F462426

General Info

Members Datasets Scaffolds Average Seq Length
549 268 526 175

Family's Representative Sequence

Representative Sequence 3300053118|Ga0500594_0173361|Ga0500594_0173361_21_581
Length 186
Sequence LRVQKTSGSHRVPVDTSRTFKPIHIALLTVSDTRGPDEDTSGDILAERIKGAGHHLVARAIEKDDAARIASRLNNWIDDRSVDAVVITGGTGLTGRDVTPEALDRVKTRDIPGFGELFRWLSYKTIGTSTIQSRACAVVARGTYIFALPGSNGAVKDGWDGILAEQLDSRNRPCNFVELMPRLLEK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
13 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
14 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
15 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
16 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
17 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
18 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
19 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
20 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
23 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
172 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
175 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
254 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 0.18
Isolates 4.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.03
Nodule 0.36
Rhizoplane 5.28
Rhizosphere 67.76
Stem 0
Stem Tuber 0
Unclassified 10.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2148523 2162886007 Bacteria 4287
2 SwRhRL2b_contig_227762 2162886007 Bacteria 1508
3 SwRhRL2b_contig_2402994 2162886007 Bacteria 55296
4 SwRhRL2b_contig_2586087 2162886007 Bacteria 50518
5 JGI24738J21930_10030141 3300002075 Bacteria 1108
6 JGI24751J29686_10000371 3300002459 Bacteria 15230
7 Ga0055536_1006241 3300003781 Bacteria 5619
8 Ga0055536_1008462 3300003781 Bacteria 4415
9 Ga0055536_1009136 3300003781 Bacteria 4150
10 Ga0055534_1011872 3300003784 Bacteria 1749
11 Ga0055530_10000095 3300003791 Bacteria 74707
12 Ga0055531_10000671 3300003794 Bacteria 29301
13 Ga0055531_10003237 3300003794 Bacteria 10449
14 Ga0065704_10000191 3300005289 Bacteria 318191
15 Ga0065704_10074063 3300005289 Bacteria 6570
16 Ga0065704_10084947 3300005289 Bacteria 3278
17 Ga0065704_10089238 3300005289 Bacteria 2875
18 Ga0065704_10161995 3300005289 Bacteria 1348
19 Ga0065707_10107248 3300005295 Bacteria 2562
20 Ga0070658_10000351 3300005327 Bacteria 39857
21 Ga0070658_10022866 3300005327 Bacteria 5018
22 Ga0070658_10085510 3300005327 Bacteria 2594
23 Ga0070658_10499179 3300005327 Bacteria 1051
24 Ga0070658_10528700 3300005327 Bacteria 1020
25 Ga0070683_100245290 3300005329 Bacteria 1704
26 Ga0070690_100043047 3300005330 Bacteria 2862
27 Ga0070670_100071110 3300005331 Bacteria 2987
28 Ga0070670_100808198 3300005331 Bacteria 847
29 Ga0070677_10505466 3300005333 Bacteria 656
30 Ga0070666_10024881 3300005335 Bacteria 3902
31 Ga0070666_10034184 3300005335 Bacteria 3369
32 Ga0070666_10144792 3300005335 Bacteria 1656
33 Ga0070680_100001788 3300005336 Bacteria 15779
34 Ga0070680_100109961 3300005336 Bacteria 2294
35 Ga0070680_100337564 3300005336 Bacteria 1280
36 Ga0070682_100223118 3300005337 Bacteria 1343
37 Ga0070660_100082325 3300005339 Bacteria 2527
38 Ga0070660_100506599 3300005339 Bacteria 1004
39 Ga0070660_100701551 3300005339 Bacteria 848
40 Ga0070661_100014392 3300005344 Bacteria 5574
41 Ga0070692_10200606 3300005345 Bacteria 1168
42 Ga0070668_100036043 3300005347 Bacteria 3774
43 Ga0070668_100050986 3300005347 Bacteria 3188
44 Ga0070668_100060072 3300005347 Bacteria 2943
45 Ga0070668_100112918 3300005347 Bacteria 2164
46 Ga0070669_100000471 3300005353 Bacteria 30589
47 Ga0070669_100001205 3300005353 Bacteria 18825
48 Ga0070669_100016003 3300005353 Bacteria 5352
49 Ga0070669_100162585 3300005353 Bacteria 1736
50 Ga0070675_100792640 3300005354 Bacteria 866
51 Ga0070671_100000050 3300005355 Bacteria 80843
52 Ga0070671_100000625 3300005355 Bacteria 25216
53 Ga0070671_100084467 3300005355 Bacteria 2655
54 Ga0070671_100187403 3300005355 Bacteria 1753
55 Ga0070659_100103131 3300005366 Bacteria 2297
56 Ga0070667_100000678 3300005367 Bacteria 33073
57 Ga0070667_100001208 3300005367 Bacteria 23502
58 Ga0070667_100012880 3300005367 Bacteria 6909
59 Ga0070667_100042618 3300005367 Bacteria 3808
60 Ga0070663_100008975 3300005455 Bacteria 6173
61 Ga0070663_100139755 3300005455 Bacteria 1848
62 Ga0070662_100005498 3300005457 Bacteria 8099
63 Ga0070662_100027278 3300005457 Bacteria 3962
64 Ga0070662_100056217 3300005457 Bacteria 2856
65 Ga0070681_10153876 3300005458 Bacteria 2225
66 Ga0070706_101016656 3300005467 Bacteria 764
67 Ga0070679_100019861 3300005530 Bacteria 6541
68 Ga0070679_100272781 3300005530 Bacteria 1645
69 Ga0070684_100406942 3300005535 Bacteria 1255
70 Ga0070684_100693853 3300005535 Bacteria 949
71 Ga0068853_100014555 3300005539 Bacteria 6448
72 Ga0068853_100034174 3300005539 Bacteria 4315
73 Ga0070672_100946434 3300005543 Bacteria 762
74 Ga0070686_100607346 3300005544 Bacteria 863
75 Ga0070665_100000558 3300005548 Bacteria 51892
76 Ga0070665_100006055 3300005548 Bacteria 12363
77 Ga0070665_100019405 3300005548 Bacteria 6822
78 Ga0070665_100034554 3300005548 Bacteria 5084
79 Ga0070665_100225525 3300005548 Bacteria 1874
80 Ga0068855_100001903 3300005563 Bacteria 25898
81 Ga0068855_100058647 3300005563 Bacteria 4507
82 Ga0068855_100093044 3300005563 Bacteria 3476
83 Ga0068855_100245608 3300005563 Bacteria 1998
84 Ga0068855_100502710 3300005563 Bacteria 1317
85 Ga0070664_100009523 3300005564 Bacteria 7877
86 Ga0068857_100036477 3300005577 Bacteria 4356
87 Ga0068854_100009070 3300005578 Bacteria 6411
88 Ga0068854_100020802 3300005578 Bacteria 4445
89 Ga0068854_100105359 3300005578 Bacteria 2120
90 Ga0068856_100000870 3300005614 Bacteria 32355
91 Ga0068856_100207206 3300005614 Bacteria 1975
92 Ga0068856_101081208 3300005614 Bacteria 820
93 Ga0068852_100001372 3300005616 Bacteria 16357
94 Ga0068852_100374625 3300005616 Bacteria 1395
95 Ga0068859_100051803 3300005617 Bacteria 4127
96 Ga0068859_100534623 3300005617 Bacteria 1267
97 Ga0068859_100808343 3300005617 Bacteria 1025
98 Ga0068864_100197223 3300005618 Bacteria 1848
99 Ga0068864_100306012 3300005618 Bacteria 1489
100 Ga0068863_100000072 3300005841 Bacteria 113996
101 Ga0068863_100025858 3300005841 Bacteria 5601
102 Ga0068858_100003271 3300005842 Bacteria 16139
103 Ga0068858_100018376 3300005842 Bacteria 6547
104 Ga0068858_100088476 3300005842 Bacteria 2882
105 Ga0068858_100102093 3300005842 Bacteria 2675
106 Ga0068858_100133357 3300005842 Bacteria 2330
107 Ga0068860_100000247 3300005843 Bacteria 81527
108 Ga0068860_100008233 3300005843 Bacteria 10377
109 Ga0068860_100011513 3300005843 Bacteria 8719
110 Ga0068860_100018892 3300005843 Bacteria 6697
111 Ga0068860_100102342 3300005843 Bacteria 2733
112 Ga0068862_100044086 3300005844 Bacteria 3805
113 Ga0068862_100082007 3300005844 Bacteria 2798
114 Ga0068862_100139823 3300005844 Bacteria 2148
115 Ga0068862_100290458 3300005844 Bacteria 1501
116 Ga0068862_100668948 3300005844 Bacteria 1003
117 Ga0075365_10101723 3300006038 Bacteria 1968
118 Ga0075368_10000292 3300006042 Bacteria 14384
119 Ga0075364_10019320 3300006051 Bacteria 4276
120 Ga0075364_10034976 3300006051 Bacteria 3245
121 Ga0075364_10606477 3300006051 Bacteria 748
122 Ga0075432_10000436 3300006058 Bacteria 12261
123 Ga0075362_10006967 3300006177 Bacteria 4244
124 Ga0075362_10209634 3300006177 Bacteria 950
125 Ga0075367_10012881 3300006178 Bacteria 4478
126 Ga0075369_10042744 3300006186 Bacteria 1943
127 Ga0075369_10055918 3300006186 Bacteria 1715
128 Ga0075369_10082625 3300006186 Bacteria 1426
129 Ga0075366_10004373 3300006195 Bacteria 7580
130 Ga0075366_10016974 3300006195 Bacteria 4186
131 Ga0075366_10173386 3300006195 Bacteria 1309
132 Ga0097621_100180290 3300006237 Bacteria 1825
133 Ga0075370_10002239 3300006353 Bacteria 8898
134 Ga0075370_10021621 3300006353 Bacteria 3525
135 Ga0075370_10049133 3300006353 Bacteria 2391
136 Ga0075370_10154574 3300006353 Bacteria 1345
137 Ga0075370_10444934 3300006353 Bacteria 779
138 Ga0097620_100051804 3300006931 Bacteria 4127
139 Ga0097620_100534535 3300006931 Bacteria 1267
140 Ga0097620_100808271 3300006931 Bacteria 1025
141 Ga0079104_1010389 3300006946 Bacteria 3071
142 Ga0105251_10001990 3300009011 Bacteria 16622
143 Ga0105250_10022700 3300009092 Bacteria 2529
144 Ga0105240_10002582 3300009093 Bacteria 29015
145 Ga0105240_10291207 3300009093 Bacteria 1871
146 Ga0105247_10026870 3300009101 Bacteria 3479
147 Ga0105247_10070349 3300009101 Bacteria 2186
148 Ga0105247_10113180 3300009101 Bacteria 1749
149 Ga0105247_10120750 3300009101 Bacteria 1697
150 Ga0105243_10235024 3300009148 Bacteria 1628
151 Ga0105241_10097336 3300009174 Bacteria 2333
152 Ga0105248_10017441 3300009177 Bacteria 7916
153 Ga0105248_10026372 3300009177 Bacteria 6463
154 Ga0105248_10382066 3300009177 Bacteria 1586
155 Ga0105248_10586921 3300009177 Bacteria 1257
156 Ga0105238_10028775 3300009551 Bacteria 5659
157 Ga0105249_10570566 3300009553 Bacteria 1184
158 Ga0105249_10777563 3300009553 Bacteria 1021
159 Ga0105239_11273852 3300010375 Bacteria 848
160 Ga0105246_10000124 3300011119 Bacteria 35447
161 Ga0157373_10004044 3300013100 Bacteria 11053
162 Ga0157371_10001205 3300013102 Bacteria 27626
163 Ga0157371_10079682 3300013102 Bacteria 2320
164 Ga0157371_10193863 3300013102 Bacteria 1455
165 Ga0157371_10224614 3300013102 Bacteria 1349
166 Ga0157370_10028075 3300013104 Bacteria 5540
167 Ga0157370_10549197 3300013104 Bacteria 1059
168 Ga0157369_10001195 3300013105 Bacteria 32360
169 Ga0157369_10249454 3300013105 Bacteria 1853
170 Ga0163162_10020601 3300013306 Bacteria 6480
171 Ga0163162_10092129 3300013306 Bacteria 3114
172 Ga0163162_10178945 3300013306 Bacteria 2246
173 Ga0157372_10003911 3300013307 Bacteria 16008
174 Ga0157380_10030824 3300014326 Bacteria 4110
175 Ga0157380_10262579 3300014326 Bacteria 1569
176 Ga0157380_10528253 3300014326 Bacteria 1152
177 Ga0157377_11162775 3300014745 Bacteria 595
178 Ga0157379_10491053 3300014968 Bacteria 1137
179 Ga0163161_10001409 3300017792 Bacteria 17755
180 Ga0163161_10655226 3300017792 Bacteria 870
181 Ga0209675_1000025 3300025291 Bacteria 294102
182 Ga0209676_1000276 3300025292 Bacteria 106867
183 Ga0209676_1000362 3300025292 Bacteria 85770
184 Ga0209676_1000453 3300025292 Bacteria 69137
185 Ga0209676_1020187 3300025292 Bacteria 2271
186 Ga0209025_1009654 3300025294 Bacteria 6679
187 Ga0209025_1042084 3300025294 Bacteria 1946
188 Ga0209025_1102865 3300025294 Bacteria 899
189 Ga0209050_1000265 3300025298 Bacteria 112618
190 Ga0209050_1000728 3300025298 Bacteria 47923
191 Ga0209050_1001953 3300025298 Bacteria 19508
192 Ga0209050_1018639 3300025298 Bacteria 2684
193 Ga0209257_1000487 3300025304 Bacteria 71315
194 Ga0209257_1000596 3300025304 Bacteria 59951
195 Ga0207696_1017291 3300025711 Bacteria 2391
196 Ga0207713_1003924 3300025735 Bacteria 9897
197 Ga0207710_10049716 3300025900 Bacteria 1879
198 Ga0207680_10086482 3300025903 Bacteria 1983
199 Ga0207680_10217053 3300025903 Bacteria 1309
200 Ga0207680_10335954 3300025903 Bacteria 1059
201 Ga0207647_10074695 3300025904 Bacteria 2041
202 Ga0207647_10081880 3300025904 Bacteria 1934
203 Ga0207645_10096010 3300025907 Bacteria 1909
204 Ga0207705_10000075 3300025909 Bacteria 123551
205 Ga0207705_10009626 3300025909 Bacteria 7027
206 Ga0207705_10035083 3300025909 Bacteria 3588
207 Ga0207705_10217584 3300025909 Bacteria 1450
208 Ga0207705_10253100 3300025909 Bacteria 1343
209 Ga0207705_10740224 3300025909 Bacteria 764
210 Ga0207684_10812551 3300025910 Bacteria 790
211 Ga0207707_10098380 3300025912 Bacteria 2557
212 Ga0207695_10002012 3300025913 Bacteria 31349
213 Ga0207660_10555100 3300025917 Bacteria 934
214 Ga0207660_10666368 3300025917 Bacteria 848
215 Ga0207662_10350919 3300025918 Bacteria 991
216 Ga0207657_10000104 3300025919 Bacteria 81832
217 Ga0207657_10024189 3300025919 Bacteria 5636
218 Ga0207649_10065015 3300025920 Bacteria 2308
219 Ga0207652_10013974 3300025921 Bacteria 6501
220 Ga0207652_10032761 3300025921 Bacteria 4372
221 Ga0207652_10042547 3300025921 Bacteria 3867
222 Ga0207681_10000090 3300025923 Bacteria 78944
223 Ga0207681_10000174 3300025923 Bacteria 52934
224 Ga0207681_10002327 3300025923 Bacteria 12090
225 Ga0207681_10060023 3300025923 Bacteria 2609
226 Ga0207694_10011099 3300025924 Bacteria 6804
227 Ga0207650_10013354 3300025925 Bacteria 5686
228 Ga0207650_10677770 3300025925 Bacteria 870
229 Ga0207644_10000003 3300025931 Bacteria 585905
230 Ga0207644_10034952 3300025931 Bacteria 3519
231 Ga0207644_10048047 3300025931 Bacteria 3048
232 Ga0207644_10118080 3300025931 Bacteria 2015
233 Ga0207690_10000231 3300025932 Bacteria 41621
234 Ga0207690_10099399 3300025932 Bacteria 2074
235 Ga0207706_10001100 3300025933 Bacteria 27513
236 Ga0207706_10002662 3300025933 Bacteria 17385
237 Ga0207706_10023678 3300025933 Bacteria 5512
238 Ga0207691_10639727 3300025940 Bacteria 899
239 Ga0207711_10014272 3300025941 Bacteria 6600
240 Ga0207711_10246309 3300025941 Bacteria 1640
241 Ga0207711_10378569 3300025941 Bacteria 1313
242 Ga0207661_10132143 3300025944 Bacteria 2140
243 Ga0207661_10328521 3300025944 Bacteria 1376
244 Ga0207661_10511926 3300025944 Bacteria 1097
245 Ga0207679_10072115 3300025945 Bacteria 2608
246 Ga0207679_10134819 3300025945 Bacteria 1987
247 Ga0207667_10009625 3300025949 Bacteria 11368
248 Ga0207667_10016336 3300025949 Bacteria 8389
249 Ga0207667_10071502 3300025949 Bacteria 3607
250 Ga0207667_10075386 3300025949 Bacteria 3503
251 Ga0207667_10086389 3300025949 Bacteria 3246
252 Ga0207667_10319211 3300025949 Bacteria 1586
253 Ga0207712_10362754 3300025961 Bacteria 1207
254 Ga0207712_10497784 3300025961 Bacteria 1041
255 Ga0207668_10002249 3300025972 Bacteria 11249
256 Ga0207668_10011435 3300025972 Bacteria 5393
257 Ga0207668_10024971 3300025972 Bacteria 3863
258 Ga0207668_10200750 3300025972 Bacteria 1588
259 Ga0207668_10513176 3300025972 Bacteria 1033
260 Ga0207640_10000662 3300025981 Bacteria 20165
261 Ga0207640_10009111 3300025981 Bacteria 5543
262 Ga0207640_10139076 3300025981 Bacteria 1767
263 Ga0207640_10498252 3300025981 Bacteria 1014
264 Ga0207658_10003035 3300025986 Bacteria 12000
265 Ga0207658_10003439 3300025986 Bacteria 11199
266 Ga0207658_10008982 3300025986 Bacteria 6781
267 Ga0207658_10012540 3300025986 Bacteria 5788
268 Ga0207658_10480959 3300025986 Bacteria 1103
269 Ga0207703_10000733 3300026035 Bacteria 32263
270 Ga0207703_10008100 3300026035 Bacteria 8307
271 Ga0207703_10124624 3300026035 Bacteria 2216
272 Ga0207639_11150406 3300026041 Bacteria 728
273 Ga0207678_10021284 3300026067 Bacteria 5686
274 Ga0207708_10773143 3300026075 Bacteria 825
275 Ga0207702_10003595 3300026078 Bacteria 14092
276 Ga0207702_10065696 3300026078 Bacteria 3108
277 Ga0207641_10000084 3300026088 Bacteria 133555
278 Ga0207641_10066188 3300026088 Bacteria 3093
279 Ga0207641_11502824 3300026088 Bacteria 675
280 Ga0207676_10017333 3300026095 Bacteria 5220
281 Ga0207676_10065282 3300026095 Bacteria 2898
282 Ga0207674_10016257 3300026116 Bacteria 8150
283 Ga0207674_10307176 3300026116 Bacteria 1535
284 Ga0207674_10598947 3300026116 Bacteria 1065
285 Ga0207698_10000005 3300026142 Bacteria 295687
286 Ga0207698_10002889 3300026142 Bacteria 10282
287 Ga0207698_10061022 3300026142 Bacteria 2935
288 Ga0207698_10535593 3300026142 Bacteria 1145
289 Ga0207698_10927297 3300026142 Bacteria 879
290 Ga0207698_11805028 3300026142 Bacteria 627
291 Ga0209281_1014327 3300027111 Bacteria 1682
292 Ga0209813_10000236 3300027866 Bacteria 16663
293 Ga0209974_10035384 3300027876 Bacteria 1659
294 Ga0209974_10052386 3300027876 Bacteria 1373
295 Ga0207428_10030767 3300027907 Bacteria 4435
296 Ga0268266_10001483 3300028379 Bacteria 27834
297 Ga0268266_10011220 3300028379 Bacteria 7798
298 Ga0268266_10012382 3300028379 Bacteria 7373
299 Ga0268266_10316978 3300028379 Bacteria 1458
300 Ga0268266_10417502 3300028379 Bacteria 1271
301 Ga0268266_10578678 3300028379 Bacteria 1077
302 Ga0268265_10002095 3300028380 Bacteria 15531
303 Ga0268265_10004649 3300028380 Bacteria 9478
304 Ga0268265_10144312 3300028380 Bacteria 1997
305 Ga0268265_10468352 3300028380 Bacteria 1180
306 Ga0268265_11306373 3300028380 Bacteria 726
307 Ga0268264_10000253 3300028381 Bacteria 98587
308 Ga0268264_10051400 3300028381 Bacteria 3434
309 Ga0268264_10076985 3300028381 Bacteria 2840
310 Ga0265327_10048730 3300031251 Bacteria 2226
311 Ga0307408_100311442 3300031548 Bacteria 1323
312 Ga0316579_10084735 3300031691 Bacteria 1512
313 Ga0307413_10070531 3300031824 Bacteria 2198
314 Ga0307413_10646362 3300031824 Bacteria 872
315 Ga0307410_10765566 3300031852 Bacteria 818
316 Ga0307406_10390631 3300031901 Bacteria 1100
317 Ga0307412_10053491 3300031911 Bacteria 2676
318 Ga0307412_10183184 3300031911 Bacteria 1577
319 Ga0307412_10214172 3300031911 Bacteria 1472
320 Ga0307409_100428792 3300031995 Bacteria 1270
321 Ga0307409_100787164 3300031995 Bacteria 958
322 Ga0307416_100295166 3300032002 Bacteria 1607
323 Ga0307416_100690523 3300032002 Bacteria 1109
324 Ga0307414_10002468 3300032004 Bacteria 9695
325 Ga0307414_10009523 3300032004 Bacteria 5587
326 Ga0307414_10037239 3300032004 Bacteria 3255
327 Ga0307414_10139617 3300032004 Bacteria 1895
328 Ga0307414_10275868 3300032004 Bacteria 1410
329 Ga0307414_10619203 3300032004 Bacteria 973
330 Ga0307414_10948635 3300032004 Bacteria 790
331 Ga0307411_10378313 3300032005 Bacteria 1164
332 Ga0307411_10457533 3300032005 Bacteria 1069
333 Ga0307415_100127752 3300032126 Bacteria 1919
334 Ga0307415_100248861 3300032126 Bacteria 1443
335 Ga0316583_10011128 3300032133 Bacteria 3240
336 Ga0316582_0001310 3300036647 Bacteria 10779
337 Ga0316584_0045647 3300036712 Bacteria 3271
338 Ga0436360_1079060 3300039438 Bacteria 1398
339 Ga0451795_0064262 3300041456 Bacteria 594
340 Ga0451802_0312486 3300041460 Bacteria 689
341 Ga0451837_1623155 3300041494 Bacteria 852
342 Ga0451841_0408716 3300041498 Bacteria 790
343 Ga0451845_0794105 3300041501 Bacteria 592
344 Ga0451853_0831705 3300041512 Bacteria 1838
345 Ga0451853_0840808 3300041512 Bacteria 625
346 Ga0451853_0955612 3300041512 Bacteria 796
347 Ga0439462_0003065 3300042015 Bacteria 3972
348 Ga0451576_0000023 3300045051 Bacteria 477965
349 Ga0495627_000579 3300046453 Bacteria 29423
350 Ga0495638_0078950 3300046460 Bacteria 2002
351 Ga0495638_0297384 3300046460 Bacteria 871
352 Ga0495650_0001710 3300046471 Bacteria 20145
353 Ga0495596_0000430 3300046500 Bacteria 26887
354 Ga0495596_0007073 3300046500 Bacteria 5085
355 Ga0495607_0033268 3300046501 Bacteria 3138
356 Ga0495583_0101941 3300046506 Bacteria 1224
357 Ga0495610_0000018 3300046512 Bacteria 355044
358 Ga0495610_0009278 3300046512 Bacteria 6236
359 Ga0495610_0010929 3300046512 Bacteria 5596
360 Ga0495610_0098563 3300046512 Bacteria 1313
361 Ga0495610_0141722 3300046512 Bacteria 1034
362 Ga0495620_0007194 3300046515 Bacteria 6064
363 Ga0495632_0001865 3300046519 Bacteria 16917
364 Ga0495643_0000132 3300046522 Bacteria 121567
365 Ga0495643_0102230 3300046522 Bacteria 1467
366 Ga0495643_0147246 3300046522 Bacteria 1169
367 Ga0495643_0228606 3300046522 Bacteria 878
368 Ga0495654_0029673 3300046530 Bacteria 2788
369 Ga0495654_0048385 3300046530 Bacteria 2087
370 Ga0495654_0075048 3300046530 Bacteria 1596
371 Ga0495598_0083295 3300046537 Bacteria 1030
372 Ga0495621_0101093 3300046539 Bacteria 1097
373 Ga0495597_0164157 3300046542 Bacteria 905
374 Ga0495668_0000001 3300046616 Bacteria 1013420
375 Ga0495668_0170905 3300046616 Bacteria 1191
376 Ga0495668_0282347 3300046616 Bacteria 910
377 Ga0495625_0001272 3300046660 Bacteria 31687
378 Ga0495625_0017416 3300046660 Bacteria 5626
379 Ga0495660_0310149 3300046810 Bacteria 712
380 Ga0495681_0000040 3300047470 Bacteria 119638
381 Ga0495615_0000112 3300048090 Bacteria 21734
382 Ga0495626_0002004 3300048091 Bacteria 15016
383 Ga0496100_0033899 3300048903 Bacteria 3198
384 Ga0496100_0040553 3300048903 Bacteria 2963
385 Ga0496101_0011210 3300048904 Bacteria 5939
386 Ga0496101_0038744 3300048904 Bacteria 3386
387 Ga0496102_0004232 3300048905 Bacteria 12132
388 Ga0496102_0115943 3300048905 Bacteria 2499
389 Ga0496103_0051735 3300048906 Bacteria 2543
390 Ga0496103_0137851 3300048906 Bacteria 1559
391 Ga0496104_0012313 3300048907 Bacteria 7689
392 Ga0496104_0030216 3300048907 Bacteria 5033
393 Ga0496104_0064732 3300048907 Bacteria 3468
394 Ga0496105_0000395 3300048908 Bacteria 28676
395 Ga0496105_0002963 3300048908 Bacteria 12460
396 Ga0496105_0427558 3300048908 Bacteria 1048
397 Ga0496106_0022674 3300048909 Bacteria 4665
398 Ga0496107_0046039 3300048910 Bacteria 3139
399 Ga0496108_0073518 3300048911 Bacteria 2886
400 Ga0496108_0085919 3300048911 Bacteria 2671
401 Ga0496109_0065383 3300048912 Bacteria 3329
402 Ga0496110_0377638 3300048913 Bacteria 1291
403 Ga0496111_0120428 3300048914 Bacteria 1938
404 Ga0496111_0545490 3300048914 Bacteria 851
405 Ga0496112_0011449 3300048915 Bacteria 8101
406 Ga0496112_0042071 3300048915 Bacteria 4470
407 Ga0496113_0014307 3300048916 Bacteria 5409
408 Ga0496114_0015293 3300048917 Bacteria 6170
409 Ga0496114_1063443 3300048917 Bacteria 693
410 Ga0496116_0000017 3300048919 Bacteria 554463
411 Ga0496116_0145137 3300048919 Bacteria 1327
412 Ga0496117_0010865 3300048920 Bacteria 8212
413 Ga0496117_0027332 3300048920 Bacteria 4448
414 Ga0496117_0228872 3300048920 Bacteria 1029
415 Ga0496117_0327767 3300048920 Bacteria 799
416 Ga0496118_0009007 3300048921 Bacteria 10180
417 Ga0496118_0025496 3300048921 Bacteria 5066
418 Ga0496118_0026497 3300048921 Bacteria 4935
419 Ga0496118_0108550 3300048921 Bacteria 1850
420 Ga0496119_0000040 3300048922 Bacteria 208180
421 Ga0496121_0000070 3300048924 Bacteria 249187
422 Ga0496121_0000136 3300048924 Bacteria 165350
423 Ga0496121_0007195 3300048924 Bacteria 13479
424 Ga0496121_0037153 3300048924 Bacteria 4329
425 Ga0496122_0002119 3300048925 Bacteria 29307
426 Ga0496122_0003206 3300048925 Bacteria 21770
427 Ga0496122_0077714 3300048925 Bacteria 2329
428 Ga0496123_0001873 3300048926 Bacteria 27552
429 Ga0496123_0002110 3300048926 Bacteria 25520
430 Ga0496123_0003210 3300048926 Bacteria 18637
431 Ga0496123_0061823 3300048926 Bacteria 2404
432 Ga0496124_0002485 3300048927 Bacteria 24031
433 Ga0496124_0005357 3300048927 Bacteria 14482
434 Ga0496124_0009214 3300048927 Bacteria 10183
435 Ga0496124_0011108 3300048927 Bacteria 9034
436 Ga0496124_0142993 3300048927 Bacteria 1885
437 Ga0496124_0162443 3300048927 Bacteria 1739
438 Ga0496124_0643496 3300048927 Bacteria 682
439 Ga0496125_0023545 3300048928 Bacteria 5682
440 Ga0496125_0041597 3300048928 Bacteria 3926
441 Ga0496125_0225684 3300048928 Bacteria 1202
442 Ga0496125_0322707 3300048928 Bacteria 935
443 Ga0496126_0000044 3300048929 Bacteria 335904
444 Ga0496126_0000359 3300048929 Bacteria 94946
445 Ga0496126_0032469 3300048929 Bacteria 4918
446 Ga0496126_0040691 3300048929 Bacteria 4308
447 Ga0496126_0227853 3300048929 Bacteria 1562
448 Ga0495682_0137448 3300049460 Bacteria 873
449 Ga0501031_0074311 3300049568 Bacteria 2213
450 Ga0501032_0003968 3300049569 Bacteria 11218
451 Ga0501033_0009304 3300049570 Bacteria 7569
