518 | 3300050491 | nmdc:mga00v17_14933_c1 | nmdc:mga00v17_14933_c1_2564_3271 | 225 |
| 519 | 3300050492 | nmdc:mga0yw44_265547_c1 | nmdc:mga0yw44_265547_c1_212_919 | 225 |
| 520 | 3300050493 | nmdc:mga0k408_157975_c1 | nmdc:mga0k408_157975_c1_95_799 | 225 |
| 521 | 3300050493 | nmdc:mga0k408_1630_c1 | nmdc:mga0k408_1630_c1_664_1371 | 225 |
| 522 | 3300050493 | nmdc:mga0k408_19589_c1 | nmdc:mga0k408_19589_c1_860_1567 | 225 |
| 523 | 3300050493 | nmdc:mga0k408_272977_c1 | nmdc:mga0k408_272977_c1_89_796 | 225 |
| 524 | 3300050493 | nmdc:mga0k408_2896_c1 | nmdc:mga0k408_2896_c1_7587_8294 | 225 |
| 525 | 3300050493 | nmdc:mga0k408_38999_c1 | nmdc:mga0k408_38999_c1_1072_1779 | 225 |
| 526 | 3300050493 | nmdc:mga0k408_8882_c1 | nmdc:mga0k408_8882_c1_626_1333 | 225 |
| 527 | 3300050494 | nmdc:mga06z11_42151_c1 | nmdc:mga06z11_42151_c1_1274_1981 | 225 |
| 528 | 3300050496 | nmdc:mga07m45_13053_c1 | nmdc:mga07m45_13053_c1_467_1174 | 225 |
| 529 | 3300050496 | nmdc:mga07m45_1758_c1 | nmdc:mga07m45_1758_c1_4587_5294 | 225 |
| 530 | 3300050496 | nmdc:mga07m45_34272_c1 | nmdc:mga07m45_34272_c1_1384_2091 | 225 |
| 531 | 3300050496 | nmdc:mga07m45_46051_c1 | nmdc:mga07m45_46051_c1_908_1615 | 225 |
| 532 | 3300050496 | nmdc:mga07m45_48364_c1 | nmdc:mga07m45_48364_c1_1082_1801 | 225 |
| 533 | 3300050496 | nmdc:mga07m45_56802_c1 | nmdc:mga07m45_56802_c1_781_1488 | 225 |
| 534 | 3300050516 | nmdc:mga0sz30_11556_c1 | nmdc:mga0sz30_11556_c1_2516_3223 | 225 |
| 535 | 3300050516 | nmdc:mga0sz30_42730_c1 | nmdc:mga0sz30_42730_c1_474_1181 | 225 |
| 536 | 3300053086 | Ga0500578_0263531 | Ga0500578_0263531_40_735 | 225 |
| 537 | 3300053088 | Ga0500644_0002955 | Ga0500644_0002955_2234_2926 | 225 |
| 538 | 3300053092 | Ga0500583_0025193 | Ga0500583_0025193_1643_2335 | 225 |
| 539 | 3300053093 | Ga0500651_0049716 | Ga0500651_0049716_512_1219 | 225 |
| 540 | 3300053093 | Ga0500651_0072819 | Ga0500651_0072819_1163_1855 | 225 |
| 541 | 3300053118 | Ga0500594_0021278 | Ga0500594_0021278_890_1582 | 225 |
| 542 | 3300053131 | Ga0500652_123037 | Ga0500652_123037_352_1047 | 225 |
| 543 | 3300053134 | Ga0500658_0002643 | Ga0500658_0002643_5813_6520 | 225 |
| 544 | 3300053136 | Ga0500559_0000089 | Ga0500559_0000089_31646_32338 | 225 |
| 545 | 3300053139 | Ga0500568_0035636 | Ga0500568_0035636_360_1067 | 225 |
| 546 | 3300053153 | Ga0500616_0093336 | Ga0500616_0093336_765_1460 | 225 |
| 547 | 3300053156 | Ga0500622_0063439 | Ga0500622_0063439_840_1532 | 225 |
| 548 | 3300053158 | Ga0500627_0099660 | Ga0500627_0099660_400_1092 | 225 |
| 549 | 3300053730 | Ga0500645_004599 | Ga0500645_004599_4197_4892 | 225 |
| 550 | 3300053739 | Ga0500587_002067 | Ga0500587_002067_856_1548 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zrm-assembly1.cif.gz_A | crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate | 0.9791 | 7 | 225 |
| 3umb-assembly1.cif.gz_A-2 | crystal structure of the l-2-haloacid dehalogenase rsc1362 | 0.9759 | 5 | 224 |
| 3um9-assembly1.cif.gz_B | crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 | 0.9738 | 6 | 225 |
| 1zrm-assembly1.cif.gz_A | crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate | 0.9704 | 7 | 225 |
| 1jud-assembly1.cif.gz_A | l-2-haloacid dehalogenase | 0.9662 | 7 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1qh9A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9807 | 21 | 94 | 1.10.150.240 |
| 3um9A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9783 | 21 | 94 | 1.10.150.240 |
| 3um9B02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9783 | 21 | 94 | 1.10.150.240 |
| 1zrmA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.974 | 21 | 94 | 1.10.150.240 |
| 3umbA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9728 | 5 | 224 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R0LQ40-F1-model_v4 | (S)-2-haloacid dehalogenase (EC 3.8.1.2) | 0.9892 | 94 | 223 |
GO:0018784
|
| AF-A0A2V2ZWE7-F1-model_v4 | 2-haloacid dehalogenase | 0.9841 | 6 | 223 |
GO:0019120
|
| AF-A0A4Q0SYU9-F1-model_v4 | Haloacid dehalogenase, type II | 0.984 | 107 | 224 |
|
| AF-A0A3S0IDG5-F1-model_v4 | deleted | 0.9831 | 8 | 162 |
|
| AF-I8AE20-F1-model_v4 | Haloacid dehalogenase | 0.9826 | 8 | 223 |
GO:0019120
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar