F462468

General Info

Members Datasets Scaffolds Average Seq Length
550 253 549 233

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100060842|Ga0068857_1000608422
Length 255
Sequence MNPRLRSYLLPLARSNKFREMSKTPDVARPRAVLFDAYGTLFDVYSVALLAEQLFPGFGERLSVLWRDKQIEYTRLTSMSGHYKPFWELTRAGLRYAALRLGLALDATAEDRLMNQYRHLSSFPENREVLVELKERGVSAGILSNGDPDMLGVAVKSAGFSGLLAHVISVHPLRKFKTDPATYALGTQALDLPARDILFVSSNCWDAIGATWFGYTTLWVNRFGLPIEQLDTSPTRTGTSLRDVLSFLEPGVHQP

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
227 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.45
Nodule 0
Rhizoplane 3.09
Rhizosphere 78.73
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10078152 3300003320 Bacteria 1200
2 rootL2_10064200 3300003322 Bacteria 4643
3 rootH1_10062634 3300003323 Bacteria 1251
4 Ga0070676_10020284 3300005328 Bacteria 3708
5 Ga0070690_100082135 3300005330 Bacteria 2109
6 Ga0070670_100066652 3300005331 Bacteria 3089
7 Ga0070670_100095561 3300005331 Bacteria 2556
8 Ga0070670_100107247 3300005331 Bacteria 2407
9 Ga0070670_100656111 3300005331 Bacteria 941
10 Ga0070677_10004539 3300005333 Bacteria 4534
11 Ga0070677_10019937 3300005333 Bacteria 2436
12 Ga0068869_100002991 3300005334 Bacteria 10269
13 Ga0068869_100005288 3300005334 Bacteria 8110
14 Ga0068869_100021512 3300005334 Bacteria 4439
15 Ga0068869_100141070 3300005334 Bacteria 1860
16 Ga0070666_10006136 3300005335 Bacteria 7388
17 Ga0070666_10064923 3300005335 Bacteria 2476
18 Ga0070680_100007042 3300005336 Bacteria 8572
19 Ga0068868_100055816 3300005338 Bacteria 3118
20 Ga0068868_100118010 3300005338 Bacteria 2162
21 Ga0068868_100212205 3300005338 Bacteria 1618
22 Ga0068868_100513869 3300005338 Bacteria 1051
23 Ga0070660_100208172 3300005339 Bacteria 1587
24 Ga0070689_100043064 3300005340 Bacteria 3468
25 Ga0070689_100354494 3300005340 Bacteria 1231
26 Ga0070689_100575896 3300005340 Bacteria 973
27 Ga0070668_100006321 3300005347 Bacteria 8772
28 Ga0070668_100042554 3300005347 Bacteria 3482
29 Ga0070669_100002253 3300005353 Bacteria 13987
30 Ga0070669_100136449 3300005353 Bacteria 1887
31 Ga0070669_100171547 3300005353 Bacteria 1691
32 Ga0070669_100269499 3300005353 Bacteria 1361
33 Ga0070675_100086401 3300005354 Bacteria 2621
34 Ga0070675_100117013 3300005354 Bacteria 2261
35 Ga0070675_100212377 3300005354 Bacteria 1682
36 Ga0070671_100005065 3300005355 Bacteria 10509
37 Ga0070671_100052136 3300005355 Bacteria 3402
38 Ga0070671_100074057 3300005355 Bacteria 2845
39 Ga0070671_100145790 3300005355 Bacteria 1998
40 Ga0070671_100744408 3300005355 Bacteria 852
41 Ga0070674_100001063 3300005356 Bacteria 14368
42 Ga0070674_100096706 3300005356 Bacteria 2143
43 Ga0070673_100023835 3300005364 Bacteria 4477
44 Ga0070673_100042709 3300005364 Bacteria 3497
45 Ga0070673_100089519 3300005364 Bacteria 2512
46 Ga0070659_100172482 3300005366 Bacteria 1772
47 Ga0070659_100358490 3300005366 Bacteria 1225
48 Ga0070659_100871255 3300005366 Bacteria 786
49 Ga0070667_100008398 3300005367 Bacteria 8563
50 Ga0070667_100016134 3300005367 Bacteria 6179
51 Ga0070667_100034647 3300005367 Bacteria 4225
52 Ga0070667_100155903 3300005367 Bacteria 2009
53 Ga0070667_100203674 3300005367 Bacteria 1756
54 Ga0070700_100085315 3300005441 Bacteria 2049
55 Ga0070708_101038685 3300005445 Bacteria 768
56 Ga0070678_100002787 3300005456 Bacteria 9654
57 Ga0070678_100006378 3300005456 Bacteria 6920
58 Ga0070678_100036945 3300005456 Bacteria 3424
59 Ga0070678_100044816 3300005456 Bacteria 3160
60 Ga0070678_100167182 3300005456 Bacteria 1788
61 Ga0070678_100225574 3300005456 Bacteria 1559
62 Ga0070662_100004630 3300005457 Bacteria 8716
63 Ga0070662_100048071 3300005457 Bacteria 3072
64 Ga0070662_100083588 3300005457 Bacteria 2383
65 Ga0068867_100001822 3300005459 Bacteria 14856
66 Ga0068867_100049765 3300005459 Bacteria 3085
67 Ga0068867_100060327 3300005459 Bacteria 2813
68 Ga0068867_100145206 3300005459 Bacteria 1858
69 Ga0068867_100375697 3300005459 Bacteria 1193
70 Ga0070685_10053740 3300005466 Bacteria 2334
71 Ga0070706_100034688 3300005467 Bacteria 4661
72 Ga0070707_100073029 3300005468 Bacteria 3307
73 Ga0070698_100117874 3300005471 Bacteria 2617
74 Ga0070679_100121949 3300005530 Bacteria 2591
75 Ga0070679_100200368 3300005530 Bacteria 1963
76 Ga0068853_100019903 3300005539 Bacteria 5574
77 Ga0068853_100117387 3300005539 Bacteria 2370
78 Ga0070672_100016969 3300005543 Bacteria 5227
79 Ga0070672_100059823 3300005543 Bacteria 2998
80 Ga0070672_100108780 3300005543 Bacteria 2257
81 Ga0070672_100122088 3300005543 Bacteria 2133
82 Ga0070686_100263643 3300005544 Bacteria 1264
83 Ga0070693_100055809 3300005547 Bacteria 2277
84 Ga0070665_100009344 3300005548 Bacteria 9924
85 Ga0070665_100241288 3300005548 Bacteria 1808
86 Ga0070665_100542896 3300005548 Bacteria 1174
87 Ga0070664_100192046 3300005564 Bacteria 1820
88 Ga0070664_100437425 3300005564 Bacteria 1199
89 Ga0070664_100439270 3300005564 Bacteria 1197
90 Ga0068857_100013289 3300005577 Bacteria 7171
91 Ga0068857_100060842 3300005577 Bacteria 3354
92 Ga0068857_100448608 3300005577 Bacteria 1206
93 Ga0068854_100049126 3300005578 Bacteria 3012
94 Ga0068854_100095511 3300005578 Bacteria 2219
95 Ga0068856_100100886 3300005614 Bacteria 2879
96 Ga0068856_100239508 3300005614 Bacteria 1830
97 Ga0070702_100050540 3300005615 Bacteria 2375
98 Ga0068852_100021495 3300005616 Bacteria 5154
99 Ga0068852_100044489 3300005616 Bacteria 3771
100 Ga0068852_100099245 3300005616 Bacteria 2624
101 Ga0068852_100217233 3300005616 Bacteria 1817
102 Ga0068852_100501464 3300005616 Bacteria 1209
103 Ga0068859_100031777 3300005617 Bacteria 5303
104 Ga0068859_100040006 3300005617 Bacteria 4705
105 Ga0068864_100007367 3300005618 Bacteria 9056
106 Ga0068864_100013078 3300005618 Bacteria 6874
107 Ga0068864_100047641 3300005618 Bacteria 3682
108 Ga0068864_100110469 3300005618 Bacteria 2448
109 Ga0068864_100603072 3300005618 Bacteria 1066
110 Ga0068866_10000966 3300005718 Bacteria 12638
111 Ga0068861_100001733 3300005719 Bacteria 13987
112 Ga0068861_100028491 3300005719 Bacteria 4075
113 Ga0068861_100104449 3300005719 Bacteria 2260
114 Ga0068861_100325141 3300005719 Bacteria 1340
115 Ga0068851_10235861 3300005834 Bacteria 1033
116 Ga0068851_10317969 3300005834 Bacteria 899
117 Ga0068870_10119906 3300005840 Bacteria 1514
118 Ga0068863_100012061 3300005841 Bacteria 8349
119 Ga0068863_100017050 3300005841 Bacteria 6965
120 Ga0068863_100021461 3300005841 Bacteria 6163
121 Ga0068863_100099046 3300005841 Bacteria 2769
122 Ga0068863_100490113 3300005841 Bacteria 1209
123 Ga0068858_100003483 3300005842 Bacteria 15604
124 Ga0068858_100008836 3300005842 Bacteria 9662
125 Ga0068858_100196274 3300005842 Bacteria 1908
126 Ga0068860_100007136 3300005843 Bacteria 11181
127 Ga0068860_100149037 3300005843 Bacteria 2252
128 Ga0068860_100300025 3300005843 Bacteria 1574
129 Ga0068860_100417893 3300005843 Bacteria 1329
130 Ga0068862_100051143 3300005844 Bacteria 3533
131 Ga0068862_100186179 3300005844 Bacteria 1866
132 Ga0068862_100556370 3300005844 Bacteria 1096
133 Ga0070717_10515221 3300006028 Bacteria 1082
134 Ga0075365_10146547 3300006038 Bacteria 1641
135 Ga0075368_10049291 3300006042 Bacteria 1670
136 Ga0075363_100013183 3300006048 Bacteria 3999
137 Ga0075363_100140266 3300006048 Bacteria 1360
138 Ga0075364_10039132 3300006051 Bacteria 3073
139 Ga0075364_10290512 3300006051 Bacteria 1112
140 Ga0070716_100113244 3300006173 Bacteria 1685
141 Ga0070716_100514352 3300006173 Bacteria 886
142 Ga0075362_10014664 3300006177 Bacteria 3168
143 Ga0075362_10031158 3300006177 Bacteria 2307
144 Ga0075367_10019680 3300006178 Bacteria 3747
145 Ga0075369_10041977 3300006186 Bacteria 1959
146 Ga0075366_10002222 3300006195 Bacteria 9907
147 Ga0075366_10006978 3300006195 Bacteria 6219
148 Ga0075366_10014619 3300006195 Bacteria 4485
149 Ga0075366_10030670 3300006195 Bacteria 3162
150 Ga0075366_10062213 3300006195 Bacteria 2219
151 Ga0075366_10100621 3300006195 Bacteria 1734
152 Ga0075366_10133956 3300006195 Bacteria 1496
153 Ga0097621_100077972 3300006237 Bacteria 2751
154 Ga0097621_100169744 3300006237 Bacteria 1880
155 Ga0097621_100313600 3300006237 Bacteria 1388
156 Ga0075370_10001175 3300006353 Bacteria 11030
157 Ga0075370_10002004 3300006353 Bacteria 9237
158 Ga0075370_10010857 3300006353 Bacteria 4774
159 Ga0075370_10031532 3300006353 Bacteria 2959
160 Ga0075370_10084283 3300006353 Bacteria 1829
161 Ga0068871_100030830 3300006358 Bacteria 4226
162 Ga0068871_100135067 3300006358 Bacteria 2094
163 Ga0068865_100063511 3300006881 Bacteria 2596
164 Ga0075436_100350251 3300006914 Bacteria 1064
165 Ga0097620_100031777 3300006931 Bacteria 5303
166 Ga0097620_100040006 3300006931 Bacteria 4705
167 Ga0105240_10003510 3300009093 Bacteria 24318
168 Ga0105240_10167581 3300009093 Bacteria 2604
169 Ga0105240_10251903 3300009093 Bacteria 2042
170 Ga0111539_10158084 3300009094 Bacteria 2652
171 Ga0105245_10105158 3300009098 Bacteria 2618
172 Ga0105245_10655743 3300009098 Bacteria 1080
173 Ga0105247_10349232 3300009101 Bacteria 1040
174 Ga0105243_10049805 3300009148 Bacteria 3306
175 Ga0105243_10050828 3300009148 Bacteria 3276
176 Ga0105243_10157318 3300009148 Bacteria 1956
177 Ga0105242_10034077 3300009176 Bacteria 4081
178 Ga0105242_10459847 3300009176 Bacteria 1201
179 Ga0105242_11287253 3300009176 Bacteria 754
180 Ga0105248_10004886 3300009177 Bacteria 14816
181 Ga0105248_10177454 3300009177 Bacteria 2401
182 Ga0105248_10797149 3300009177 Bacteria 1066
183 Ga0105237_10001543 3300009545 Bacteria 30087
184 Ga0105237_10012060 3300009545 Bacteria 9129
185 Ga0105237_10289327 3300009545 Bacteria 1641
186 Ga0105238_10081700 3300009551 Bacteria 3221
187 Ga0105238_10097608 3300009551 Bacteria 2923
188 Ga0105239_10002318 3300010375 Bacteria 24311
189 Ga0105239_10133619 3300010375 Bacteria 2762
190 Ga0105239_10226444 3300010375 Bacteria 2098
191 Ga0105239_10248180 3300010375 Bacteria 1999
192 Ga0157326_1003608 3300012513 Bacteria 1626
193 Ga0157371_10110797 3300013102 Bacteria 1948
194 Ga0157371_10454020 3300013102 Bacteria 942
195 Ga0157374_10010165 3300013296 Bacteria 8087
196 Ga0157374_10131485 3300013296 Bacteria 2422
197 Ga0157374_10380157 3300013296 Bacteria 1407
198 Ga0157374_10387565 3300013296 Bacteria 1393
199 Ga0157378_10123242 3300013297 Bacteria 2391
200 Ga0157378_10437106 3300013297 Bacteria 1296
201 Ga0163162_10024388 3300013306 Bacteria 5969
202 Ga0163162_10349262 3300013306 Bacteria 1612
203 Ga0163162_10354913 3300013306 Bacteria 1599
204 Ga0157372_10112639 3300013307 Bacteria 3117
205 Ga0157375_10001495 3300013308 Bacteria 20075
206 Ga0157375_10018437 3300013308 Bacteria 6329
207 Ga0157375_10157464 3300013308 Bacteria 2411
208 Ga0157375_10308886 3300013308 Bacteria 1746
209 Ga0157375_10673183 3300013308 Bacteria 1190
210 Ga0163163_10116347 3300014325 Bacteria 2705
211 Ga0163163_10193097 3300014325 Bacteria 2084
212 Ga0163163_10362688 3300014325 Bacteria 1505
213 Ga0157380_10001259 3300014326 Bacteria 16460
214 Ga0182008_10110264 3300014497 Bacteria 1364
215 Ga0157379_10004464 3300014968 Bacteria 12002
216 Ga0157379_10008970 3300014968 Bacteria 8716
217 Ga0157379_10053994 3300014968 Bacteria 3590
218 Ga0157379_10078842 3300014968 Bacteria 2950
219 Ga0157379_10079954 3300014968 Bacteria 2928
220 Ga0157379_10290375 3300014968 Bacteria 1489
221 Ga0157376_10124349 3300014969 Bacteria 2291
222 Ga0157376_10187061 3300014969 Bacteria 1897
223 Ga0157376_10603019 3300014969 Bacteria 1093
224 Ga0163161_10037576 3300017792 Bacteria 3472
225 Ga0163161_10336538 3300017792 Bacteria 1196
226 Ga0213872_10007252 3300021361 Bacteria 5477
227 Ga0207666_1021328 3300025271 Bacteria 955
228 Ga0207697_10017948 3300025315 Bacteria 2905
229 Ga0207682_10008363 3300025893 Bacteria 4093
230 Ga0207682_10011228 3300025893 Bacteria 3501
231 Ga0207682_10020195 3300025893 Bacteria 2614
232 Ga0207642_10036666 3300025899 Bacteria 2106
233 Ga0207688_10263939 3300025901 Bacteria 1046
234 Ga0207688_10335554 3300025901 Bacteria 929
235 Ga0207680_10006180 3300025903 Bacteria 5778
236 Ga0207680_10021819 3300025903 Bacteria 3472
237 Ga0207645_10005248 3300025907 Bacteria 9437
238 Ga0207645_10017896 3300025907 Bacteria 4674
239 Ga0207645_10028050 3300025907 Bacteria 3634
240 Ga0207645_10047337 3300025907 Bacteria 2746
241 Ga0207645_10068425 3300025907 Bacteria 2271
242 Ga0207645_10229645 3300025907 Bacteria 1225
243 Ga0207643_10262814 3300025908 Bacteria 1066
244 Ga0207705_10146168 3300025909 Bacteria 1769
245 Ga0207705_10297833 3300025909 Bacteria 1237
246 Ga0207684_10067747 3300025910 Bacteria 3033
247 Ga0207707_10180268 3300025912 Bacteria 1844
248 Ga0207695_10008769 3300025913 Bacteria 12610
249 Ga0207695_10280749 3300025913 Bacteria 1559
250 Ga0207671_10005989 3300025914 Bacteria 11002
251 Ga0207671_10009937 3300025914 Bacteria 7907
252 Ga0207660_10051622 3300025917 Bacteria 2924
253 Ga0207662_10028087 3300025918 Bacteria 3250
254 Ga0207652_10026613 3300025921 Bacteria 4819
255 Ga0207646_10028126 3300025922 Bacteria 5121
256 Ga0207681_10000367 3300025923 Bacteria 32064
257 Ga0207681_10190646 3300025923 Bacteria 1568
258 Ga0207681_10381663 3300025923 Bacteria 1134
259 Ga0207694_10069930 3300025924 Bacteria 2743
260 Ga0207650_10059316 3300025925 Bacteria 2852
261 Ga0207650_10079924 3300025925 Bacteria 2478
262 Ga0207650_10097983 3300025925 Bacteria 2252
263 Ga0207650_10486515 3300025925 Bacteria 1030
264 Ga0207650_10582017 3300025925 Bacteria 940
265 Ga0207659_10003915 3300025926 Bacteria 8981
266 Ga0207659_10065085 3300025926 Bacteria 2641
267 Ga0207687_10107801 3300025927 Bacteria 2062
268 Ga0207687_10355813 3300025927 Bacteria 1194
269 Ga0207644_10001664 3300025931 Bacteria 14316
270 Ga0207644_10071743 3300025931 Bacteria 2534
271 Ga0207644_10144602 3300025931 Bacteria 1834
272 Ga0207644_10170985 3300025931 Bacteria 1696
273 Ga0207644_10208899 3300025931 Bacteria 1543
274 Ga0207644_10242313 3300025931 Bacteria 1436
275 Ga0207644_10392153 3300025931 Bacteria 1134
276 Ga0207706_10015077 3300025933 Bacteria 6995
277 Ga0207706_10053026 3300025933 Bacteria 3580
278 Ga0207706_10070767 3300025933 Bacteria 3068
279 Ga0207706_10072960 3300025933 Bacteria 3018
280 Ga0207686_10024829 3300025934 Bacteria 3478
281 Ga0207709_10017657 3300025935 Bacteria 3985
282 Ga0207709_10118208 3300025935 Bacteria 1785
283 Ga0207670_10004979 3300025936 Bacteria 7231
284 Ga0207670_10387601 3300025936 Bacteria 1114
285 Ga0207669_10003090 3300025937 Bacteria 7168
286 Ga0207669_10346775 3300025937 Bacteria 1145
287 Ga0207704_10003682 3300025938 Bacteria 6969
288 Ga0207691_10009805 3300025940 Bacteria 9197
289 Ga0207691_10010398 3300025940 Bacteria 8927
290 Ga0207691_10053338 3300025940 Bacteria 3691
291 Ga0207691_10197505 3300025940 Bacteria 1752
292 Ga0207691_10233306 3300025940 Bacteria 1593
293 Ga0207691_10760093 3300025940 Bacteria 816
294 Ga0207711_10217656 3300025941 Bacteria 1746
295 Ga0207711_10239343 3300025941 Bacteria 1664
296 Ga0207711_10552324 3300025941 Bacteria 1074
297 Ga0207711_10567630 3300025941 Bacteria 1058
298 Ga0207689_10005885 3300025942 Bacteria 10863
299 Ga0207689_10006473 3300025942 Bacteria 10350
300 Ga0207689_10041303 3300025942 Bacteria 3817
301 Ga0207689_10063299 3300025942 Bacteria 3043
302 Ga0207689_10156604 3300025942 Bacteria 1878
303 Ga0207689_10408544 3300025942 Bacteria 1132
304 Ga0207679_10045101 3300025945 Bacteria 3186
305 Ga0207679_10219992 3300025945 Bacteria 1597
306 Ga0207679_10249459 3300025945 Bacteria 1508