452 Ga0501033_0187394 3300049570 Bacteria 1481
453 Ga0501034_0023678 3300049571 Bacteria 6253
454 Ga0501034_0104217 3300049571 Bacteria 2830
455 Ga0501034_0209400 3300049571 Bacteria 1905
456 Ga0501036_0004924 3300049572 Bacteria 10789
457 Ga0501036_1123480 3300049572 Bacteria 642
458 Ga0501037_0029636 3300049573 Bacteria 4043
459 Ga0501037_0219646 3300049573 Bacteria 1338
460 Ga0501038_0047954 3300049574 Bacteria 3698
461 Ga0501039_0247635 3300049575 Bacteria 1401
462 Ga0501039_0371494 3300049575 Bacteria 1124
463 Ga0501043_0141299 3300049579 Bacteria 1885
464 Ga0501046_0283827 3300049580 Bacteria 1212
465 Ga0501047_0029036 3300049581 Bacteria 5334
466 Ga0501047_0668492 3300049581 Bacteria 857
467 Ga0501047_1195802 3300049581 Bacteria 574
468 Ga0501070_0196947 3300049586 Bacteria 1655
469 Ga0501073_0769777 3300049589 Bacteria 664
470 Ga0501074_0441501 3300049590 Bacteria 923
471 Ga0501080_0690706 3300049742 Bacteria 901
472 Ga0501035_0005950 3300049822 Bacteria 11484
473 Ga0501044_0000346 3300049823 Bacteria 58137
474 Ga0501044_0068301 3300049823 Bacteria 3620
475 Ga0501044_0144438 3300049823 Bacteria 2366
476 Ga0501044_0219059 3300049823 Bacteria 1854
477 Ga0501044_0335121 3300049823 Bacteria 1435
478 Ga0501044_0725786 3300049823 Bacteria 877
479 nmdc:mga03683_116_c1 3300050489 Bacteria 27362
480 nmdc:mga03683_183656_c1 3300050489 Bacteria 955
481 nmdc:mga03683_50052_c1 3300050489 Bacteria 1741
482 nmdc:mga03n38_38140_c1 3300050490 Bacteria 2077
483 nmdc:mga00v17_102033_c1 3300050491 Bacteria 1812
484 nmdc:mga00v17_2760_c1 3300050491 Bacteria 9010
485 nmdc:mga00v17_5001_c1 3300050491 Bacteria 6960
486 nmdc:mga0yw44_272659_c1 3300050492 Bacteria 1130
487 nmdc:mga0k408_24374_c1 3300050493 Bacteria 3420
488 nmdc:mga0k408_2554_c1 3300050493 Bacteria 9672
489 nmdc:mga06z11_1105_c1 3300050494 Bacteria 9850
490 nmdc:mga04h51_202_c1 3300050495 Bacteria 16266
491 nmdc:mga07m45_1346_c1 3300050496 Bacteria 11186
492 nmdc:mga07m45_224387_c1 3300050496 Bacteria 1093
493 nmdc:mga07m45_26885_c1 3300050496 Bacteria 3165
494 nmdc:mga07m45_312158_c1 3300050496 Bacteria 914
495 nmdc:mga07m45_426748_c1 3300050496 Bacteria 769
496 nmdc:mga07m45_530038_c1 3300050496 Bacteria 681
497 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
498 nmdc:mga07m45_73257_c1 3300050496 Bacteria 1950
499 nmdc:mga07m45_75151_c1 3300050496 Bacteria 1925
500 nmdc:mga0sz30_24979_c1 3300050516 Bacteria 2442
501 nmdc:mga0sz30_58236_c2 3300050516 Bacteria 1344
502 nmdc:mga0sz30_660_c1 3300050516 Bacteria 12749
503 nmdc:mga0sz30_74714_c1 3300050516 Bacteria 1462
504 Ga0500643_014843 3300053087 Bacteria 2689
505 Ga0500566_0071940 3300053094 Bacteria 1940
506 Ga0500594_0014225 3300053118 Bacteria 1903
507 Ga0500594_0173361 3300053118 Bacteria 701
508 Ga0500607_000048 3300053121 Bacteria 82363
509 Ga0500607_000162 3300053121 Bacteria 57883
510 Ga0500608_002538 3300053122 Bacteria 6662
511 Ga0500618_001530 3300053125 Bacteria 10143
512 Ga0500642_0094660 3300053130 Bacteria 1384
513 Ga0500559_0000897 3300053136 Bacteria 18990
514 Ga0500559_0011336 3300053136 Bacteria 3808
515 Ga0500559_0022855 3300053136 Bacteria 2653
516 Ga0500564_000591 3300053138 Bacteria 10962
517 Ga0500568_0002416 3300053139 Bacteria 11013
518 Ga0500590_058608 3300053148 Bacteria 1939
519 Ga0500616_0005248 3300053153 Bacteria 8859
520 Ga0500622_0000491 3300053156 Bacteria 36964
521 Ga0500622_0055421 3300053156 Bacteria 2031
522 Ga0500627_0000005 3300053158 Bacteria 167950
523 Ga0500625_000010 3300053729 Bacteria 154401
524 Ga0500645_003073 3300053730 Bacteria 6999
525 Ga0500645_069864 3300053730 Bacteria 1009
526 Ga0587072_055443 3300059643 Bacteria 804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917021 2511128784 170
2 iso_pu_bacteria 2643221560 2643821659 170
3 iso_pu_bacteria 2643221563 2643835808 170
4 iso_pu_bacteria 2643221608 2644056734 170
5 iso_pu_bacteria 2852653556 2852655415 170
6 iso_pu_bacteria 2852680915 2852681772 170
7 iso_pu_bacteria 8054302542 8054302611 170
8 3300041494 Ga0451837_1623155 Ga0451837_1623155_320_835 171
9 iso_pu_bacteria 2643221588 2643949474 171
10 iso_pu_bacteria 2738541275 2738709990 171
11 iso_pu_bacteria 2738541301 2738848415 171
12 iso_pu_bacteria 2738541304 2738864144 171
13 iso_pu_bacteria 2738543022 2739296662 171
14 iso_pu_bacteria 2738543033 2739358340 171
15 iso_pu_bacteria 2739367664 2739649775 171
16 iso_pu_bacteria 2739367865 2740028248 171
17 iso_pu_bacteria 2818991438 2819550826 171
18 iso_pu_bacteria 2848297114 2848299063 171
19 iso_pu_bacteria 2896184354 2896184680 171
20 iso_pu_bacteria 2896253425 2896255046 171
21 iso_pu_bacteria 2919138771 2919141662 171
22 iso_pu_bacteria 2928100450 2928101689 171
23 iso_pu_bacteria 2928959182 2928959779 171
24 iso_pu_bacteria 3000865235 3000866230 171
25 3300003781 Ga0055536_1006241 Ga0055536_10062413 174
26 3300003781 Ga0055536_1008462 Ga0055536_10084624 174
27 3300003781 Ga0055536_1009136 Ga0055536_10091363 174
28 3300003784 Ga0055534_1011872 Ga0055534_10118722 174
29 3300003791 Ga0055530_10000095 Ga0055530_1000009516 174
30 3300003794 Ga0055531_10000671 Ga0055531_1000067111 174
31 3300003794 Ga0055531_10003237 Ga0055531_100032376 174
32 3300025291 Ga0209675_1000025 Ga0209675_100002576 174
33 3300025292 Ga0209676_1000276 Ga0209676_100027611 174
34 3300025292 Ga0209676_1000362 Ga0209676_100036216 174
35 3300025292 Ga0209676_1000453 Ga0209676_100045365 174
36 3300025292 Ga0209676_1020187 Ga0209676_10201872 174
37 3300025294 Ga0209025_1009654 Ga0209025_10096544 174
38 3300025294 Ga0209025_1042084 Ga0209025_10420841 174
39 3300025294 Ga0209025_1102865 Ga0209025_11028652 174
40 3300025298 Ga0209050_1000728 Ga0209050_100072828 174
41 3300025298 Ga0209050_1001953 Ga0209050_100195312 174
42 3300025298 Ga0209050_1018639 Ga0209050_10186392 174
43 3300025304 Ga0209257_1000487 Ga0209257_100048754 174
44 3300025304 Ga0209257_1000596 Ga0209257_100059642 174
45 3300031824 Ga0307413_10646362 Ga0307413_106463622 174
46 3300031911 Ga0307412_10183184 Ga0307412_101831842 174
47 3300031911 Ga0307412_10214172 Ga0307412_102141722 174
48 3300032004 Ga0307414_10139617 Ga0307414_101396172 174
49 3300032004 Ga0307414_10275868 Ga0307414_102758682 174
50 3300032004 Ga0307414_10948635 Ga0307414_109486352 174
51 3300046460 Ga0495638_0297384 Ga0495638_0297384_291_818 174
52 3300046500 Ga0495596_0000430 Ga0495596_0000430_22324_22851 174
53 3300046501 Ga0495607_0033268 Ga0495607_0033268_1619_2146 174
54 3300046506 Ga0495583_0101941 Ga0495583_0101941_219_746 174
55 3300046522 Ga0495643_0102230 Ga0495643_0102230_146_673 174
56 3300046530 Ga0495654_0048385 Ga0495654_0048385_600_1142 174
57 3300046616 Ga0495668_0000001 Ga0495668_0000001_816979_817503 174
58 3300046660 Ga0495625_0001272 Ga0495625_0001272_9978_10502 174
59 3300048090 Ga0495615_0000112 Ga0495615_0000112_14378_14905 174
60 3300048925 Ga0496122_0003206 Ga0496122_0003206_14400_14927 174
61 3300048926 Ga0496123_0002110 Ga0496123_0002110_10568_11095 174
62 3300048927 Ga0496124_0011108 Ga0496124_0011108_2791_3318 174
63 3300049568 Ga0501031_0074311 Ga0501031_0074311_1276_1800 174
64 3300049569 Ga0501032_0003968 Ga0501032_0003968_6315_6839 174
65 3300049570 Ga0501033_0009304 Ga0501033_0009304_4435_4959 174
66 3300049570 Ga0501033_0187394 Ga0501033_0187394_881_1405 174
67 3300049571 Ga0501034_0023678 Ga0501034_0023678_3195_3719 174
68 3300049571 Ga0501034_0209400 Ga0501034_0209400_348_872 174
69 3300049572 Ga0501036_0004924 Ga0501036_0004924_7646_8170 174
70 3300049573 Ga0501037_0029636 Ga0501037_0029636_2395_2919 174
71 3300049574 Ga0501038_0047954 Ga0501038_0047954_2578_3102 174
72 3300049575 Ga0501039_0247635 Ga0501039_0247635_548_1072 174
