F462421

General Info

Members Datasets Scaffolds Average Seq Length
549 435 1098 155

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0370728|Ga0496122_0370728_71_571
Length 166
Sequence MRGQDRLRLGLTDRGTALGAALAGLIVFACGALSQDASPIQIVPRVTGEAAPMSEVPVPALARPVVDDVRRMRNYPEQPPIIPHAIDGYQLTVNTNRCLDCHKREFTEGSGAPMISITHFQDRDGQVLSDVTPRRYFCTACHVQQTDARPLVKNLFQDANDIGPKP

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
57 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
94 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
95 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
100 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
149 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
163 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
166 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
167 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
168 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
169 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
170 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
171 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
172 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
173 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
174 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
175 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
176 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
177 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
178 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
179 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
180 2516143018 Ensifer sp. BR816 Isolate Nodule
181 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
182 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
183 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
184 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
185 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
186 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
187 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
188 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
189 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
190 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
191 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
192 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
193 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
194 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
195 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
196 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
197 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
198 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
199 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
200 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
201 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
202 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
203 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
204 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
205 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
206 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
207 2643221557 Ensifer sp. Root558 Isolate Unclassified
208 2643221582 Rhizobium sp. Root651 Isolate Unclassified
209 2643221599 Rhizobium sp. Root708 Isolate Unclassified
210 2643221607 Rhizobium sp. Root73 Isolate Unclassified
211 2643221610 Ensifer sp. Root74 Isolate Unclassified
212 2643221618 Ensifer sp. Root231 Isolate Unclassified
213 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
214 2643221626 Ensifer sp. Root31 Isolate Unclassified
215 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
216 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
217 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
218 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
219 2643221655 Ensifer sp. Root1252 Isolate Unclassified
220 2643221659 Ensifer sp. Root127 Isolate Unclassified
221 2643221668 Ensifer sp. Root423 Isolate Unclassified
222 2643221675 Ensifer sp. Root1298 Isolate Unclassified
223 2643221680 Ensifer sp. Root1312 Isolate Unclassified
224 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
225 2643221688 Rhizobium sp. Root482 Isolate Unclassified
226 2643221698 Ensifer sp. Root142 Isolate Unclassified
227 2643221712 Ensifer sp. Root258 Isolate Unclassified
228 2643221718 Rhizobium sp. Root268 Isolate Unclassified
229 2643221723 Ensifer sp. Root278 Isolate Unclassified
230 2643221726 Ensifer sp. Root954 Isolate Unclassified
231 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
232 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
233 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
234 2738543024 Aminobacter sp. AP02 Isolate Unclassified
235 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
236 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
237 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
238 2791355261 Rhizobium sp. J15 Isolate Nodule
239 2791355263 Rhizobium chutanense C5 Isolate Nodule
240 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
241 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
242 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
243 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
244 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
245 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
246 2802429633 Rhizobium anhuiense J3 Isolate Nodule
247 2802429634 Rhizobium anhuiense S10 Isolate Nodule
248 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
249 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
250 2802429637 Rhizobium anhuiense C15 Isolate Nodule
251 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
252 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
253 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
254 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
255 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
256 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
257 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
258 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
259 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
260 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
261 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
262 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
263 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
264 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
265 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
266 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
267 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
268 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
269 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
270 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
271 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
272 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
273 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
274 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
275 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
276 2844163670 Ensifer sp. 1H6 Isolate Unclassified
277 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
278 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
279 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
280 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
281 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
282 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
283 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
284 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
285 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
286 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
287 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
288 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
289 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
290 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
291 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
292 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
293 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
294 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
295 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
296 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
297 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
298 2936381700 Rhizobium chutanense C16 Isolate Unclassified
299 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
300 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
301 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
302 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
303 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
304 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
305 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
306 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
307 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
308 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
309 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
310 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
311 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
312 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
313 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
314 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
315 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
316 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
317 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
318 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
319 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
320 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
321 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
322 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
323 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
324 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
325 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
326 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
327 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
328 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
329 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
330 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
331 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
332 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
333 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
334 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
335 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
336 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
337 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
338 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
339 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
340 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
341 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
342 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
343 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
344 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
345 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
346 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
347 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
348 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
349 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
350 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
351 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
352 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
353 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
354 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
355 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
356 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
357 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
358 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
359 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
360 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
361 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
362 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
363 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
364 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
365 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
366 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
367 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
368 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
369 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
370 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
371 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
372 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
373 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
374 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
375 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
376 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
377 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
378 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
379 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
380 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
381 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
382 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
383 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
384 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
385 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
386 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
387 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
388 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
389 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
390 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
391 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
392 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
393 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
394 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
395 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
396 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
397 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
398 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
399 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
400 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
401 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
402 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
403 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
404 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
405 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
406 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
407 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
408 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
409 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
410 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
411 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
412 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
413 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
414 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
415 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
416 2996887358 Rhizobium sp. R711 Isolate Nodule
417 2996893221 Rhizobium sp. R635 Isolate Nodule
418 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
419 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
420 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
421 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
422 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
423 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
424 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
425 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
426 8005258706 Rhizobium sp. R693 Isolate Nodule
427 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
428 8005321885 Rhizobium sp. R72 Isolate Nodule
429 8005382845 Rhizobium sp. R634 Isolate Nodule
430 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
431 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
432 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
433 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
434 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
435 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.36
Metatranscriptomes 0.18
Isolates 50.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 20.95
Nodule 38.98
Rhizoplane 3.46
Rhizosphere 20.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0370728 3300048925 Bacteria 739
2 JGI25158J39367_1009106 3300002739 Bacteria 1365
3 JGI25159J45721_1000046 3300002987 Bacteria 60119
4 JGI25159J45721_1000411 3300002987 Bacteria 19832
5 JGI25151J46595_10021936 3300003187 Bacteria 2661
6 JGI25153J46596_10004207 3300003215 Bacteria 7804
7 JGI25153J46596_10025985 3300003215 Bacteria 2082
8 JGI25160J50197_1000001 3300003354 Bacteria 782301
9 JGI25160J50197_1000024 3300003354 Bacteria 189526
10 JGI25161J50226_1000001 3300003374 Bacteria 655036
11 JGI25161J50226_1000086 3300003374 Bacteria 75939
12 JGI25161J50226_1000831 3300003374 Bacteria 11554
13 Ga0006562J51391_1011398 3300003578 Bacteria 5782
14 Ga0055526_1002839 3300003771 Bacteria 11442
15 Ga0055526_1004669 3300003771 Bacteria 8140
16 Ga0055526_1006971 3300003771 Bacteria 5997
17 Ga0055524_1000850 3300003775 Bacteria 20030
18 Ga0055524_1000924 3300003775 Bacteria 18904
19 Ga0055524_1007266 3300003775 Bacteria 4727
20 Ga0055524_1007969 3300003775 Bacteria 4447
21 Ga0055524_1008839 3300003775 Bacteria 4149
22 Ga0055536_1000446 3300003781 Bacteria 29033
23 Ga0055536_1002129 3300003781 Bacteria 11270
24 Ga0055528_1001807 3300003790 Bacteria 12257
25 Ga0055528_1004016 3300003790 Bacteria 7199
26 Ga0055528_1006715 3300003790 Bacteria 5185
27 Ga0055540_1003792 3300003792 Bacteria 7121
28 Ga0055540_1004533 3300003792 Bacteria 6197
29 Ga0055540_1005387 3300003792 Bacteria 5401
30 Ga0055540_1029977 3300003792 Bacteria 1268
31 Ga0055540_1034505 3300003792 Bacteria 1138
32 Ga0055531_10006243 3300003794 Bacteria 6803
33 Ga0055531_10020727 3300003794 Bacteria 2586
34 Ga0058692_1011733 3300003856 Bacteria 2104
35 Ga0058692_1012442 3300003856 Bacteria 2014
36 Ga0055543_1000003 3300004625 Bacteria 358656
37 Ga0055543_1000013 3300004625 Bacteria 179052
38 Ga0055543_1000066 3300004625 Bacteria 97081
39 Ga0065165_1000068 3300005262 Bacteria 170609
40 Ga0065165_1000098 3300005262 Bacteria 144210
41 Ga0065165_1004115 3300005262 Bacteria 9361
42 Ga0065165_1007429 3300005262 Bacteria 5384
43 Ga0065165_1008694 3300005262 Bacteria 4696
44 Ga0070683_100447360 3300005329 Bacteria 1233
45 Ga0070668_100117572 3300005347 Bacteria 2121
46 Ga0070668_100975016 3300005347 Bacteria 761
47 Ga0070675_100661044 3300005354 Bacteria 950
48 Ga0070671_100112698 3300005355 Bacteria 2285
49 Ga0070674_100635227 3300005356 Bacteria 906
50 Ga0070673_101728535 3300005364 Bacteria 592
51 Ga0070667_100424373 3300005367 Bacteria 1213
52 Ga0070681_10189247 3300005458 Bacteria 1978
53 Ga0070665_100024603 3300005548 Bacteria 6068
54 Ga0068864_101438378 3300005618 Bacteria 692
55 Ga0068863_100544969 3300005841 Bacteria 1145
56 Ga0075365_10000264 3300006038 Bacteria 17993
57 Ga0075368_10045291 3300006042 Bacteria 1737
58 Ga0075363_100179893 3300006048 Bacteria 1203
59 Ga0075363_100696829 3300006048 Bacteria 613
60 Ga0075364_10000076 3300006051 Bacteria 38765
61 Ga0075362_10000099 3300006177 Bacteria 24570
62 Ga0075367_10000716 3300006178 Bacteria 12824
63 Ga0075367_10036756 3300006178 Bacteria 2842
64 Ga0075369_10023255 3300006186 Bacteria 2561
65 Ga0075366_10001596 3300006195 Bacteria 11338
66 Ga0075370_10001804 3300006353 Bacteria 9581
67 Ga0075436_100386004 3300006914 Bacteria 1013
68 Ga0079104_1000014 3300006946 Bacteria 337362
69 Ga0079104_1006597 3300006946 Bacteria 4354
70 Ga0099826_10030091 3300006948 Bacteria 3948
71 Ga0099826_10086791 3300006948 Bacteria 1928
72 Ga0105251_10049924 3300009011 Bacteria 2000
73 Ga0105245_12057235 3300009098 Bacteria 625
74 Ga0105248_10996268 3300009177 Bacteria 947
75 Ga0105237_11304480 3300009545 Bacteria 732
76 Ga0105249_11041355 3300009553 Bacteria 888
77 Ga0105035_102994 3300009988 Bacteria 1277
78 Ga0105239_10782031 3300010375 Bacteria 1093
79 Ga0105246_10811128 3300011119 Bacteria 831
80 Ga0171463_1003 3300013249 Bacteria 695693
81 Ga0163162_10138647 3300013306 Bacteria 2544
82 Ga0157515_128610 3300013875 Bacteria 1340
83 Ga0163163_10752263 3300014325 Bacteria 1038
84 Ga0183363_1039 3300015690 Bacteria 43099
85 Ga0214542_1000006 3300021321 Bacteria 345164
86 Ga0214543_1000005 3300021327 Bacteria 454523
87 Ga0214543_1000014 3300021327 Bacteria 324986
88 Ga0228711_1001405 3300022739 Bacteria 35255
89 Ga0228711_1016339 3300022739 Bacteria 7767
90 Ga0228710_1017751 3300022740 Bacteria 6957
91 Ga0228710_1023839 3300022740 Bacteria 4367
92 Ga0209436_100014 3300025208 Bacteria 127004
93 Ga0209436_102342 3300025208 Bacteria 5789
94 Ga0207425_1022064 3300025245 Bacteria 1344
95 Ga0209129_1005362 3300025258 Bacteria 4573
96 Ga0209129_1005874 3300025258 Bacteria 4170
97 Ga0209673_1001283 3300025273 Bacteria 25740
98 Ga0209673_1003634 3300025273 Bacteria 8917
99 Ga0209673_1013505 3300025273 Bacteria 3217
100 Ga0209130_1000003 3300025284 Bacteria 677988
101 Ga0209130_1000004 3300025284 Bacteria 633436
102 Ga0209130_1000026 3300025284 Bacteria 334058
103 Ga0209676_1000837 3300025292 Bacteria 39860
104 Ga0209676_1044392 3300025292 Bacteria 1219
105 Ga0209025_1000216 3300025294 Bacteria 138307
106 Ga0209025_1012765 3300025294 Bacteria 5348
107 Ga0209025_1033437 3300025294 Bacteria 2376
108 Ga0209025_1111566 3300025294 Bacteria 839
109 Ga0209564_1000013 3300025295 Bacteria 775755
110 Ga0209564_1000831 3300025295 Bacteria 41857
111 Ga0209564_1001309 3300025295 Bacteria 26756
112 Ga0209564_1026899 3300025295 Bacteria 1885
113 Ga0209564_1031495 3300025295 Bacteria 1619
114 Ga0209758_1001818 3300025297 Bacteria 23544
115 Ga0209758_1007539 3300025297 Bacteria 7363
116 Ga0209758_1009568 3300025297 Bacteria 5990
117 Ga0209758_1013538 3300025297 Bacteria 4435
118 Ga0209050_1049937 3300025298 Bacteria 1068
119 Ga0209256_1000042 3300025299 Bacteria 341821
120 Ga0209256_1000753 3300025299 Bacteria 42143
121 Ga0209256_1001748 3300025299 Bacteria 20711
122 Ga0209256_1008359 3300025299 Bacteria 4821
123 Ga0207426_1000003 3300025302 Bacteria 1063212
124 Ga0207426_1000006 3300025302 Bacteria 1025969
125 Ga0207426_1000011 3300025302 Bacteria 791203
126 Ga0207426_1004068 3300025302 Bacteria 7380
127 Ga0207426_1087798 3300025302 Bacteria 829
128 Ga0209051_1003861 3300025303 Bacteria 9579
129 Ga0209051_1004634 3300025303 Bacteria 8370
130 Ga0209051_1004688 3300025303 Bacteria 8321
131 Ga0209051_1005600 3300025303 Bacteria 7284
132 Ga0209051_1013124 3300025303 Bacteria 3961
133 Ga0209051_1100849 3300025303 Bacteria 777
134 Ga0209257_1006075 3300025304 Bacteria 8030
135 Ga0209257_1007147 3300025304 Bacteria 6863
136 Ga0207713_1110393 3300025735 Bacteria 936
137 Ga0207707_10156539 3300025912 Bacteria 1993
138 Ga0207652_10589439 3300025921 Bacteria 998
139 Ga0207650_10838191 3300025925 Bacteria 780
140 Ga0207650_11043235 3300025925 Bacteria 696
141 Ga0207661_10123158 3300025944 Bacteria 2211
142 Ga0207678_10487984 3300026067 Bacteria 1073
143 Ga0207678_10551085 3300026067 Bacteria 1008