307 Ga0207679_10257686 3300025945 Bacteria 1486
308 Ga0207679_10302425 3300025945 Bacteria 1379
309 Ga0207679_10331788 3300025945 Bacteria 1320
310 Ga0207679_10482791 3300025945 Bacteria 1103
311 Ga0207651_10001537 3300025960 Bacteria 10531
312 Ga0207651_10036336 3300025960 Bacteria 3214
313 Ga0207651_10265869 3300025960 Bacteria 1410
314 Ga0207651_10317427 3300025960 Bacteria 1301
315 Ga0207712_10003631 3300025961 Bacteria 9730
316 Ga0207712_10421431 3300025961 Bacteria 1126
317 Ga0207668_10007182 3300025972 Bacteria 6616
318 Ga0207668_10039984 3300025972 Bacteria 3161
319 Ga0207640_10047575 3300025981 Bacteria 2768
320 Ga0207640_10291096 3300025981 Bacteria 1287
321 Ga0207640_10419401 3300025981 Bacteria 1095
322 Ga0207658_10000767 3300025986 Bacteria 27431
323 Ga0207658_10007546 3300025986 Bacteria 7409
324 Ga0207658_10012010 3300025986 Bacteria 5907
325 Ga0207658_10174648 3300025986 Bacteria 1773
326 Ga0207677_10004355 3300026023 Bacteria 7585
327 Ga0207677_10024944 3300026023 Bacteria 3723
328 Ga0207677_10116563 3300026023 Bacteria 2000
329 Ga0207677_10691196 3300026023 Bacteria 904
330 Ga0207703_10001725 3300026035 Bacteria 19651
331 Ga0207703_10001947 3300026035 Bacteria 18258
332 Ga0207703_10168066 3300026035 Bacteria 1927
333 Ga0207639_10051313 3300026041 Bacteria 3137
334 Ga0207639_10166902 3300026041 Bacteria 1861
335 Ga0207639_10569091 3300026041 Bacteria 1042
336 Ga0207678_10074354 3300026067 Bacteria 2912
337 Ga0207708_10007760 3300026075 Bacteria 7946
338 Ga0207708_10114660 3300026075 Bacteria 2095
339 Ga0207702_10017891 3300026078 Bacteria 5865
340 Ga0207702_10132541 3300026078 Bacteria 2244
341 Ga0207641_10000960 3300026088 Bacteria 29558
342 Ga0207641_10042184 3300026088 Bacteria 3826
343 Ga0207641_10120271 3300026088 Bacteria 2342
344 Ga0207641_10136245 3300026088 Bacteria 2210
345 Ga0207641_10588319 3300026088 Bacteria 1088
346 Ga0207648_10024642 3300026089 Bacteria 5367
347 Ga0207648_10026596 3300026089 Bacteria 5140
348 Ga0207648_10029103 3300026089 Bacteria 4898
349 Ga0207648_11017972 3300026089 Bacteria 776
350 Ga0207676_10000778 3300026095 Bacteria 24842
351 Ga0207676_10009337 3300026095 Bacteria 6979
352 Ga0207676_10055762 3300026095 Bacteria 3104
353 Ga0207674_10069070 3300026116 Bacteria 3554
354 Ga0207674_10075742 3300026116 Bacteria 3374
355 Ga0207674_10087317 3300026116 Bacteria 3112
356 Ga0207674_10350109 3300026116 Bacteria 1428
357 Ga0207675_100016108 3300026118 Bacteria 6982
358 Ga0207675_100116647 3300026118 Bacteria 2523
359 Ga0207675_100120487 3300026118 Bacteria 2482
360 Ga0207683_10052227 3300026121 Bacteria 3581
361 Ga0207683_10060942 3300026121 Bacteria 3319
362 Ga0207683_10107086 3300026121 Bacteria 2500
363 Ga0207683_10175918 3300026121 Bacteria 1939
364 Ga0207683_10248345 3300026121 Bacteria 1623
365 Ga0207683_10281002 3300026121 Bacteria 1521
366 Ga0207698_10017876 3300026142 Bacteria 4819
367 Ga0207698_10031156 3300026142 Bacteria 3846
368 Ga0207698_10325986 3300026142 Bacteria 1440
369 Ga0207698_10345835 3300026142 Bacteria 1403
370 Ga0268266_10070331 3300028379 Bacteria 3032
371 Ga0268266_10209304 3300028379 Bacteria 1788
372 Ga0268266_10354671 3300028379 Bacteria 1379
373 Ga0268265_10047909 3300028380 Bacteria 3205
374 Ga0268265_10154785 3300028380 Bacteria 1938
375 Ga0268265_10386052 3300028380 Bacteria 1290
376 Ga0268264_10001133 3300028381 Bacteria 26125
377 Ga0268264_10043438 3300028381 Bacteria 3724
378 Ga0268264_10047978 3300028381 Bacteria 3551
379 Ga0268264_10075831 3300028381 Bacteria 2860
380 Ga0268264_10120455 3300028381 Bacteria 2312
381 Ga0307517_10004277 3300028786 Bacteria 22001
382 Ga0307517_10096806 3300028786 Bacteria 2361
383 Ga0307517_10111453 3300028786 Bacteria 2079
384 Ga0307515_10000058 3300028794 Bacteria 259680
385 Ga0307515_10000283 3300028794 Bacteria 124822
386 Ga0307515_10026725 3300028794 Bacteria 9914
387 Ga0307515_10032592 3300028794 Bacteria 8624
388 Ga0307515_10238061 3300028794 Bacteria 1597
389 Ga0307515_10307460 3300028794 Bacteria 1264
390 Ga0307515_10360262 3300028794 Bacteria 1096
391 Ga0265324_10106066 3300029957 Bacteria 954
392 Ga0307512_10131715 3300030522 Bacteria 1565
393 Ga0307513_10024066 3300031456 Bacteria 7092
394 Ga0307513_10275921 3300031456 Bacteria 1461
395 Ga0307509_10000157 3300031507 Bacteria 106022
396 Ga0307509_10018280 3300031507 Bacteria 8040
397 Ga0307509_10077774 3300031507 Bacteria 3440
398 Ga0307509_10113102 3300031507 Bacteria 2713
399 Ga0307509_10166424 3300031507 Bacteria 2092
400 Ga0307508_10014979 3300031616 Bacteria 7069
401 Ga0307508_10026666 3300031616 Bacteria 5237
402 Ga0307508_10157246 3300031616 Bacteria 1877
403 Ga0307514_10113353 3300031649 Bacteria 1914
404 Ga0307516_10001791 3300031730 Bacteria 29495
405 Ga0307516_10084634 3300031730 Bacteria 3010
406 Ga0307516_10447819 3300031730 Bacteria 948
407 Ga0307518_10178036 3300031838 Bacteria 1441
408 Ga0307412_10322357 3300031911 Bacteria 1230
409 Ga0307416_100036273 3300032002 Bacteria 3779
410 Ga0307411_10115453 3300032005 Bacteria 1931
411 Ga0307411_10149626 3300032005 Bacteria 1733
412 Ga0307411_10239720 3300032005 Bacteria 1419
413 Ga0307510_10000870 3300033180 Bacteria 31736
414 Ga0307510_10028393 3300033180 Bacteria 6390
415 Ga0307510_10116890 3300033180 Bacteria 2386
416 Ga0373943_0059936 3300035170 Bacteria 1899
417 Ga0373955_0041282 3300035172 Bacteria 2472
418 Ga0373961_0026705 3300035241 Bacteria 1580
419 Ga0373924_0022957 3300035410 Bacteria 2442
420 Ga0373931_0004243 3300035691 Bacteria 6521
421 Ga0373931_0047762 3300035691 Bacteria 2266
422 Ga0373935_0214064 3300035692 Bacteria 1336
423 Ga0373927_0211246 3300035695 Bacteria 1275
424 Ga0373927_0371536 3300035695 Bacteria 943
425 Ga0373947_0396840 3300035725 Bacteria 930
426 Ga0373947_0489465 3300035725 Bacteria 835
427 Ga0373937_0047084 3300036401 Bacteria 3945
428 Ga0373937_0083917 3300036401 Bacteria 2948
429 Ga0373925_0086694 3300037068 Bacteria 2389
430 Ga0373925_0218783 3300037068 Bacteria 1519
431 Ga0436365_1087719 3300039437 Bacteria 4747
432 Ga0436361_0063474 3300039447 Bacteria 40373
433 Ga0451793_0211455 3300041452 Bacteria 959
434 Ga0451853_1771025 3300041512 Bacteria 984
435 Ga0451853_2036237 3300041512 Bacteria 972
436 Ga0451853_3364572 3300041512 Bacteria 1961
437 Ga0439455_0113445 3300042012 Bacteria 755
438 Ga0450898_002506 3300042134 Bacteria 2566
439 Ga0466972_0025081 3300044658 Bacteria 2958
440 Ga0466965_0043772 3300044683 Bacteria 2211
441 Ga0466965_0073062 3300044683 Bacteria 1726
442 Ga0466964_0053794 3300044706 Bacteria 1658
443 Ga0453684_0097053 3300044712 Bacteria 3618
444 Ga0453684_0264180 3300044712 Bacteria 1970
445 Ga0466971_0071183 3300044719 Bacteria 1579
446 Ga0466971_0167791 3300044719 Bacteria 1029
447 Ga0466957_0096186 3300044842 Bacteria 1861
448 Ga0466959_0135069 3300045049 Bacteria 1746
449 Ga0495592_0000058 3300046454 Bacteria 101492
450 Ga0495603_0162602 3300046455 Bacteria 1295
451 Ga0495629_0242850 3300046459 Bacteria 1240
452 Ga0495629_0385573 3300046459 Bacteria 953
453 Ga0495638_0183347 3300046460 Bacteria 1193
454 Ga0495582_0082359 3300046473 Bacteria 1788
455 Ga0495605_0237502 3300046474 Bacteria 783
456 Ga0495610_0111799 3300046512 Bacteria 1209
457 Ga0495620_0080807 3300046515 Bacteria 1315
458 Ga0495630_0053886 3300046517 Bacteria 3013
459 Ga0495632_0009594 3300046519 Bacteria 5820
460 Ga0495666_0107764 3300046526 Bacteria 1310
461 Ga0495642_0193160 3300046528 Bacteria 887
462 Ga0495597_0060297 3300046542 Bacteria 1655
463 Ga0495645_0038465 3300046543 Bacteria 3489
464 Ga0495645_0080535 3300046543 Bacteria 2337
465 Ga0495622_0090507 3300046557 Bacteria 1406
466 Ga0495622_0213969 3300046557 Bacteria 855
467 Ga0495668_0222901 3300046616 Bacteria 1032
468 Ga0495625_0043514 3300046660 Bacteria 3256
469 Ga0495635_0387865 3300046663 Bacteria 929
470 Ga0495647_0062407 3300046681 Bacteria 1473
471 Ga0495658_0100457 3300046683 Bacteria 1726
472 Ga0495658_0227849 3300046683 Bacteria 1168
473 Ga0495613_0060017 3300046689 Bacteria 2787
474 Ga0495624_0053558 3300046690 Bacteria 2547
475 Ga0495671_0053495 3300046692 Bacteria 2004
476 Ga0495649_0027389 3300046694 Bacteria 3163
477 Ga0495649_0157220 3300046694 Bacteria 1193
478 Ga0495676_0328157 3300047321 Bacteria 1027
479 Ga0495687_004677 3300047443 Bacteria 9120
480 Ga0495684_0247432 3300047471 Bacteria 1298
481 Ga0495686_0040543 3300047472 Bacteria 2969
482 Ga0495686_0149187 3300047472 Bacteria 1374
483 Ga0495593_0014213 3300047673 Bacteria 4528
484 Ga0496100_0692731 3300048903 Bacteria 795
485 Ga0496101_0233302 3300048904 Bacteria 1431
486 Ga0496104_0266622 3300048907 Bacteria 1625
487 Ga0496104_0484827 3300048907 Bacteria 1148
488 Ga0496106_0063823 3300048909 Bacteria 2800
489 Ga0496106_0114183 3300048909 Bacteria 2106
490 Ga0496107_0057678 3300048910 Bacteria 2807
491 Ga0496108_0196660 3300048911 Bacteria 1749
492 Ga0496108_0341271 3300048911 Bacteria 1307
493 Ga0496109_0239920 3300048912 Bacteria 1706
494 Ga0496111_0157423 3300048914 Bacteria 1686
495 Ga0496112_0177543 3300048915 Bacteria 2094
496 Ga0496112_0508009 3300048915 Bacteria 1140
497 Ga0496113_0168688 3300048916 Bacteria 1733
498 Ga0496114_0572281 3300048917 Bacteria 997
499 Ga0496114_0700442 3300048917 Bacteria 888
500 Ga0495682_0057697 3300049460 Bacteria 1405
501 Ga0495682_0128928 3300049460 Bacteria 905
502 Ga0501198_000003 3300049649 Bacteria 175301
503 Ga0501222_000014 3300049662 Bacteria 83609
504 Ga0501035_0182549 3300049822 Bacteria 1807
505 nmdc:mga03683_127560_c1 3300050489 Bacteria 1136
506 nmdc:mga03683_27419_c1 3300050489 Bacteria 2256
507 nmdc:mga03683_31327_c1 3300050489 Bacteria 2133
508 nmdc:mga03683_59562_c1 3300050489 Bacteria 1611
509 nmdc:mga00v17_14933_c1 3300050491 Bacteria 4348
510 nmdc:mga0yw44_265547_c1 3300050492 Bacteria 1145
511 nmdc:mga0k408_157975_c1 3300050493 Bacteria 1351
512 nmdc:mga0k408_1630_c1 3300050493 Bacteria 12144
513 nmdc:mga0k408_19589_c1 3300050493 Bacteria 3784
514 nmdc:mga0k408_2442_c1 3300050493 Bacteria 9875
515 nmdc:mga0k408_272977_c1 3300050493 Bacteria 1010
516 nmdc:mga0k408_2896_c1 3300050493 Bacteria 9095
517 nmdc:mga0k408_38999_c1 3300050493 Bacteria 2728
518 nmdc:mga0k408_66880_c1 3300050493 Bacteria 2094
519 nmdc:mga0k408_8882_c1 3300050493 Bacteria 5406
520 nmdc:mga06z11_42151_c1 3300050494 Bacteria 2288
521 nmdc:mga07m45_13053_c1 3300050496 Bacteria 4398
522 nmdc:mga07m45_1758_c1 3300050496 Bacteria 9985
523 nmdc:mga07m45_34272_c1 3300050496 Bacteria 2822
524 nmdc:mga07m45_46051_c1 3300050496 Bacteria 1888
525 nmdc:mga07m45_48364_c1 3300050496 Bacteria 2392
526 nmdc:mga07m45_56802_c1 3300050496 Bacteria 2213
527 nmdc:mga07m45_65477_c1 3300050496 Bacteria 2064
528 nmdc:mga0sz30_11556_c1 3300050516 Bacteria 3413
529 nmdc:mga0sz30_42730_c1 3300050516 Bacteria 1907
530 Ga0495601_0065298 3300053077 Bacteria 2316
531 Ga0495601_0124579 3300053077 Bacteria 1676
532 Ga0495619_0235889 3300053085 Bacteria 1268
533 Ga0500578_0263531 3300053086 Bacteria 1034
534 Ga0500644_0002955 3300053088 Bacteria 4220
535 Ga0500583_0025193 3300053092 Bacteria 2537
536 Ga0500651_0049716 3300053093 Bacteria 2633
537 Ga0500651_0072819 3300053093 Bacteria 2136
538 Ga0500594_0021278 3300053118 Bacteria 1624
539 Ga0500652_123037 3300053131 Bacteria 1084
540 Ga0500658_0002643 3300053134 Bacteria 6901
541 Ga0500559_0000089 3300053136 Bacteria 72681
542 Ga0500568_0035636 3300053139 Bacteria 2029
543 Ga0500616_0093336 3300053153 Bacteria 1486
544 Ga0500619_052343 3300053154 Bacteria 1324
545 Ga0500622_0063439 3300053156 Bacteria 1880
546 Ga0500627_0099660 3300053158 Bacteria 1304
547 Ga0500645_004599 3300053730 Bacteria 5254
548 Ga0500587_002067 3300053739 Bacteria 2867
549 Ga0466962_0046206 3300061719 Bacteria 2080

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025945 Ga0207679_10219992 Ga0207679_102199922 202
2 3300046694 Ga0495649_0157220 Ga0495649_0157220_165_788 202
3 3300030522 Ga0307512_10131715 Ga0307512_101317152 207
4 3300025908 Ga0207643_10262814 Ga0207643_102628142 215
5 3300005338 Ga0068868_100513869 Ga0068868_1005138692 216
6 3300005539 Ga0068853_100019903 Ga0068853_1000199034 216
7 3300028794 Ga0307515_10307460 Ga0307515_103074602 216
8 3300039447 Ga0436361_0063474 Ga0436361_0063474_37518_38186 216
9 3300046557 Ga0495622_0090507 Ga0495622_0090507_34_690 216
10 3300050496 nmdc:mga07m45_65477_c1 nmdc:mga07m45_65477_c1_1180_1851 216
11 3300053154 Ga0500619_052343 Ga0500619_052343_657_1313 216
12 3300025945 Ga0207679_10331788 Ga0207679_103317882 219
13 3300014497 Ga0182008_10110264 Ga0182008_101102641 220
14 3300025271 Ga0207666_1021328 Ga0207666_10213282 220
15 3300028794 Ga0307515_10000058 Ga0307515_1000005875 220
16 3300028794 Ga0307515_10000283 Ga0307515_1000028386 220
17 3300049822 Ga0501035_0182549 Ga0501035_0182549_1045_1713 220
18 3300005347 Ga0070668_100042554 Ga0070668_1000425543 221
19 3300005843 Ga0068860_100300025 Ga0068860_1003000252 221
20 3300006358 Ga0068871_100135067 Ga0068871_1001350673 221
21 3300025918 Ga0207662_10028087 Ga0207662_100280872 221
22 3300025972 Ga0207668_10039984 Ga0207668_100399842 221
23 3300028381 Ga0268264_10120455 Ga0268264_101204552 221
24 3300035241 Ga0373961_0026705 Ga0373961_0026705_399_1109 221
25 3300035691 Ga0373931_0004243 Ga0373931_0004243_2368_3078 221
26 3300041512 Ga0451853_2036237 Ga0451853_2036237_128_817 221
27 iso_pu_bacteria 2643221654 2644303786 221
28 3300005616 Ga0068852_100044489 Ga0068852_1000444894 222
29 3300006195 Ga0075366_10133956 Ga0075366_101339563 222
30 3300026142 Ga0207698_10031156 Ga0207698_100311562 222
31 3300031911 Ga0307412_10322357 Ga0307412_103223572 222
32 3300032002 Ga0307416_100036273 Ga0307416_1000362732 222
33 3300032005 Ga0307411_10149626 Ga0307411_101496262 222
34 3300041452 Ga0451793_0211455 Ga0451793_0211455_167_862 222
35 3300041512 Ga0451853_3364572 Ga0451853_3364572_445_1140 222
36 3300042134 Ga0450898_002506 Ga0450898_002506_211_894 222
37 3300049649 Ga0501198_000003 Ga0501198_000003_28954_29649 222
38 3300049662 Ga0501222_000014 Ga0501222_000014_28954_29649 222
39 3300050493 nmdc:mga0k408_66880_c1 nmdc:mga0k408_66880_c1_1317_1994 222
40 3300005331 Ga0070670_100095561 Ga0070670_1000955612 223
41 3300005333 Ga0070677_10004539 Ga0070677_100045395 223
42 3300005364 Ga0070673_100089519 Ga0070673_1000895193 223
43 3300005445 Ga0070708_101038685 Ga0070708_1010386851 223
44 3300005456 Ga0070678_100002787 Ga0070678_1000027873 223
45 3300005457 Ga0070662_100048071 Ga0070662_1000480713 223
46 3300005459 Ga0068867_100060327 Ga0068867_1000603272 223
47 3300005459 Ga0068867_100375697 Ga0068867_1003756972 223
48 3300005543 Ga0070672_100122088 Ga0070672_1001220882 223
49 3300005616 Ga0068852_100501464 Ga0068852_1005014642 223
50 3300005719 Ga0068861_100028491 Ga0068861_1000284914 223
51 3300005844 Ga0068862_100051143 Ga0068862_1000511432 223
52 3300009148 Ga0105243_10050828 Ga0105243_100508282 223
53 3300009176 Ga0105242_10459847 Ga0105242_104598472 223
54 3300013306 Ga0163162_10349262 Ga0163162_103492622 223
55 3300025893 Ga0207682_10020195 Ga0207682_100201953 223
56 3300025925 Ga0207650_10486515 Ga0207650_104865152 223
57 3300025931 Ga0207644_10392153 Ga0207644_103921532 223
58 3300025940 Ga0207691_10233306 Ga0207691_102333062 223
59 3300025945 Ga0207679_10257686 Ga0207679_102576862 223
60 3300026075 Ga0207708_10114660 Ga0207708_101146602 223
61 3300026118 Ga0207675_100116647 Ga0207675_1001166472 223
62 3300026121 Ga0207683_10107086 Ga0207683_101070861 223
63 3300028380 Ga0268265_10154785 Ga0268265_101547853 223
64 3300005330 Ga0070690_100082135 Ga0070690_1000821353 224
65 3300005331 Ga0070670_100066652 Ga0070670_1000666523 224
66 3300005331 Ga0070670_100107247 Ga0070670_1001072472 224
67 3300005331 Ga0070670_100656111 Ga0070670_1006561112 224
68 3300005333 Ga0070677_10019937 Ga0070677_100199372 224
69 3300005334 Ga0068869_100002991 Ga0068869_1000029913 224
70 3300005334 Ga0068869_100005288 Ga0068869_1000052882 224
71 3300005335 Ga0070666_10006136 Ga0070666_100061364 224
72 3300005335 Ga0070666_10064923 Ga0070666_100649232 224
73 3300005336 Ga0070680_100007042 Ga0070680_1000070422 224
74 3300005338 Ga0068868_100055816 Ga0068868_1000558162 224
75 3300005338 Ga0068868_100212205 Ga0068868_1002122051 224
76 3300005339 Ga0070660_100208172 Ga0070660_1002081722 224
77 3300005340 Ga0070689_100043064 Ga0070689_1000430643 224
78 3300005340 Ga0070689_100354494 Ga0070689_1003544942 224
79 3300005340 Ga0070689_100575896 Ga0070689_1005758962 224
80 3300005347 Ga0070668_100006321 Ga0070668_1000063213 224
81 3300005353 Ga0070669_100002253 Ga0070669_1000022534 224
82 3300005353 Ga0070669_100136449 Ga0070669_1001364491 224
83 3300005353 Ga0070669_100171547 Ga0070669_1001715473 224
84 3300005354 Ga0070675_100086401 Ga0070675_1000864012 224
85 3300005354 Ga0070675_100117013 Ga0070675_1001170133 224
86 3300005355 Ga0070671_100052136 Ga0070671_1000521362 224
87 3300005355 Ga0070671_100145790 Ga0070671_1001457902 224
88 3300005355 Ga0070671_100744408 Ga0070671_1007444081 224
89 3300005356 Ga0070674_100001063 Ga0070674_1000010637 224
90 3300005356 Ga0070674_100096706 Ga0070674_1000967062 224
91 3300005364 Ga0070673_100023835 Ga0070673_1000238353 224
92 3300005364 Ga0070673_100042709 Ga0070673_1000427093 224
93 3300005366 Ga0070659_100172482 Ga0070659_1001724822 224
94 3300005366 Ga0070659_100358490 Ga0070659_1003584902 224
95 3300005367 Ga0070667_100008398 Ga0070667_1000083982 224
96 3300005367 Ga0070667_100016134 Ga0070667_1000161343 224
97 3300005367 Ga0070667_100203674 Ga0070667_1002036743 224
98 3300005441 Ga0070700_100085315 Ga0070700_1000853151 224
99 3300005456 Ga0070678_100006378 Ga0070678_1000063787 224
100 3300005456 Ga0070678_100036945 Ga0070678_1000369452 224
101 3300005456 Ga0070678_100044816 Ga0070678_1000448162 224
102 3300005456 Ga0070678_100225574 Ga0070678_1002255742 224
103 3300005457 Ga0070662_100083588 Ga0070662_1000835882 224
104 3300005459 Ga0068867_100001822 Ga0068867_1000018224 224
105 3300005459 Ga0068867_100145206 Ga0068867_1001452062 224
106 3300005466 Ga0070685_10053740 Ga0070685_100537403 224
107 3300005530 Ga0070679_100121949 Ga0070679_1001219492 224
108 3300005530 Ga0070679_100200368 Ga0070679_1002003683 224
109 3300005543 Ga0070672_100016969 Ga0070672_1000169692 224
110 3300005543 Ga0070672_100059823 Ga0070672_1000598233 224
111 3300005543 Ga0070672_100108780 Ga0070672_1001087802 224
112 3300005544 Ga0070686_100263643 Ga0070686_1002636432 224
113 3300005547 Ga0070693_100055809 Ga0070693_1000558093 224
114 3300005548 Ga0070665_100241288 Ga0070665_1002412883 224
115 3300005548 Ga0070665_100542896 Ga0070665_1005428961 224
116 3300005564 Ga0070664_100192046 Ga0070664_1001920462 224
117 3300005564 Ga0070664_100437425 Ga0070664_1004374252 224
118 3300005578 Ga0068854_100049126 Ga0068854_1000491263 224
119 3300005578 Ga0068854_100095511 Ga0068854_1000955112 224
120 3300005614 Ga0068856_100100886 Ga0068856_1001008862 224
121 3300005614 Ga0068856_100239508 Ga0068856_1002395082 224
122 3300005615 Ga0070702_100050540 Ga0070702_1000505402 224
123 3300005616 Ga0068852_100021495 Ga0068852_1000214954 224
124 3300005616 Ga0068852_100099245 Ga0068852_1000992452 224
125 3300005616 Ga0068852_100217233 Ga0068852_1002172332 224
126 3300005617 Ga0068859_100031777 Ga0068859_1000317772 224
127 3300005617 Ga0068859_100040006 Ga0068859_1000400062 224
128 3300005618 Ga0068864_100007367 Ga0068864_1000073673 224
129 3300005618 Ga0068864_100047641 Ga0068864_1000476413 224
130 3300005618 Ga0068864_100110469 Ga0068864_1001104692 224
131 3300005618 Ga0068864_100603072 Ga0068864_1006030721 224
132 3300005718 Ga0068866_10000966 Ga0068866_100009664 224
133 3300005719 Ga0068861_100001733 Ga0068861_1000017339 224
134 3300005719 Ga0068861_100104449 Ga0068861_1001044493 224
135 3300005719 Ga0068861_100325141 Ga0068861_1003251412 224
136 3300005834 Ga0068851_10235861 Ga0068851_102358612 224
137 3300005834 Ga0068851_10317969 Ga0068851_103179691 224
138 3300005840 Ga0068870_10119906 Ga0068870_101199063 224
139 3300005841 Ga0068863_100012061 Ga0068863_1000120612 224
140 3300005841 Ga0068863_100021461 Ga0068863_1000214614 224
141 3300005841 Ga0068863_100099046 Ga0068863_1000990462 224
142 3300005841 Ga0068863_100490113 Ga0068863_1004901132 224
143 3300005842 Ga0068858_100003483 Ga0068858_1000034839 224
144 3300005842 Ga0068858_100008836 Ga0068858_1000088363 224
145 3300005842 Ga0068858_100196274 Ga0068858_1001962742 224
146 3300005843 Ga0068860_100007136 Ga0068860_1000071363 224
147 3300005844 Ga0068862_100186179 Ga0068862_1001861792 224
148 3300006028 Ga0070717_10515221 Ga0070717_105152211 224
149 3300006173 Ga0070716_100113244 Ga0070716_1001132442 224
150 3300006173 Ga0070716_100514352 Ga0070716_1005143521 224
151 3300006237 Ga0097621_100077972 Ga0097621_1000779722 224
152 3300006237 Ga0097621_100169744 Ga0097621_1001697442 224
153 3300006358 Ga0068871_100030830 Ga0068871_1000308303 224
154 3300006881 Ga0068865_100063511 Ga0068865_1000635113 224
155 3300006914 Ga0075436_100350251 Ga0075436_1003502512 224
156 3300006931 Ga0097620_100031777 Ga0097620_1000317772 224
157 3300006931 Ga0097620_100040006 Ga0097620_1000400062 224
158 3300009093 Ga0105240_10251903 Ga0105240_102519032 224
159 3300009094 Ga0111539_10158084 Ga0111539_101580842 224
160 3300009098 Ga0105245_10655743 Ga0105245_106557432 224
161 3300009148 Ga0105243_10049805 Ga0105243_100498054 224
162 3300009176 Ga0105242_10034077 Ga0105242_100340772 224
163 3300009177 Ga0105248_10004886 Ga0105248_100048869 224
164 3300009177 Ga0105248_10177454 Ga0105248_101774542 224
165 3300009177 Ga0105248_10797149 Ga0105248_107971491 224
166 3300009551 Ga0105238_10097608 Ga0105238_100976082 224
167 3300010375 Ga0105239_10226444 Ga0105239_102264443 224
168 3300013102 Ga0157371_10110797 Ga0157371_101107972 224
169 3300013102 Ga0157371_10454020 Ga0157371_104540201 224
170 3300013296 Ga0157374_10010165 Ga0157374_100101657 224
171 3300013296 Ga0157374_10131485 Ga0157374_101314853 224
172 3300013296 Ga0157374_10387565 Ga0157374_103875652 224
173 3300013297 Ga0157378_10437106 Ga0157378_104371062 224
174 3300013306 Ga0163162_10024388 Ga0163162_100243883 224
175 3300013307 Ga0157372_10112639 Ga0157372_101126393 224
176 3300013308 Ga0157375_10001495 Ga0157375_1000149511 224
177 3300013308 Ga0157375_10157464 Ga0157375_101574643 224
178 3300013308 Ga0157375_10308886 Ga0157375_103088863 224
179 3300014325 Ga0163163_10116347 Ga0163163_101163472 224
180 3300014325 Ga0163163_10193097 Ga0163163_101930973 224
181 3300014326 Ga0157380_10001259 Ga0157380_100012593 224
182 3300014968 Ga0157379_10008970 Ga0157379_100089707 224
183 3300014968 Ga0157379_10078842 Ga0157379_100788423 224
184 3300014968 Ga0157379_10079954 Ga0157379_100799543 224
185 3300014969 Ga0157376_10124349 Ga0157376_101243492 224
186 3300014969 Ga0157376_10187061 Ga0157376_101870613 224
187 3300014969 Ga0157376_10603019 Ga0157376_106030192 224
188 3300017792 Ga0163161_10037576 Ga0163161_100375764 224
189 3300025315 Ga0207697_10017948 Ga0207697_100179482 224
190 3300025893 Ga0207682_10008363 Ga0207682_100083633 224
191 3300025893 Ga0207682_10011228 Ga0207682_100112283 224
192 3300025899 Ga0207642_10036666 Ga0207642_100366662 224
193 3300025901 Ga0207688_10335554 Ga0207688_103355542 224
194 3300025903 Ga0207680_10006180 Ga0207680_100061803 224
195 3300025903 Ga0207680_10021819 Ga0207680_100218194 224
196 3300025907 Ga0207645_10017896 Ga0207645_100178963 224
197 3300025907 Ga0207645_10028050 Ga0207645_100280503 224
198 3300025907 Ga0207645_10047337 Ga0207645_100473372 224
199 3300025907 Ga0207645_10068425 Ga0207645_100684253 224
200 3300025909 Ga0207705_10146168 Ga0207705_101461682 224
201 3300025909 Ga0207705_10297833 Ga0207705_102978332 224
202 3300025912 Ga0207707_10180268 Ga0207707_101802682 224
203 3300025913 Ga0207695_10280749 Ga0207695_102807492 224
204 3300025917 Ga0207660_10051622 Ga0207660_100516223 224
205 3300025921 Ga0207652_10026613 Ga0207652_100266133 224
206 3300025923 Ga0207681_10000367 Ga0207681_1000036723 224
207 3300025923 Ga0207681_10381663 Ga0207681_103816632 224
208 3300025924 Ga0207694_10069930 Ga0207694_100699302 224
209 3300025925 Ga0207650_10079924 Ga0207650_100799242 224
210 3300025925 Ga0207650_10097983 Ga0207650_100979832 224
211 3300025925 Ga0207650_10582017 Ga0207650_105820172 224
212 3300025926 Ga0207659_10003915 Ga0207659_100039153 224
213 3300025926 Ga0207659_10065085 Ga0207659_100650852 224
214 3300025931 Ga0207644_10001664 Ga0207644_100016646 224
215 3300025931 Ga0207644_10071743 Ga0207644_100717432 224
216 3300025931 Ga0207644_10144602 Ga0207644_101446022 224
217 3300025931 Ga0207644_10208899 Ga0207644_102088991 224
218 3300025933 Ga0207706_10015077 Ga0207706_100150773 224
219 3300025933 Ga0207706_10053026 Ga0207706_100530263 224
220 3300025933 Ga0207706_10070767 Ga0207706_100707672 224
221 3300025934 Ga0207686_10024829 Ga0207686_100248292 224
222 3300025935 Ga0207709_10017657 Ga0207709_100176572 224
223 3300025936 Ga0207670_10004979 Ga0207670_100049792 224
224 3300025936 Ga0207670_10387601 Ga0207670_103876011 224
225 3300025937 Ga0207669_10003090 Ga0207669_100030902 224
226 3300025937 Ga0207669_10346775 Ga0207669_103467751 224
227 3300025938 Ga0207704_10003682 Ga0207704_100036822 224
228 3300025940 Ga0207691_10010398 Ga0207691_100103982 224
229 3300025940 Ga0207691_10053338 Ga0207691_100533382 224
230 3300025940 Ga0207691_10197505 Ga0207691_101975052 224
231 3300025940 Ga0207691_10760093 Ga0207691_107600931 224
232 3300025941 Ga0207711_10217656 Ga0207711_102176563 224
233 3300025941 Ga0207711_10239343 Ga0207711_102393432 224
234 3300025941 Ga0207711_10552324 Ga0207711_105523241 224
235 3300025941 Ga0207711_10567630 Ga0207711_105676302 224
236 3300025942 Ga0207689_10006473 Ga0207689_100064738 224
237 3300025942 Ga0207689_10041303 Ga0207689_100413033 224
238 3300025942 Ga0207689_10063299 Ga0207689_100632993 224
239 3300025945 Ga0207679_10045101 Ga0207679_100451012 224
240 3300025945 Ga0207679_10249459 Ga0207679_102494592 224
241 3300025945 Ga0207679_10302425 Ga0207679_103024252 224
242 3300025960 Ga0207651_10001537 Ga0207651_100015373 224
243 3300025960 Ga0207651_10036336 Ga0207651_100363363 224
244 3300025960 Ga0207651_10317427 Ga0207651_103174271 224
245 3300025961 Ga0207712_10003631 Ga0207712_100036313 224
246 3300025972 Ga0207668_10007182 Ga0207668_100071824 224
247 3300025981 Ga0207640_10291096 Ga0207640_102910962 224
248 3300025981 Ga0207640_10419401 Ga0207640_104194011 224
249 3300025986 Ga0207658_10000767 Ga0207658_1000076718 224
250 3300025986 Ga0207658_10007546 Ga0207658_100075467 224
251 3300025986 Ga0207658_10174648 Ga0207658_101746482 224
252 3300026023 Ga0207677_10004355 Ga0207677_100043553 224
253 3300026023 Ga0207677_10024944 Ga0207677_100249443 224
254 3300026035 Ga0207703_10001725 Ga0207703_100017256 224
255 3300026035 Ga0207703_10001947 Ga0207703_1000194710 224
256 3300026035 Ga0207703_10168066 Ga0207703_101680662 224
257 3300026041 Ga0207639_10166902 Ga0207639_101669022 224
258 3300026041 Ga0207639_10569091 Ga0207639_105690911 224
259 3300026075 Ga0207708_10007760 Ga0207708_100077603 224
260 3300026078 Ga0207702_10017891 Ga0207702_100178913 224
261 3300026078 Ga0207702_10132541 Ga0207702_101325413 224
262 3300026088 Ga0207641_10000960 Ga0207641_100009608 224
263 3300026088 Ga0207641_10042184 Ga0207641_100421844 224
264 3300026088 Ga0207641_10120271 Ga0207641_101202713 224
265 3300026088 Ga0207641_10588319 Ga0207641_105883192 224
266 3300026089 Ga0207648_10024642 Ga0207648_100246423 224
267 3300026089 Ga0207648_11017972 Ga0207648_110179721 224
268 3300026095 Ga0207676_10000778 Ga0207676_1000077817 224
269 3300026095 Ga0207676_10009337 Ga0207676_100093374 224
270 3300026116 Ga0207674_10350109 Ga0207674_103501092 224
271 3300026118 Ga0207675_100016108 Ga0207675_1000161086 224
272 3300026118 Ga0207675_100120487 Ga0207675_1001204872 224
273 3300026121 Ga0207683_10060942 Ga0207683_100609422 224
274 3300026121 Ga0207683_10175918 Ga0207683_101759182 224
275 3300026121 Ga0207683_10281002 Ga0207683_102810022 224
276 3300026142 Ga0207698_10017876 Ga0207698_100178763 224
277 3300026142 Ga0207698_10325986 Ga0207698_103259863 224
278 3300026142 Ga0207698_10345835 Ga0207698_103458351 224
279 3300028379 Ga0268266_10209304 Ga0268266_102093043 224
280 3300028380 Ga0268265_10047909 Ga0268265_100479094 224
281 3300028380 Ga0268265_10386052 Ga0268265_103860521 224
282 3300028381 Ga0268264_10001133 Ga0268264_1000113317 224
283 3300028381 Ga0268264_10047978 Ga0268264_100479783 224
284 3300031730 Ga0307516_10084634 Ga0307516_100846343 224
285 3300035170 Ga0373943_0059936 Ga0373943_0059936_666_1367 224
286 3300035172 Ga0373955_0041282 Ga0373955_0041282_263_967 224
287 3300035410 Ga0373924_0022957 Ga0373924_0022957_693_1397 224
288 3300035692 Ga0373935_0214064 Ga0373935_0214064_469_1173 224
289 3300035725 Ga0373947_0396840 Ga0373947_0396840_139_843 224
290 3300035725 Ga0373947_0489465 Ga0373947_0489465_121_825 224
291 3300036401 Ga0373937_0047084 Ga0373937_0047084_3230_3934 224
292 3300036401 Ga0373937_0083917 Ga0373937_0083917_2140_2844 224
293 3300039437 Ga0436365_1087719 Ga0436365_1087719_290_994 224
294 3300044683 Ga0466965_0043772 Ga0466965_0043772_924_1613 224
295 3300044706 Ga0466964_0053794 Ga0466964_0053794_414_1139 224
296 3300044719 Ga0466971_0071183 Ga0466971_0071183_540_1265 224
297 3300044842 Ga0466957_0096186 Ga0466957_0096186_752_1477 224
298 3300045049 Ga0466959_0135069 Ga0466959_0135069_23_748 224
299 3300046455 Ga0495603_0162602 Ga0495603_0162602_54_758 224
300 3300046459 Ga0495629_0242850 Ga0495629_0242850_436_1140 224
301 3300046459 Ga0495629_0385573 Ga0495629_0385573_31_735 224
302 3300046543 Ga0495645_0038465 Ga0495645_0038465_416_1120 224
303 3300046543 Ga0495645_0080535 Ga0495645_0080535_406_1110 224
304 3300046663 Ga0495635_0387865 Ga0495635_0387865_13_717 224
305 3300046681 Ga0495647_0062407 Ga0495647_0062407_417_1121 224
306 3300046683 Ga0495658_0100457 Ga0495658_0100457_386_1090 224
307 3300046683 Ga0495658_0227849 Ga0495658_0227849_345_1049 224
308 3300046689 Ga0495613_0060017 Ga0495613_0060017_1749_2453 224
309 3300047471 Ga0495684_0247432 Ga0495684_0247432_547_1251 224
310 3300048903 Ga0496100_0692731 Ga0496100_0692731_34_747 224
311 3300048904 Ga0496101_0233302 Ga0496101_0233302_230_943 224
312 3300048907 Ga0496104_0266622 Ga0496104_0266622_383_1087 224
313 3300048909 Ga0496106_0114183 Ga0496106_0114183_679_1386 224
314 3300048910 Ga0496107_0057678 Ga0496107_0057678_1292_1996 224
315 3300048911 Ga0496108_0196660 Ga0496108_0196660_33_740 224
316 3300048911 Ga0496108_0341271 Ga0496108_0341271_472_1176 224
317 3300048912 Ga0496109_0239920 Ga0496109_0239920_273_980 224
318 3300048914 Ga0496111_0157423 Ga0496111_0157423_939_1643 224
319 3300048915 Ga0496112_0177543 Ga0496112_0177543_745_1449 224
320 3300048916 Ga0496113_0168688 Ga0496113_0168688_300_1004 224
321 3300048917 Ga0496114_0572281 Ga0496114_0572281_231_944 224
322 3300048917 Ga0496114_0700442 Ga0496114_0700442_91_795 224