73 3300049579 Ga0501043_0141299 Ga0501043_0141299_880_1404 174
74 3300049580 Ga0501046_0283827 Ga0501046_0283827_381_905 174
75 3300049581 Ga0501047_0029036 Ga0501047_0029036_1272_1796 174
76 3300049822 Ga0501035_0005950 Ga0501035_0005950_3340_3864 174
77 3300049823 Ga0501044_0068301 Ga0501044_0068301_466_990 174
78 3300049823 Ga0501044_0219059 Ga0501044_0219059_85_609 174
79 3300049823 Ga0501044_0725786 Ga0501044_0725786_43_567 174
80 3300053118 Ga0500594_0014225 Ga0500594_0014225_1027_1572 174
81 3300053139 Ga0500568_0002416 Ga0500568_0002416_1564_2088 174
82 3300053158 Ga0500627_0000005 Ga0500627_0000005_110581_111123 174
83 2162886007 SwRhRL2b_contig_2148523 SwRhRL2b_0762.00006820 175
84 2162886007 SwRhRL2b_contig_227762 SwRhRL2b_0372.00003920 175
85 2162886007 SwRhRL2b_contig_2402994 SwRhRL2b_0577.00001720 175
86 2162886007 SwRhRL2b_contig_2586087 SwRhRL2b_0310.00004520 175
87 3300002075 JGI24738J21930_10030141 JGI24738J21930_100301411 175
88 3300002459 JGI24751J29686_10000371 JGI24751J29686_1000037111 175
89 3300005289 Ga0065704_10000191 Ga0065704_10000191220 175
90 3300005289 Ga0065704_10074063 Ga0065704_100740631 175
91 3300005289 Ga0065704_10084947 Ga0065704_100849472 175
92 3300005289 Ga0065704_10089238 Ga0065704_100892383 175
93 3300005289 Ga0065704_10161995 Ga0065704_101619952 175
94 3300005295 Ga0065707_10107248 Ga0065707_101072482 175
95 3300005327 Ga0070658_10000351 Ga0070658_1000035116 175
96 3300005327 Ga0070658_10022866 Ga0070658_100228663 175
97 3300005327 Ga0070658_10085510 Ga0070658_100855104 175
98 3300005327 Ga0070658_10499179 Ga0070658_104991792 175
99 3300005327 Ga0070658_10528700 Ga0070658_105287002 175
100 3300005329 Ga0070683_100245290 Ga0070683_1002452902 175
101 3300005330 Ga0070690_100043047 Ga0070690_1000430473 175
102 3300005331 Ga0070670_100071110 Ga0070670_1000711102 175
103 3300005331 Ga0070670_100808198 Ga0070670_1008081981 175
104 3300005333 Ga0070677_10505466 Ga0070677_105054661 175
105 3300005335 Ga0070666_10024881 Ga0070666_100248814 175
106 3300005335 Ga0070666_10034184 Ga0070666_100341842 175
107 3300005335 Ga0070666_10144792 Ga0070666_101447922 175
108 3300005336 Ga0070680_100001788 Ga0070680_1000017886 175
109 3300005336 Ga0070680_100109961 Ga0070680_1001099614 175
110 3300005336 Ga0070680_100337564 Ga0070680_1003375642 175
111 3300005337 Ga0070682_100223118 Ga0070682_1002231182 175
112 3300005339 Ga0070660_100082325 Ga0070660_1000823252 175
113 3300005339 Ga0070660_100506599 Ga0070660_1005065991 175
114 3300005339 Ga0070660_100701551 Ga0070660_1007015511 175
115 3300005344 Ga0070661_100014392 Ga0070661_1000143923 175
116 3300005345 Ga0070692_10200606 Ga0070692_102006062 175
117 3300005347 Ga0070668_100036043 Ga0070668_1000360432 175
118 3300005347 Ga0070668_100050986 Ga0070668_1000509862 175
119 3300005347 Ga0070668_100060072 Ga0070668_1000600723 175
120 3300005347 Ga0070668_100112918 Ga0070668_1001129182 175
121 3300005353 Ga0070669_100000471 Ga0070669_1000004712 175
122 3300005353 Ga0070669_100001205 Ga0070669_10000120511 175
123 3300005353 Ga0070669_100016003 Ga0070669_1000160034 175
124 3300005353 Ga0070669_100162585 Ga0070669_1001625852 175
125 3300005354 Ga0070675_100792640 Ga0070675_1007926402 175
126 3300005355 Ga0070671_100000050 Ga0070671_10000005056 175
127 3300005355 Ga0070671_100000625 Ga0070671_10000062525 175
128 3300005355 Ga0070671_100084467 Ga0070671_1000844672 175
129 3300005355 Ga0070671_100187403 Ga0070671_1001874032 175
130 3300005366 Ga0070659_100103131 Ga0070659_1001031313 175
131 3300005367 Ga0070667_100000678 Ga0070667_10000067817 175
132 3300005367 Ga0070667_100001208 Ga0070667_10000120816 175
133 3300005367 Ga0070667_100012880 Ga0070667_1000128803 175
134 3300005367 Ga0070667_100042618 Ga0070667_1000426182 175
135 3300005455 Ga0070663_100008975 Ga0070663_1000089754 175
136 3300005455 Ga0070663_100139755 Ga0070663_1001397552 175
137 3300005457 Ga0070662_100005498 Ga0070662_1000054984 175
138 3300005457 Ga0070662_100027278 Ga0070662_1000272782 175
139 3300005457 Ga0070662_100056217 Ga0070662_1000562172 175
140 3300005458 Ga0070681_10153876 Ga0070681_101538762 175
141 3300005467 Ga0070706_101016656 Ga0070706_1010166561 175
142 3300005530 Ga0070679_100019861 Ga0070679_1000198616 175
143 3300005530 Ga0070679_100272781 Ga0070679_1002727812 175
144 3300005535 Ga0070684_100406942 Ga0070684_1004069422 175
145 3300005535 Ga0070684_100693853 Ga0070684_1006938532 175
146 3300005539 Ga0068853_100014555 Ga0068853_1000145552 175
147 3300005539 Ga0068853_100034174 Ga0068853_1000341742 175
148 3300005543 Ga0070672_100946434 Ga0070672_1009464341 175
149 3300005544 Ga0070686_100607346 Ga0070686_1006073462 175
150 3300005548 Ga0070665_100000558 Ga0070665_10000055839 175
151 3300005548 Ga0070665_100006055 Ga0070665_1000060555 175
152 3300005548 Ga0070665_100019405 Ga0070665_1000194055 175
153 3300005548 Ga0070665_100034554 Ga0070665_1000345542 175
154 3300005548 Ga0070665_100225525 Ga0070665_1002255252 175
155 3300005563 Ga0068855_100001903 Ga0068855_1000019035 175
156 3300005563 Ga0068855_100058647 Ga0068855_1000586473 175
157 3300005563 Ga0068855_100093044 Ga0068855_1000930442 175
158 3300005563 Ga0068855_100245608 Ga0068855_1002456082 175
159 3300005563 Ga0068855_100502710 Ga0068855_1005027102 175
160 3300005564 Ga0070664_100009523 Ga0070664_1000095235 175
161 3300005577 Ga0068857_100036477 Ga0068857_1000364772 175
162 3300005578 Ga0068854_100009070 Ga0068854_1000090706 175
163 3300005578 Ga0068854_100020802 Ga0068854_1000208022 175
164 3300005578 Ga0068854_100105359 Ga0068854_1001053593 175
165 3300005614 Ga0068856_100000870 Ga0068856_10000087012 175
166 3300005614 Ga0068856_100207206 Ga0068856_1002072062 175
167 3300005614 Ga0068856_101081208 Ga0068856_1010812082 175
168 3300005616 Ga0068852_100001372 Ga0068852_10000137213 175
169 3300005616 Ga0068852_100374625 Ga0068852_1003746253 175
170 3300005617 Ga0068859_100051803 Ga0068859_1000518032 175
171 3300005617 Ga0068859_100534623 Ga0068859_1005346232 175
172 3300005617 Ga0068859_100808343 Ga0068859_1008083432 175
173 3300005618 Ga0068864_100197223 Ga0068864_1001972232 175
174 3300005618 Ga0068864_100306012 Ga0068864_1003060122 175
175 3300005841 Ga0068863_100000072 Ga0068863_10000007272 175
176 3300005841 Ga0068863_100025858 Ga0068863_1000258585 175
177 3300005842 Ga0068858_100003271 Ga0068858_1000032717 175
178 3300005842 Ga0068858_100018376 Ga0068858_1000183765 175
179 3300005842 Ga0068858_100088476 Ga0068858_1000884762 175
180 3300005842 Ga0068858_100102093 Ga0068858_1001020933 175
181 3300005842 Ga0068858_100133357 Ga0068858_1001333572 175
182 3300005843 Ga0068860_100000247 Ga0068860_10000024726 175
183 3300005843 Ga0068860_100008233 Ga0068860_1000082332 175
184 3300005843 Ga0068860_100011513 Ga0068860_1000115135 175
185 3300005843 Ga0068860_100018892 Ga0068860_1000188922 175
186 3300005843 Ga0068860_100102342 Ga0068860_1001023422 175
187 3300005844 Ga0068862_100044086 Ga0068862_1000440862 175
188 3300005844 Ga0068862_100082007 Ga0068862_1000820072 175
189 3300005844 Ga0068862_100139823 Ga0068862_1001398232 175
190 3300005844 Ga0068862_100290458 Ga0068862_1002904582 175
191 3300005844 Ga0068862_100668948 Ga0068862_1006689482 175
192 3300006038 Ga0075365_10101723 Ga0075365_101017231 175
193 3300006042 Ga0075368_10000292 Ga0075368_1000029213 175
194 3300006051 Ga0075364_10019320 Ga0075364_100193203 175
195 3300006051 Ga0075364_10034976 Ga0075364_100349762 175
196 3300006051 Ga0075364_10606477 Ga0075364_106064771 175
197 3300006058 Ga0075432_10000436 Ga0075432_100004362 175
198 3300006177 Ga0075362_10006967 Ga0075362_100069671 175
199 3300006177 Ga0075362_10209634 Ga0075362_102096342 175