144 Ga0207683_10388341 3300026121 Bacteria 1283
145 Ga0209281_1000032 3300027111 Bacteria 401727
146 Ga0209281_1000682 3300027111 Bacteria 35440
147 Ga0209281_1004224 3300027111 Bacteria 4367
148 Ga0209281_1005038 3300027111 Bacteria 3764
149 Ga0209371_1001887 3300027312 Bacteria 12862
150 Ga0209371_1005637 3300027312 Bacteria 4903
151 Ga0209999_1044717 3300027543 Bacteria 832
152 Ga0209282_1000049 3300027666 Bacteria 109875
153 Ga0209282_1117264 3300027666 Bacteria 1339
154 Ga0209813_10051369 3300027866 Bacteria 1289
155 Ga0268266_10026834 3300028379 Bacteria 4901
156 Ga0268256_1005410 3300030500 Bacteria 5012
157 Ga0268256_1010572 3300030500 Bacteria 2980
158 Ga0316181_1153708 3300030744 Bacteria 1653
159 Ga0307405_10157761 3300031731 Bacteria 1603
160 Ga0307413_10777123 3300031824 Bacteria 803
161 Ga0307406_10091180 3300031901 Bacteria 2053
162 Ga0307412_10913887 3300031911 Bacteria 770
163 Ga0307412_11033151 3300031911 Bacteria 728
164 Ga0315914_1000005 3300031967 Bacteria 242195
165 Ga0315914_1023551 3300031967 Bacteria 4368
166 Ga0307414_10311333 3300032004 Bacteria 1336
167 Ga0315913_1002524 3300033430 Bacteria 21536
168 Ga0315913_1002550 3300033430 Bacteria 21476
169 Ga0315915_1000004 3300033464 Bacteria 403083
170 Ga0315915_1018160 3300033464 Bacteria 6276
171 Ga0439466_0169570 3300041411 Bacteria 666
172 Ga0439465_0005716 3300041413 Bacteria 3958
173 Ga0451807_0626715 3300041486 Bacteria 681
174 Ga0451841_0264032 3300041498 Bacteria 5991
175 Ga0451849_1134801 3300041505 Bacteria 2062
176 Ga0451855_0080692 3300041511 Bacteria 700
177 Ga0451855_0419906 3300041511 Bacteria 5423
178 Ga0451853_0910860 3300041512 Bacteria 25581
179 Ga0451853_1360564 3300041512 Bacteria 5167
180 Ga0439445_0047831 3300042004 Bacteria 1149
181 Ga0495638_0175805 3300046460 Bacteria 1225
182 Ga0495585_0070386 3300046492 Bacteria 1908
183 Ga0495606_0015680 3300046507 Bacteria 5822
184 Ga0495616_0254165 3300046513 Bacteria 754
185 Ga0495643_0102947 3300046522 Bacteria 1461
186 Ga0495648_0416662 3300046524 Bacteria 596
187 Ga0495633_0277279 3300046558 Bacteria 763
188 Ga0495656_0145228 3300046615 Bacteria 1141
189 Ga0495625_0688889 3300046660 Bacteria 605
190 Ga0495588_0109624 3300046674 Bacteria 1454
191 Ga0495649_0149797 3300046694 Bacteria 1226
192 Ga0495681_0061544 3300047470 Bacteria 1729
193 Ga0496100_0318259 3300048903 Bacteria 1168
194 Ga0496102_0127023 3300048905 Bacteria 2384
195 Ga0496103_0396711 3300048906 Bacteria 886
196 Ga0496104_0033326 3300048907 Bacteria 4797
197 Ga0496105_0008791 3300048908 Bacteria 7863
198 Ga0496105_0539492 3300048908 Bacteria 912
199 Ga0496105_0696979 3300048908 Bacteria 780
200 Ga0496106_0000095 3300048909 Bacteria 67435
201 Ga0496106_0779404 3300048909 Bacteria 759
202 Ga0496107_0810638 3300048910 Bacteria 685
203 Ga0496111_0398901 3300048914 Bacteria 1016
204 Ga0496113_0091681 3300048916 Bacteria 2343
205 Ga0496113_0467337 3300048916 Bacteria 1014
206 Ga0496114_0084002 3300048917 Bacteria 2695
207 Ga0496114_0297322 3300048917 Bacteria 1425
208 Ga0496117_0366945 3300048920 Bacteria 738
209 Ga0496118_0530097 3300048921 Bacteria 579
210 Ga0496119_0044968 3300048922 Bacteria 2773
211 Ga0496121_0023018 3300048924 Bacteria 6019
212 Ga0496121_0041249 3300048924 Bacteria 4037
213 Ga0496121_0057382 3300048924 Bacteria 3228
214 Ga0496121_0436479 3300048924 Bacteria 848
215 Ga0496122_0030550 3300048925 Bacteria 4511
216 Ga0496122_0082045 3300048925 Bacteria 2241
217 Ga0496123_0047730 3300048926 Bacteria 2889
218 Ga0496124_0011936 3300048927 Bacteria 8644
219 Ga0496124_0018584 3300048927 Bacteria 6506
220 Ga0496124_0187199 3300048927 Bacteria 1588
221 Ga0496124_0352536 3300048927 Bacteria 1040
222 Ga0496125_0020969 3300048928 Bacteria 6112
223 Ga0496125_0038179 3300048928 Bacteria 4162
224 Ga0496125_0403302 3300048928 Bacteria 798
225 Ga0496126_0073740 3300048929 Bacteria 3033
226 Ga0496126_0207064 3300048929 Bacteria 1653
227 Ga0501032_0051455 3300049569 Bacteria 2777
228 Ga0501033_0370417 3300049570 Bacteria 1001
229 Ga0501034_0009627 3300049571 Bacteria 10109
230 Ga0501036_0245093 3300049572 Bacteria 1502
231 Ga0501036_0568097 3300049572 Bacteria 942
232 Ga0501038_0024792 3300049574 Bacteria 5347
233 Ga0501038_0061675 3300049574 Bacteria 3206
234 Ga0501038_0430438 3300049574 Bacteria 1017
235 Ga0501039_0328090 3300049575 Bacteria 1203
236 Ga0501039_0900243 3300049575 Bacteria 689
237 Ga0501043_0095091 3300049579 Bacteria 2342
238 Ga0501043_0683615 3300049579 Bacteria 751
239 Ga0501046_0172633 3300049580 Bacteria 1621
240 Ga0501047_0034780 3300049581 Bacteria 4865
241 Ga0501047_0068153 3300049581 Bacteria 3428
242 Ga0501068_0228490 3300049584 Bacteria 1183