323 3300050489 nmdc:mga03683_127560_c1 nmdc:mga03683_127560_c1_200_925 224
324 3300050493 nmdc:mga0k408_2442_c1 nmdc:mga0k408_2442_c1_1884_2609 224
325 3300053077 Ga0495601_0065298 Ga0495601_0065298_802_1506 224
326 3300053077 Ga0495601_0124579 Ga0495601_0124579_950_1654 224
327 3300053085 Ga0495619_0235889 Ga0495619_0235889_83_787 224
328 3300061719 Ga0466962_0046206 Ga0466962_0046206_775_1500 224
329 3300003320 rootH2_10078152 rootH2_100781522 225
330 3300003322 rootL2_10064200 rootL2_100642005 225
331 3300003323 rootH1_10062634 rootH1_100626341 225
332 3300005328 Ga0070676_10020284 Ga0070676_100202842 225
333 3300005334 Ga0068869_100021512 Ga0068869_1000215123 225
334 3300005334 Ga0068869_100141070 Ga0068869_1001410702 225
335 3300005338 Ga0068868_100118010 Ga0068868_1001180102 225
336 3300005353 Ga0070669_100269499 Ga0070669_1002694991 225
337 3300005354 Ga0070675_100212377 Ga0070675_1002123772 225
338 3300005355 Ga0070671_100005065 Ga0070671_1000050655 225
339 3300005355 Ga0070671_100074057 Ga0070671_1000740572 225
340 3300005366 Ga0070659_100871255 Ga0070659_1008712551 225
341 3300005367 Ga0070667_100034647 Ga0070667_1000346472 225
342 3300005367 Ga0070667_100155903 Ga0070667_1001559032 225
343 3300005456 Ga0070678_100167182 Ga0070678_1001671822 225
344 3300005457 Ga0070662_100004630 Ga0070662_1000046301 225
345 3300005459 Ga0068867_100049765 Ga0068867_1000497652 225
346 3300005467 Ga0070706_100034688 Ga0070706_1000346883 225
347 3300005468 Ga0070707_100073029 Ga0070707_1000730292 225
348 3300005471 Ga0070698_100117874 Ga0070698_1001178742 225
349 3300005539 Ga0068853_100117387 Ga0068853_1001173872 225
350 3300005548 Ga0070665_100009344 Ga0070665_1000093445 225
351 3300005564 Ga0070664_100439270 Ga0070664_1004392702 225
352 3300005577 Ga0068857_100013289 Ga0068857_1000132892 225
353 3300005577 Ga0068857_100060842 Ga0068857_1000608422 225
354 3300005577 Ga0068857_100448608 Ga0068857_1004486081 225
355 3300005618 Ga0068864_100013078 Ga0068864_1000130785 225
356 3300005841 Ga0068863_100017050 Ga0068863_1000170502 225
357 3300005843 Ga0068860_100149037 Ga0068860_1001490372 225
358 3300005843 Ga0068860_100417893 Ga0068860_1004178932 225
359 3300005844 Ga0068862_100556370 Ga0068862_1005563702 225
360 3300006038 Ga0075365_10146547 Ga0075365_101465472 225
361 3300006042 Ga0075368_10049291 Ga0075368_100492912 225
362 3300006048 Ga0075363_100013183 Ga0075363_1000131832 225
363 3300006048 Ga0075363_100140266 Ga0075363_1001402662 225
364 3300006051 Ga0075364_10039132 Ga0075364_100391322 225
365 3300006051 Ga0075364_10290512 Ga0075364_102905122 225
366 3300006177 Ga0075362_10014664 Ga0075362_100146644 225
367 3300006177 Ga0075362_10031158 Ga0075362_100311582 225
368 3300006178 Ga0075367_10019680 Ga0075367_100196803 225
369 3300006186 Ga0075369_10041977 Ga0075369_100419772 225
370 3300006195 Ga0075366_10002222 Ga0075366_100022228 225
371 3300006195 Ga0075366_10006978 Ga0075366_100069782 225
372 3300006195 Ga0075366_10014619 Ga0075366_100146195 225
373 3300006195 Ga0075366_10030670 Ga0075366_100306702 225
374 3300006195 Ga0075366_10062213 Ga0075366_100622132 225
375 3300006195 Ga0075366_10100621 Ga0075366_101006212 225
376 3300006237 Ga0097621_100313600 Ga0097621_1003136002 225
377 3300006353 Ga0075370_10001175 Ga0075370_100011758 225
378 3300006353 Ga0075370_10002004 Ga0075370_100020042 225
379 3300006353 Ga0075370_10010857 Ga0075370_100108572 225
380 3300006353 Ga0075370_10031532 Ga0075370_100315322 225
381 3300006353 Ga0075370_10084283 Ga0075370_100842832 225
382 3300009093 Ga0105240_10003510 Ga0105240_1000351016 225
383 3300009093 Ga0105240_10167581 Ga0105240_101675812 225
384 3300009098 Ga0105245_10105158 Ga0105245_101051582 225
385 3300009101 Ga0105247_10349232 Ga0105247_103492322 225
386 3300009148 Ga0105243_10157318 Ga0105243_101573182 225
387 3300009176 Ga0105242_11287253 Ga0105242_112872531 225
388 3300009545 Ga0105237_10001543 Ga0105237_1000154312 225
389 3300009545 Ga0105237_10012060 Ga0105237_100120606 225
390 3300009545 Ga0105237_10289327 Ga0105237_102893272 225
391 3300009551 Ga0105238_10081700 Ga0105238_100817004 225
392 3300010375 Ga0105239_10002318 Ga0105239_1000231813 225
393 3300010375 Ga0105239_10133619 Ga0105239_101336192 225
394 3300010375 Ga0105239_10248180 Ga0105239_102481802 225
395 3300012513 Ga0157326_1003608 Ga0157326_10036082 225
396 3300013296 Ga0157374_10380157 Ga0157374_103801572 225
397 3300013297 Ga0157378_10123242 Ga0157378_101232422 225
398 3300013306 Ga0163162_10354913 Ga0163162_103549132 225
399 3300013308 Ga0157375_10018437 Ga0157375_100184372 225
400 3300013308 Ga0157375_10673183 Ga0157375_106731831 225
401 3300014325 Ga0163163_10362688 Ga0163163_103626882 225
402 3300014968 Ga0157379_10004464 Ga0157379_100044648 225
403 3300014968 Ga0157379_10053994 Ga0157379_100539944 225
404 3300014968 Ga0157379_10290375 Ga0157379_102903752 225
405 3300017792 Ga0163161_10336538 Ga0163161_103365382 225
406 3300021361 Ga0213872_10007252 Ga0213872_100072522 225
407 3300025901 Ga0207688_10263939 Ga0207688_102639392 225
408 3300025907 Ga0207645_10005248 Ga0207645_100052484 225
409 3300025907 Ga0207645_10229645 Ga0207645_102296452 225
410 3300025910 Ga0207684_10067747 Ga0207684_100677472 225
411 3300025913 Ga0207695_10008769 Ga0207695_100087694 225
412 3300025914 Ga0207671_10005989 Ga0207671_100059896 225
413 3300025914 Ga0207671_10009937 Ga0207671_100099374 225
414 3300025922 Ga0207646_10028126 Ga0207646_100281264 225
415 3300025923 Ga0207681_10190646 Ga0207681_101906462 225
416 3300025925 Ga0207650_10059316 Ga0207650_100593163 225
417 3300025927 Ga0207687_10107801 Ga0207687_101078012 225
418 3300025927 Ga0207687_10355813 Ga0207687_103558132 225
419 3300025931 Ga0207644_10170985 Ga0207644_101709852 225
420 3300025931 Ga0207644_10242313 Ga0207644_102423132 225
421 3300025933 Ga0207706_10072960 Ga0207706_100729602 225
422 3300025935 Ga0207709_10118208 Ga0207709_101182082 225
423 3300025940 Ga0207691_10009805 Ga0207691_100098058 225
424 3300025942 Ga0207689_10005885 Ga0207689_100058859 225
425 3300025942 Ga0207689_10156604 Ga0207689_101566042 225
426 3300025942 Ga0207689_10408544 Ga0207689_104085442 225
427 3300025945 Ga0207679_10482791 Ga0207679_104827911 225
428 3300025960 Ga0207651_10265869 Ga0207651_102658692 225
429 3300025961 Ga0207712_10421431 Ga0207712_104214312 225
430 3300025981 Ga0207640_10047575 Ga0207640_100475754 225
431 3300025986 Ga0207658_10012010 Ga0207658_100120102 225
432 3300026023 Ga0207677_10116563 Ga0207677_101165632 225
433 3300026023 Ga0207677_10691196 Ga0207677_106911961 225
434 3300026041 Ga0207639_10051313 Ga0207639_100513132 225
435 3300026067 Ga0207678_10074354 Ga0207678_100743542 225
436 3300026088 Ga0207641_10136245 Ga0207641_101362452 225
437 3300026089 Ga0207648_10026596 Ga0207648_100265964 225
438 3300026089 Ga0207648_10029103 Ga0207648_100291035 225
439 3300026095 Ga0207676_10055762 Ga0207676_100557622 225
440 3300026116 Ga0207674_10069070 Ga0207674_100690702 225
441 3300026116 Ga0207674_10075742 Ga0207674_100757423 225
442 3300026116 Ga0207674_10087317 Ga0207674_100873174 225
443 3300026121 Ga0207683_10052227 Ga0207683_100522271 225
444 3300026121 Ga0207683_10248345 Ga0207683_102483452 225
445 3300028379 Ga0268266_10070331 Ga0268266_100703312 225
446 3300028379 Ga0268266_10354671 Ga0268266_103546712 225
447 3300028381 Ga0268264_10043438 Ga0268264_100434384 225
448 3300028381 Ga0268264_10075831 Ga0268264_100758312 225
449 3300028786 Ga0307517_10004277 Ga0307517_1000427716 225
450 3300028786 Ga0307517_10096806 Ga0307517_100968062 225
451 3300028786 Ga0307517_10111453 Ga0307517_101114532 225
452 3300028794 Ga0307515_10026725 Ga0307515_100267257 225