200 3300006178 Ga0075367_10012881 Ga0075367_100128813 175
201 3300006186 Ga0075369_10042744 Ga0075369_100427442 175
202 3300006186 Ga0075369_10055918 Ga0075369_100559182 175
203 3300006186 Ga0075369_10082625 Ga0075369_100826252 175
204 3300006195 Ga0075366_10004373 Ga0075366_100043735 175
205 3300006195 Ga0075366_10016974 Ga0075366_100169742 175
206 3300006195 Ga0075366_10173386 Ga0075366_101733861 175
207 3300006237 Ga0097621_100180290 Ga0097621_1001802902 175
208 3300006353 Ga0075370_10002239 Ga0075370_100022395 175
209 3300006353 Ga0075370_10021621 Ga0075370_100216212 175
210 3300006353 Ga0075370_10049133 Ga0075370_100491332 175
211 3300006353 Ga0075370_10154574 Ga0075370_101545742 175
212 3300006353 Ga0075370_10444934 Ga0075370_104449342 175
213 3300006931 Ga0097620_100051804 Ga0097620_1000518042 175
214 3300006931 Ga0097620_100534535 Ga0097620_1005345352 175
215 3300006931 Ga0097620_100808271 Ga0097620_1008082712 175
216 3300006946 Ga0079104_1010389 Ga0079104_10103895 175
217 3300009011 Ga0105251_10001990 Ga0105251_1000199011 175
218 3300009092 Ga0105250_10022700 Ga0105250_100227002 175
219 3300009093 Ga0105240_10002582 Ga0105240_1000258216 175
220 3300009093 Ga0105240_10291207 Ga0105240_102912072 175
221 3300009101 Ga0105247_10026870 Ga0105247_100268703 175
222 3300009101 Ga0105247_10070349 Ga0105247_100703493 175
223 3300009101 Ga0105247_10113180 Ga0105247_101131802 175
224 3300009101 Ga0105247_10120750 Ga0105247_101207502 175
225 3300009148 Ga0105243_10235024 Ga0105243_102350242 175
226 3300009174 Ga0105241_10097336 Ga0105241_100973362 175
227 3300009177 Ga0105248_10017441 Ga0105248_100174412 175
228 3300009177 Ga0105248_10026372 Ga0105248_100263725 175
229 3300009177 Ga0105248_10382066 Ga0105248_103820662 175
230 3300009177 Ga0105248_10586921 Ga0105248_105869212 175
231 3300009551 Ga0105238_10028775 Ga0105238_100287752 175
232 3300009553 Ga0105249_10570566 Ga0105249_105705662 175
233 3300009553 Ga0105249_10777563 Ga0105249_107775632 175
234 3300010375 Ga0105239_11273852 Ga0105239_112738522 175
235 3300011119 Ga0105246_10000124 Ga0105246_1000012430 175
236 3300013100 Ga0157373_10004044 Ga0157373_1000404410 175
237 3300013102 Ga0157371_10001205 Ga0157371_100012053 175
238 3300013102 Ga0157371_10079682 Ga0157371_100796823 175
239 3300013102 Ga0157371_10193863 Ga0157371_101938632 175
240 3300013102 Ga0157371_10224614 Ga0157371_102246142 175
241 3300013104 Ga0157370_10028075 Ga0157370_100280754 175
242 3300013104 Ga0157370_10549197 Ga0157370_105491971 175
243 3300013105 Ga0157369_10001195 Ga0157369_1000119513 175
244 3300013105 Ga0157369_10249454 Ga0157369_102494542 175
245 3300013306 Ga0163162_10020601 Ga0163162_100206012 175
246 3300013306 Ga0163162_10092129 Ga0163162_100921294 175
247 3300013306 Ga0163162_10178945 Ga0163162_101789452 175
248 3300013307 Ga0157372_10003911 Ga0157372_100039118 175
249 3300014326 Ga0157380_10030824 Ga0157380_100308246 175
250 3300014326 Ga0157380_10262579 Ga0157380_102625792 175
251 3300014326 Ga0157380_10528253 Ga0157380_105282532 175
252 3300014745 Ga0157377_11162775 Ga0157377_111627751 175
253 3300014968 Ga0157379_10491053 Ga0157379_104910532 175
254 3300017792 Ga0163161_10001409 Ga0163161_1000140915 175
255 3300017792 Ga0163161_10655226 Ga0163161_106552262 175
256 3300025298 Ga0209050_1000265 Ga0209050_100026589 175
257 3300025711 Ga0207696_1017291 Ga0207696_10172913 175
258 3300025735 Ga0207713_1003924 Ga0207713_10039247 175
259 3300025900 Ga0207710_10049716 Ga0207710_100497162 175
260 3300025903 Ga0207680_10086482 Ga0207680_100864822 175
261 3300025903 Ga0207680_10217053 Ga0207680_102170532 175
262 3300025903 Ga0207680_10335954 Ga0207680_103359542 175
263 3300025904 Ga0207647_10074695 Ga0207647_100746952 175
264 3300025904 Ga0207647_10081880 Ga0207647_100818802 175
265 3300025907 Ga0207645_10096010 Ga0207645_100960102 175
266 3300025909 Ga0207705_10000075 Ga0207705_10000075107 175
267 3300025909 Ga0207705_10009626 Ga0207705_100096262 175
268 3300025909 Ga0207705_10035083 Ga0207705_100350833 175
269 3300025909 Ga0207705_10217584 Ga0207705_102175842 175
270 3300025909 Ga0207705_10253100 Ga0207705_102531002 175
271 3300025909 Ga0207705_10740224 Ga0207705_107402241 175
272 3300025910 Ga0207684_10812551 Ga0207684_108125512 175
273 3300025912 Ga0207707_10098380 Ga0207707_100983802 175
274 3300025913 Ga0207695_10002012 Ga0207695_1000201222 175
275 3300025917 Ga0207660_10555100 Ga0207660_105551002 175
276 3300025917 Ga0207660_10666368 Ga0207660_106663681 175
277 3300025918 Ga0207662_10350919 Ga0207662_103509192 175
278 3300025919 Ga0207657_10000104 Ga0207657_1000010461 175
279 3300025919 Ga0207657_10024189 Ga0207657_100241898 175
280 3300025920 Ga0207649_10065015 Ga0207649_100650152 175
281 3300025921 Ga0207652_10013974 Ga0207652_100139745 175
282 3300025921 Ga0207652_10032761 Ga0207652_100327614 175
283 3300025921 Ga0207652_10042547 Ga0207652_100425473 175
284 3300025923 Ga0207681_10000090 Ga0207681_1000009065 175
285 3300025923 Ga0207681_10000174 Ga0207681_1000017427 175
286 3300025923 Ga0207681_10002327 Ga0207681_100023274 175
287 3300025923 Ga0207681_10060023 Ga0207681_100600232 175
288 3300025924 Ga0207694_10011099 Ga0207694_100110993 175
289 3300025925 Ga0207650_10013354 Ga0207650_100133544 175
290 3300025925 Ga0207650_10677770 Ga0207650_106777701 175
291 3300025931 Ga0207644_10000003 Ga0207644_1000000356 175
292 3300025931 Ga0207644_10034952 Ga0207644_100349522 175
293 3300025931 Ga0207644_10048047 Ga0207644_100480472 175
294 3300025931 Ga0207644_10118080 Ga0207644_101180803 175
295 3300025932 Ga0207690_10000231 Ga0207690_1000023139 175
296 3300025932 Ga0207690_10099399 Ga0207690_100993992 175
297 3300025933 Ga0207706_10001100 Ga0207706_1000110019 175
298 3300025933 Ga0207706_10002662 Ga0207706_100026624 175
299 3300025933 Ga0207706_10023678 Ga0207706_100236783 175
300 3300025940 Ga0207691_10639727 Ga0207691_106397272 175
301 3300025941 Ga0207711_10014272 Ga0207711_100142723 175
302 3300025941 Ga0207711_10246309 Ga0207711_102463092 175
303 3300025941 Ga0207711_10378569 Ga0207711_103785692 175
304 3300025944 Ga0207661_10132143 Ga0207661_101321432 175
305 3300025944 Ga0207661_10328521 Ga0207661_103285212 175
306 3300025944 Ga0207661_10511926 Ga0207661_105119262 175
307 3300025945 Ga0207679_10072115 Ga0207679_100721152 175
308 3300025945 Ga0207679_10134819 Ga0207679_101348192 175
309 3300025949 Ga0207667_10009625 Ga0207667_100096254 175
310 3300025949 Ga0207667_10016336 Ga0207667_100163366 175
311 3300025949 Ga0207667_10071502 Ga0207667_100715022 175
312 3300025949 Ga0207667_10075386 Ga0207667_100753862 175
313 3300025949 Ga0207667_10086389 Ga0207667_100863892 175
314 3300025949 Ga0207667_10319211 Ga0207667_103192112 175
315 3300025961 Ga0207712_10362754 Ga0207712_103627542 175
316 3300025961 Ga0207712_10497784 Ga0207712_104977842 175
317 3300025972 Ga0207668_10002249 Ga0207668_1000224910 175
318 3300025972 Ga0207668_10011435 Ga0207668_100114354 175
319 3300025972 Ga0207668_10024971 Ga0207668_100249713 175
320 3300025972 Ga0207668_10200750 Ga0207668_102007501 175
321 3300025972 Ga0207668_10513176 Ga0207668_105131762 175
322 3300025981 Ga0207640_10000662 Ga0207640_1000066213 175
323 3300025981 Ga0207640_10009111 Ga0207640_100091116 175
324 3300025981 Ga0207640_10139076 Ga0207640_101390763 175
325 3300025981 Ga0207640_10498252 Ga0207640_104982522 175
326 3300025986 Ga0207658_10003035 Ga0207658_100030355 175
327 3300025986 Ga0207658_10003439 Ga0207658_100034392 175
328 3300025986 Ga0207658_10008982 Ga0207658_100089823 175
329 3300025986 Ga0207658_10012540 Ga0207658_100125403 175
330 3300025986 Ga0207658_10480959 Ga0207658_104809592 175
331 3300026035 Ga0207703_10000733 Ga0207703_100007338 175