453 3300028794 Ga0307515_10032592 Ga0307515_100325925 225
454 3300028794 Ga0307515_10238061 Ga0307515_102380612 225
455 3300028794 Ga0307515_10360262 Ga0307515_103602622 225
456 3300029957 Ga0265324_10106066 Ga0265324_101060661 225
457 3300031456 Ga0307513_10024066 Ga0307513_100240662 225
458 3300031456 Ga0307513_10275921 Ga0307513_102759212 225
459 3300031507 Ga0307509_10000157 Ga0307509_1000015739 225
460 3300031507 Ga0307509_10018280 Ga0307509_100182802 225
461 3300031507 Ga0307509_10077774 Ga0307509_100777742 225
462 3300031507 Ga0307509_10113102 Ga0307509_101131023 225
463 3300031507 Ga0307509_10166424 Ga0307509_101664242 225
464 3300031616 Ga0307508_10014979 Ga0307508_100149792 225
465 3300031616 Ga0307508_10026666 Ga0307508_100266663 225
466 3300031616 Ga0307508_10157246 Ga0307508_101572462 225
467 3300031649 Ga0307514_10113353 Ga0307514_101133532 225
468 3300031730 Ga0307516_10001791 Ga0307516_1000179119 225
469 3300031730 Ga0307516_10447819 Ga0307516_104478191 225
470 3300031838 Ga0307518_10178036 Ga0307518_101780362 225
471 3300032005 Ga0307411_10115453 Ga0307411_101154532 225
472 3300032005 Ga0307411_10239720 Ga0307411_102397202 225
473 3300033180 Ga0307510_10000870 Ga0307510_1000087013 225
474 3300033180 Ga0307510_10028393 Ga0307510_100283932 225
475 3300033180 Ga0307510_10116890 Ga0307510_101168902 225
476 3300035691 Ga0373931_0047762 Ga0373931_0047762_1505_2197 225
477 3300035695 Ga0373927_0211246 Ga0373927_0211246_46_753 225
478 3300035695 Ga0373927_0371536 Ga0373927_0371536_55_747 225
479 3300037068 Ga0373925_0086694 Ga0373925_0086694_1632_2336 225
480 3300037068 Ga0373925_0218783 Ga0373925_0218783_400_1092 225
481 3300041512 Ga0451853_1771025 Ga0451853_1771025_61_753 225
482 3300042012 Ga0439455_0113445 Ga0439455_0113445_52_738 225
483 3300044658 Ga0466972_0025081 Ga0466972_0025081_1918_2643 225
484 3300044683 Ga0466965_0073062 Ga0466965_0073062_624_1349 225
485 3300044712 Ga0453684_0097053 Ga0453684_0097053_335_1036 225
486 3300044712 Ga0453684_0264180 Ga0453684_0264180_124_825 225
487 3300044719 Ga0466971_0167791 Ga0466971_0167791_225_950 225
488 3300046454 Ga0495592_0000058 Ga0495592_0000058_31106_31798 225
489 3300046460 Ga0495638_0183347 Ga0495638_0183347_204_911 225
490 3300046473 Ga0495582_0082359 Ga0495582_0082359_921_1613 225
491 3300046474 Ga0495605_0237502 Ga0495605_0237502_82_768 225
492 3300046512 Ga0495610_0111799 Ga0495610_0111799_426_1118 225
493 3300046515 Ga0495620_0080807 Ga0495620_0080807_80_775 225
494 3300046517 Ga0495630_0053886 Ga0495630_0053886_445_1137 225
495 3300046519 Ga0495632_0009594 Ga0495632_0009594_4056_4763 225
496 3300046526 Ga0495666_0107764 Ga0495666_0107764_90_782 225
497 3300046528 Ga0495642_0193160 Ga0495642_0193160_131_838 225
498 3300046542 Ga0495597_0060297 Ga0495597_0060297_138_845 225
499 3300046557 Ga0495622_0213969 Ga0495622_0213969_28_720 225
500 3300046616 Ga0495668_0222901 Ga0495668_0222901_192_878 225
501 3300046660 Ga0495625_0043514 Ga0495625_0043514_519_1226 225
502 3300046690 Ga0495624_0053558 Ga0495624_0053558_153_845 225
503 3300046692 Ga0495671_0053495 Ga0495671_0053495_1098_1787 225
504 3300046694 Ga0495649_0027389 Ga0495649_0027389_1125_1832 225
505 3300047321 Ga0495676_0328157 Ga0495676_0328157_278_970 225
506 3300047443 Ga0495687_004677 Ga0495687_004677_7522_8229 225
507 3300047472 Ga0495686_0040543 Ga0495686_0040543_863_1555 225
508 3300047472 Ga0495686_0149187 Ga0495686_0149187_193_888 225
509 3300047673 Ga0495593_0014213 Ga0495593_0014213_71_763 225
510 3300048907 Ga0496104_0484827 Ga0496104_0484827_326_1012 225
511 3300048909 Ga0496106_0063823 Ga0496106_0063823_34_729 225
512 3300048915 Ga0496112_0508009 Ga0496112_0508009_188_889 225
513 3300049460 Ga0495682_0057697 Ga0495682_0057697_176_868 225
514 3300049460 Ga0495682_0128928 Ga0495682_0128928_180_887 225
515 3300050489 nmdc:mga03683_27419_c1 nmdc:mga03683_27419_c1_215_922 225
516 3300050489 nmdc:mga03683_31327_c1 nmdc:mga03683_31327_c1_941_1648 225
517 3300050489 nmdc:mga03683_59562_c1 nmdc:mga03683_59562_c1_243_950 225
518 3300050491 nmdc:mga00v17_14933_c1 nmdc:mga00v17_14933_c1_2564_3271 225
519 3300050492 nmdc:mga0yw44_265547_c1 nmdc:mga0yw44_265547_c1_212_919 225
520 3300050493 nmdc:mga0k408_157975_c1 nmdc:mga0k408_157975_c1_95_799 225
521 3300050493 nmdc:mga0k408_1630_c1 nmdc:mga0k408_1630_c1_664_1371 225
522 3300050493 nmdc:mga0k408_19589_c1 nmdc:mga0k408_19589_c1_860_1567 225
523 3300050493 nmdc:mga0k408_272977_c1 nmdc:mga0k408_272977_c1_89_796 225
524 3300050493 nmdc:mga0k408_2896_c1 nmdc:mga0k408_2896_c1_7587_8294 225
525 3300050493 nmdc:mga0k408_38999_c1 nmdc:mga0k408_38999_c1_1072_1779 225
526 3300050493 nmdc:mga0k408_8882_c1 nmdc:mga0k408_8882_c1_626_1333 225
527 3300050494 nmdc:mga06z11_42151_c1 nmdc:mga06z11_42151_c1_1274_1981 225
528 3300050496 nmdc:mga07m45_13053_c1 nmdc:mga07m45_13053_c1_467_1174 225
529 3300050496 nmdc:mga07m45_1758_c1 nmdc:mga07m45_1758_c1_4587_5294 225
530 3300050496 nmdc:mga07m45_34272_c1 nmdc:mga07m45_34272_c1_1384_2091 225
531 3300050496 nmdc:mga07m45_46051_c1 nmdc:mga07m45_46051_c1_908_1615 225
532 3300050496 nmdc:mga07m45_48364_c1 nmdc:mga07m45_48364_c1_1082_1801 225
533 3300050496 nmdc:mga07m45_56802_c1 nmdc:mga07m45_56802_c1_781_1488 225
534 3300050516 nmdc:mga0sz30_11556_c1 nmdc:mga0sz30_11556_c1_2516_3223 225
535 3300050516 nmdc:mga0sz30_42730_c1 nmdc:mga0sz30_42730_c1_474_1181 225
536 3300053086 Ga0500578_0263531 Ga0500578_0263531_40_735 225
537 3300053088 Ga0500644_0002955 Ga0500644_0002955_2234_2926 225
538 3300053092 Ga0500583_0025193 Ga0500583_0025193_1643_2335 225
539 3300053093 Ga0500651_0049716 Ga0500651_0049716_512_1219 225
540 3300053093 Ga0500651_0072819 Ga0500651_0072819_1163_1855 225
541 3300053118 Ga0500594_0021278 Ga0500594_0021278_890_1582 225
542 3300053131 Ga0500652_123037 Ga0500652_123037_352_1047 225
543 3300053134 Ga0500658_0002643 Ga0500658_0002643_5813_6520 225
544 3300053136 Ga0500559_0000089 Ga0500559_0000089_31646_32338 225
545 3300053139 Ga0500568_0035636 Ga0500568_0035636_360_1067 225
546 3300053153 Ga0500616_0093336 Ga0500616_0093336_765_1460 225
547 3300053156 Ga0500622_0063439 Ga0500622_0063439_840_1532 225
548 3300053158 Ga0500627_0099660 Ga0500627_0099660_400_1092 225
549 3300053730 Ga0500645_004599 Ga0500645_004599_4197_4892 225
550 3300053739 Ga0500587_002067 Ga0500587_002067_856_1548 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

103

220

0.94

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

30

214

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9791 7 225
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.9759 5 224
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9738 6 225
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9704 7 225
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.9662 7 225
ID Description Score Start End Superfamily
1qh9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9807 21 94 1.10.150.240
3um9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9783 21 94 1.10.150.240
3um9B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9783 21 94 1.10.150.240
1zrmA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.974 21 94 1.10.150.240
3umbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9728 5 224 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A0R0LQ40-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) 0.9892 94 223 GO:0018784
AF-A0A2V2ZWE7-F1-model_v4 2-haloacid dehalogenase 0.9841 6 223 GO:0019120
AF-A0A4Q0SYU9-F1-model_v4 Haloacid dehalogenase, type II 0.984 107 224
AF-A0A3S0IDG5-F1-model_v4 deleted 0.9831 8 162
AF-I8AE20-F1-model_v4 Haloacid dehalogenase 0.9826 8 223 GO:0019120

Feature Viewer

pLDDT pTM Quality
95.31 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map