332 3300026035 Ga0207703_10008100 Ga0207703_100081003 175
333 3300026035 Ga0207703_10124624 Ga0207703_101246243 175
334 3300026041 Ga0207639_11150406 Ga0207639_111504062 175
335 3300026067 Ga0207678_10021284 Ga0207678_100212844 175
336 3300026075 Ga0207708_10773143 Ga0207708_107731431 175
337 3300026078 Ga0207702_10003595 Ga0207702_100035959 175
338 3300026078 Ga0207702_10065696 Ga0207702_100656965 175
339 3300026088 Ga0207641_10000084 Ga0207641_1000008473 175
340 3300026088 Ga0207641_10066188 Ga0207641_100661883 175
341 3300026088 Ga0207641_11502824 Ga0207641_115028241 175
342 3300026095 Ga0207676_10017333 Ga0207676_100173333 175
343 3300026095 Ga0207676_10065282 Ga0207676_100652823 175
344 3300026116 Ga0207674_10016257 Ga0207674_100162573 175
345 3300026116 Ga0207674_10307176 Ga0207674_103071763 175
346 3300026116 Ga0207674_10598947 Ga0207674_105989472 175
347 3300026142 Ga0207698_10000005 Ga0207698_10000005139 175
348 3300026142 Ga0207698_10002889 Ga0207698_100028896 175
349 3300026142 Ga0207698_10061022 Ga0207698_100610222 175
350 3300026142 Ga0207698_10535593 Ga0207698_105355932 175
351 3300026142 Ga0207698_10927297 Ga0207698_109272972 175
352 3300026142 Ga0207698_11805028 Ga0207698_118050281 175
353 3300027111 Ga0209281_1014327 Ga0209281_10143272 175
354 3300027866 Ga0209813_10000236 Ga0209813_100002364 175
355 3300027876 Ga0209974_10035384 Ga0209974_100353841 175
356 3300027876 Ga0209974_10052386 Ga0209974_100523862 175
357 3300027907 Ga0207428_10030767 Ga0207428_100307674 175
358 3300028379 Ga0268266_10001483 Ga0268266_1000148312 175
359 3300028379 Ga0268266_10011220 Ga0268266_100112205 175
360 3300028379 Ga0268266_10012382 Ga0268266_100123825 175
361 3300028379 Ga0268266_10316978 Ga0268266_103169781 175
362 3300028379 Ga0268266_10417502 Ga0268266_104175022 175
363 3300028379 Ga0268266_10578678 Ga0268266_105786781 175
364 3300028380 Ga0268265_10002095 Ga0268265_1000209514 175
365 3300028380 Ga0268265_10004649 Ga0268265_100046493 175
366 3300028380 Ga0268265_10144312 Ga0268265_101443122 175
367 3300028380 Ga0268265_10468352 Ga0268265_104683521 175
368 3300028380 Ga0268265_11306373 Ga0268265_113063732 175
369 3300028381 Ga0268264_10000253 Ga0268264_1000025340 175
370 3300028381 Ga0268264_10051400 Ga0268264_100514003 175
371 3300028381 Ga0268264_10076985 Ga0268264_100769853 175
372 3300031251 Ga0265327_10048730 Ga0265327_100487302 175
373 3300031548 Ga0307408_100311442 Ga0307408_1003114422 175
374 3300031691 Ga0316579_10084735 Ga0316579_100847352 175
375 3300031824 Ga0307413_10070531 Ga0307413_100705312 175
376 3300031852 Ga0307410_10765566 Ga0307410_107655661 175
377 3300031901 Ga0307406_10390631 Ga0307406_103906312 175
378 3300031911 Ga0307412_10053491 Ga0307412_100534912 175
379 3300031995 Ga0307409_100428792 Ga0307409_1004287922 175
380 3300031995 Ga0307409_100787164 Ga0307409_1007871642 175
381 3300032002 Ga0307416_100295166 Ga0307416_1002951662 175
382 3300032002 Ga0307416_100690523 Ga0307416_1006905232 175
383 3300032004 Ga0307414_10002468 Ga0307414_100024688 175
384 3300032004 Ga0307414_10009523 Ga0307414_100095232 175
385 3300032004 Ga0307414_10037239 Ga0307414_100372393 175
386 3300032004 Ga0307414_10619203 Ga0307414_106192031 175
387 3300032005 Ga0307411_10378313 Ga0307411_103783132 175
388 3300032005 Ga0307411_10457533 Ga0307411_104575331 175
389 3300032126 Ga0307415_100127752 Ga0307415_1001277522 175
390 3300032126 Ga0307415_100248861 Ga0307415_1002488611 175
391 3300032133 Ga0316583_10011128 Ga0316583_100111283 175
392 3300036647 Ga0316582_0001310 Ga0316582_0001310_1576_2103 175
393 3300036712 Ga0316584_0045647 Ga0316584_0045647_324_851 175
394 3300039438 Ga0436360_1079060 Ga0436360_1079060_573_1103 175
395 3300041456 Ga0451795_0064262 Ga0451795_0064262_50_577 175
396 3300041460 Ga0451802_0312486 Ga0451802_0312486_131_658 175
397 3300041498 Ga0451841_0408716 Ga0451841_0408716_156_683 175
398 3300041501 Ga0451845_0794105 Ga0451845_0794105_40_567 175
399 3300041512 Ga0451853_0831705 Ga0451853_0831705_864_1391 175
400 3300041512 Ga0451853_0840808 Ga0451853_0840808_44_583 175
401 3300041512 Ga0451853_0955612 Ga0451853_0955612_100_639 175
402 3300042015 Ga0439462_0003065 Ga0439462_0003065_1461_1988 175
403 3300045051 Ga0451576_0000023 Ga0451576_0000023_94451_94981 175
404 3300046453 Ga0495627_000579 Ga0495627_000579_13515_14045 175
405 3300046460 Ga0495638_0078950 Ga0495638_0078950_1217_1744 175
406 3300046471 Ga0495650_0001710 Ga0495650_0001710_12636_13166 175
407 3300046500 Ga0495596_0007073 Ga0495596_0007073_1462_1989 175
408 3300046512 Ga0495610_0000018 Ga0495610_0000018_196652_197182 175
409 3300046512 Ga0495610_0009278 Ga0495610_0009278_3102_3632 175
410 3300046512 Ga0495610_0010929 Ga0495610_0010929_2187_2714 175
411 3300046512 Ga0495610_0098563 Ga0495610_0098563_522_1049 175
412 3300046512 Ga0495610_0141722 Ga0495610_0141722_142_669 175
413 3300046515 Ga0495620_0007194 Ga0495620_0007194_2896_3426 175
414 3300046519 Ga0495632_0001865 Ga0495632_0001865_7974_8504 175
415 3300046522 Ga0495643_0000132 Ga0495643_0000132_92950_93480 175
416 3300046522 Ga0495643_0147246 Ga0495643_0147246_170_697 175
417 3300046522 Ga0495643_0228606 Ga0495643_0228606_24_551 175
418 3300046530 Ga0495654_0029673 Ga0495654_0029673_1091_1621 175
419 3300046530 Ga0495654_0075048 Ga0495654_0075048_545_1072 175
420 3300046537 Ga0495598_0083295 Ga0495598_0083295_47_574 175
421 3300046539 Ga0495621_0101093 Ga0495621_0101093_107_634 175
422 3300046542 Ga0495597_0164157 Ga0495597_0164157_92_619 175
423 3300046616 Ga0495668_0170905 Ga0495668_0170905_626_1153 175
424 3300046616 Ga0495668_0282347 Ga0495668_0282347_41_568 175
425 3300046660 Ga0495625_0017416 Ga0495625_0017416_1339_1866 175
426 3300046810 Ga0495660_0310149 Ga0495660_0310149_126_653 175
427 3300047470 Ga0495681_0000040 Ga0495681_0000040_15379_15909 175
428 3300048091 Ga0495626_0002004 Ga0495626_0002004_11648_12175 175
429 3300048903 Ga0496100_0033899 Ga0496100_0033899_2598_3125 175
430 3300048903 Ga0496100_0040553 Ga0496100_0040553_2320_2862 175
431 3300048904 Ga0496101_0011210 Ga0496101_0011210_174_701 175
432 3300048904 Ga0496101_0038744 Ga0496101_0038744_1100_1642 175
433 3300048905 Ga0496102_0004232 Ga0496102_0004232_7321_7848 175
434 3300048905 Ga0496102_0115943 Ga0496102_0115943_1712_2254 175
435 3300048906 Ga0496103_0051735 Ga0496103_0051735_1904_2431 175
436 3300048906 Ga0496103_0137851 Ga0496103_0137851_26_553 175
437 3300048907 Ga0496104_0012313 Ga0496104_0012313_6019_6546 175
438 3300048907 Ga0496104_0030216 Ga0496104_0030216_3796_4323 175
439 3300048907 Ga0496104_0064732 Ga0496104_0064732_1704_2246 175
440 3300048908 Ga0496105_0000395 Ga0496105_0000395_5995_6522 175
441 3300048908 Ga0496105_0002963 Ga0496105_0002963_2593_3120 175
442 3300048908 Ga0496105_0427558 Ga0496105_0427558_28_570 175
443 3300048909 Ga0496106_0022674 Ga0496106_0022674_2666_3208 175
444 3300048910 Ga0496107_0046039 Ga0496107_0046039_1765_2307 175
445 3300048911 Ga0496108_0073518 Ga0496108_0073518_2179_2706 175
446 3300048911 Ga0496108_0085919 Ga0496108_0085919_306_848 175
447 3300048912 Ga0496109_0065383 Ga0496109_0065383_2559_3101 175
448 3300048913 Ga0496110_0377638 Ga0496110_0377638_344_886 175
449 3300048914 Ga0496111_0120428 Ga0496111_0120428_692_1234 175
450 3300048914 Ga0496111_0545490 Ga0496111_0545490_170_712 175
451 3300048915 Ga0496112_0011449 Ga0496112_0011449_5402_5929 175
452 3300048915 Ga0496112_0042071 Ga0496112_0042071_1724_2266 175
453 3300048916 Ga0496113_0014307 Ga0496113_0014307_3438_3965 175
454 3300048917 Ga0496114_0015293 Ga0496114_0015293_3086_3628 175
455 3300048917 Ga0496114_1063443 Ga0496114_1063443_131_658 175
456 3300048919 Ga0496116_0000017 Ga0496116_0000017_111451_111978 175
457 3300048919 Ga0496116_0145137 Ga0496116_0145137_621_1148 175
458 3300048920 Ga0496117_0010865 Ga0496117_0010865_7573_8100 175
459 3300048920 Ga0496117_0027332 Ga0496117_0027332_1730_2257 175
460 3300048920 Ga0496117_0228872 Ga0496117_0228872_191_718 175
461 3300048920 Ga0496117_0327767 Ga0496117_0327767_166_693 175
462 3300048921 Ga0496118_0009007 Ga0496118_0009007_6039_6566 175
463 3300048921 Ga0496118_0025496 Ga0496118_0025496_3647_4174 175
464 3300048921 Ga0496118_0026497 Ga0496118_0026497_4124_4651 175
465 3300048921 Ga0496118_0108550 Ga0496118_0108550_1177_1704 175
466 3300048922 Ga0496119_0000040 Ga0496119_0000040_199234_199761 175
467 3300048924 Ga0496121_0000070 Ga0496121_0000070_185756_186295 175
468 3300048924 Ga0496121_0000136 Ga0496121_0000136_120799_121326 175
469 3300048924 Ga0496121_0007195 Ga0496121_0007195_1883_2410 175
470 3300048924 Ga0496121_0037153 Ga0496121_0037153_2924_3451 175
471 3300048925 Ga0496122_0002119 Ga0496122_0002119_25282_25809 175
472 3300048925 Ga0496122_0077714 Ga0496122_0077714_852_1379 175
473 3300048926 Ga0496123_0001873 Ga0496123_0001873_25734_26261 175
474 3300048926 Ga0496123_0003210 Ga0496123_0003210_15937_16464 175
475 3300048926 Ga0496123_0061823 Ga0496123_0061823_1439_1966 175
476 3300048927 Ga0496124_0002485 Ga0496124_0002485_16299_16826 175
477 3300048927 Ga0496124_0005357 Ga0496124_0005357_13228_13755 175
478 3300048927 Ga0496124_0009214 Ga0496124_0009214_2870_3397 175
479 3300048927 Ga0496124_0142993 Ga0496124_0142993_1118_1645 175
480 3300048927 Ga0496124_0162443 Ga0496124_0162443_86_613 175
481 3300048927 Ga0496124_0643496 Ga0496124_0643496_136_663 175
482 3300048928 Ga0496125_0023545 Ga0496125_0023545_3867_4394 175
483 3300048928 Ga0496125_0041597 Ga0496125_0041597_726_1253 175
484 3300048928 Ga0496125_0225684 Ga0496125_0225684_167_694 175
485 3300048928 Ga0496125_0322707 Ga0496125_0322707_295_822 175
486 3300048929 Ga0496126_0000044 Ga0496126_0000044_128515_129042 175
487 3300048929 Ga0496126_0000359 Ga0496126_0000359_49389_49916 175
488 3300048929 Ga0496126_0032469 Ga0496126_0032469_1231_1758 175
489 3300048929 Ga0496126_0040691 Ga0496126_0040691_2510_3052 175
490 3300048929 Ga0496126_0227853 Ga0496126_0227853_878_1405 175
491 3300049460 Ga0495682_0137448 Ga0495682_0137448_274_813 175
492 3300049571 Ga0501034_0104217 Ga0501034_0104217_1286_1840 175
493 3300049572 Ga0501036_1123480 Ga0501036_1123480_48_575 175
494 3300049573 Ga0501037_0219646 Ga0501037_0219646_316_843 175
495 3300049575 Ga0501039_0371494 Ga0501039_0371494_299_826 175
496 3300049581 Ga0501047_0668492 Ga0501047_0668492_245_772 175
497 3300049581 Ga0501047_1195802 Ga0501047_1195802_23_550 175
498 3300049586 Ga0501070_0196947 Ga0501070_0196947_238_765 175
499 3300049589 Ga0501073_0769777 Ga0501073_0769777_56_583 175
500 3300049590 Ga0501074_0441501 Ga0501074_0441501_339_866 175
501 3300049742 Ga0501080_0690706 Ga0501080_0690706_206_733 175
502 3300049823 Ga0501044_0000346 Ga0501044_0000346_40029_40556 175
503 3300049823 Ga0501044_0144438 Ga0501044_0144438_220_747 175
504 3300049823 Ga0501044_0335121 Ga0501044_0335121_874_1401 175
505 3300050489 nmdc:mga03683_116_c1 nmdc:mga03683_116_c1_4439_4966 175
506 3300050489 nmdc:mga03683_183656_c1 nmdc:mga03683_183656_c1_120_647 175
507 3300050489 nmdc:mga03683_50052_c1 nmdc:mga03683_50052_c1_58_585 175
508 3300050490 nmdc:mga03n38_38140_c1 nmdc:mga03n38_38140_c1_797_1324 175
509 3300050491 nmdc:mga00v17_102033_c1 nmdc:mga00v17_102033_c1_312_839 175
510 3300050491 nmdc:mga00v17_2760_c1 nmdc:mga00v17_2760_c1_8020_8547 175
511 3300050491 nmdc:mga00v17_5001_c1 nmdc:mga00v17_5001_c1_4565_5092 175
512 3300050492 nmdc:mga0yw44_272659_c1 nmdc:mga0yw44_272659_c1_414_941 175
513 3300050493 nmdc:mga0k408_24374_c1 nmdc:mga0k408_24374_c1_1183_1710 175
514 3300050493 nmdc:mga0k408_2554_c1 nmdc:mga0k408_2554_c1_780_1307 175
515 3300050494 nmdc:mga06z11_1105_c1 nmdc:mga06z11_1105_c1_2923_3450 175
516 3300050495 nmdc:mga04h51_202_c1 nmdc:mga04h51_202_c1_3699_4226 175
517 3300050496 nmdc:mga07m45_1346_c1 nmdc:mga07m45_1346_c1_2398_2925 175
518 3300050496 nmdc:mga07m45_224387_c1 nmdc:mga07m45_224387_c1_68_595 175
519 3300050496 nmdc:mga07m45_26885_c1 nmdc:mga07m45_26885_c1_453_992 175
520 3300050496 nmdc:mga07m45_312158_c1 nmdc:mga07m45_312158_c1_243_770 175
521 3300050496 nmdc:mga07m45_426748_c1 nmdc:mga07m45_426748_c1_80_607 175
522 3300050496 nmdc:mga07m45_530038_c1 nmdc:mga07m45_530038_c1_73_612 175
523 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_15695_16222 175
524 3300050496 nmdc:mga07m45_73257_c1 nmdc:mga07m45_73257_c1_258_785 175
525 3300050496 nmdc:mga07m45_75151_c1 nmdc:mga07m45_75151_c1_631_1158 175
526 3300050516 nmdc:mga0sz30_24979_c1 nmdc:mga0sz30_24979_c1_249_776 175
527 3300050516 nmdc:mga0sz30_58236_c2 nmdc:mga0sz30_58236_c2_720_1247 175
528 3300050516 nmdc:mga0sz30_660_c1 nmdc:mga0sz30_660_c1_8170_8697 175
529 3300050516 nmdc:mga0sz30_74714_c1 nmdc:mga0sz30_74714_c1_635_1162 175
530 3300053087 Ga0500643_014843 Ga0500643_014843_1558_2085 175
531 3300053094 Ga0500566_0071940 Ga0500566_0071940_461_988 175
532 3300053118 Ga0500594_0173361 Ga0500594_0173361_21_581 175
533 3300053121 Ga0500607_000048 Ga0500607_000048_75204_75731 175
534 3300053121 Ga0500607_000162 Ga0500607_000162_5312_5839 175
535 3300053122 Ga0500608_002538 Ga0500608_002538_6089_6616 175
536 3300053125 Ga0500618_001530 Ga0500618_001530_1745_2284 175
537 3300053130 Ga0500642_0094660 Ga0500642_0094660_666_1193 175
538 3300053136 Ga0500559_0000897 Ga0500559_0000897_15942_16469 175
539 3300053136 Ga0500559_0011336 Ga0500559_0011336_1973_2500 175
540 3300053136 Ga0500559_0022855 Ga0500559_0022855_1601_2128 175
541 3300053138 Ga0500564_000591 Ga0500564_000591_4775_5302 175
542 3300053148 Ga0500590_058608 Ga0500590_058608_166_693 175
543 3300053153 Ga0500616_0005248 Ga0500616_0005248_5453_5980 175
544 3300053156 Ga0500622_0000491 Ga0500622_0000491_31016_31543 175
545 3300053156 Ga0500622_0055421 Ga0500622_0055421_1095_1628 175
546 3300053729 Ga0500625_000010 Ga0500625_000010_115395_115955 175
547 3300053730 Ga0500645_003073 Ga0500645_003073_1658_2185 175
548 3300053730 Ga0500645_069864 Ga0500645_069864_185_712 175
549 3300059643 Ga0587072_055443 Ga0587072_055443_172_699 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

26

169

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9413 2 165
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9345 2 167
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9079 2 167
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9077 7 175
2f7y-assembly1.cif.gz_B crystal structure of molybdenum cofactor biosynthesis protein mog from shewanella oneidensis 0.9061 14 145
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9374 2 167 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.924 10 153 3.40.980.10
1uiyA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9216 55 78 3.90.226.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9175 7 172 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9103 2 167 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A845AIF6-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.973 1 175 GO:0005829
GO:0006777
AF-A0A1X7GPE2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9707 10 175 GO:0005829
GO:0006777
AF-A0A017HJD4-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9707 2 174 GO:0005829
GO:0006777
AF-A0A520XJK7-F1-model_v4 deleted 0.9705 2 174
AF-A0A2E0U6B2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9702 2 175 GO:0005829
GO:0006777

Feature Viewer

pLDDT pTM Quality
87.24 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map