243 Ga0501072_0106345 3300049588 Bacteria 2232
244 Ga0501083_0008495 3300049744 Bacteria 7251
245 Ga0501083_0032671 3300049744 Bacteria 3567
246 Ga0501035_0060729 3300049822 Bacteria 3365
247 Ga0501044_0249704 3300049823 Bacteria 1715
248 Ga0501044_0976769 3300049823 Bacteria 719
249 Ga0501045_1376968 3300049824 Bacteria 513
250 nmdc:mga03683_178_c1 3300050489 Bacteria 21289
251 nmdc:mga03n38_115053_c1 3300050490 Bacteria 1315
252 nmdc:mga00v17_63_c1 3300050491 Bacteria 66457
253 nmdc:mga0yw44_309172_c1 3300050492 Bacteria 1060
254 nmdc:mga0yw44_641_c1 3300050492 Bacteria 12731
255 nmdc:mga0k408_4555_c1 3300050493 Bacteria 7362
256 nmdc:mga06z11_187018_c1 3300050494 Bacteria 1197
257 nmdc:mga06z11_664_c1 3300050494 Bacteria 12506
258 nmdc:mga04h51_61392_c1 3300050495 Bacteria 1289
259 nmdc:mga07m45_3057_c1 3300050496 Bacteria 7987
260 nmdc:mga07m45_344289_c1 3300050496 Bacteria 866
261 nmdc:mga08y16_307669_c1 3300050511 Bacteria 1632
262 Ga0500644_0032696 3300053088 Bacteria 1664
263 Ga0500568_0000644 3300053139 Bacteria 25194
264 Ga0500568_0033197 3300053139 Bacteria 2119
265 Ga0500568_0161931 3300053139 Bacteria 825
266 Ga0500604_0016401 3300053151 Bacteria 2040
267 Ga0500616_0004286 3300053153 Bacteria 10245
268 Ga0500622_0000228 3300053156 Bacteria 58436
269 Ga0500622_0002622 3300053156 Bacteria 12789
270 Ga0500627_0116774 3300053158 Bacteria 1202
271 Ga0590075_009620 3300059424 Bacteria 2319
272 Ga0501082_0187810 3300060353 Bacteria 1798
273 2509390260 2509276021 Bacteria 7634384
274 2510306568 2510065057 Bacteria 6649661
275 2511186628 2510917028 Bacteria 6185411
276 2511196654 2510917030 Bacteria 7460662
277 2511499738 2511231052 Bacteria 6974333
278 2512530658 2512047086 Bacteria 6850303
279 2512974902 2512875026 Bacteria 6861065
280 2513603763 2513237089 Bacteria 6553624
281 2513870004 2513237138 Bacteria 7368160
282 2513883004 2513237140 Bacteria 7076289
283 2513903059 2513237143 Bacteria 6664116
284 2513986473 2513237156 Bacteria 6402557
285 2514001988 2513237159 Bacteria 6810126
286 2514004280 2513237160 Bacteria 6650282
287 2514592013 2513237351 Bacteria 6968952
288 2516208982 2516143018 Bacteria 6951533
289 2516897297 2516653046 Bacteria 6989037
290 2517567549 2517487022 Bacteria 7227575
291 2524453003 2524023207 Bacteria 6813453
292 2535519608 2534681796 Bacteria 7146037
293 2537874276 2537561587 Bacteria 5425293
294 2551681509 2551306084 Bacteria 8942552
295 2551688935 2551306085 Bacteria 7347181
296 2551695865 2551306086 Bacteria 6843938
297 2551697570 2551306087 Bacteria 7351905
298 2551713696 2551306089 Bacteria 7162724
299 2551723457 2551306090 Bacteria 7953713
300 2551727561 2551306091 Bacteria 7086830
301 2551734267 2551306092 Bacteria 6992595
302 2551742864 2551306093 Bacteria 7064773
303 2585168559 2582581283 Bacteria 6030556
304 2585169326 2582581283 Bacteria 6030556
305 2585200175 2582581294 Bacteria 6626667
306 2585226770 2582581298 Bacteria 7315509
307 2585270194 2582581306 Bacteria 6450535
308 2585390581 2582581865 Bacteria 6644329
309 2585394353 2582581866 Bacteria 6859583
310 2585401816 2582581867 Bacteria 7184437
311 2585550185 2585427529 Bacteria 7395659
312 2585820205 2585427590 Bacteria 6824633
313 2600195898 2599185352 Bacteria 7228948
314 2601612706 2600255279 Bacteria 5605316
315 2601749438 2600255308 Bacteria 5611129
316 2643803321 2643221557 Bacteria 7184309
317 2643922134 2643221582 Bacteria 5804683
318 2644008194 2643221599 Bacteria 6292121
319 2644049432 2643221607 Bacteria 6314006
320 2644049866 2643221607 Bacteria 6314006
321 2644063686 2643221610 Bacteria 7480339
322 2644104322 2643221618 Bacteria 7717186
323 2644129475 2643221623 Bacteria 5239945
324 2644148861 2643221626 Bacteria 8069654
325 2644194174 2643221634 Bacteria 6705461
326 2644203885 2643221636 Bacteria 6583769
327 2644204229 2643221636 Bacteria 6583769
328 2644208197 2643221637 Bacteria 5345260
329 2644239307 2643221643 Bacteria 5749658
330 2644313315 2643221655 Bacteria 7722067
331 2644334185 2643221659 Bacteria 7890716
332 2644374965 2643221668 Bacteria 7306521
333 2644414449 2643221675 Bacteria 7473456
334 2644447977 2643221680 Bacteria 7473610
335 2644482466 2643221686 Bacteria 6310811
336 2644482778 2643221686 Bacteria 6310811
337 2644495958 2643221688 Bacteria 5260751
338 2644547238 2643221698 Bacteria 7756764
339 2644612940 2643221712 Bacteria 7729434
340 2644651955 2643221718 Bacteria 5345506
341 2644676295 2643221723 Bacteria 7095460
342 2644690450 2643221726 Bacteria 7455827
343 2692316699 2690316117 Bacteria 6800650
344 2720609877 2718218232 Bacteria 6720332
345 2739033853 2738541333 Bacteria 7106503
346 2739306686 2738543024 Bacteria 5603683
347 2753460931 2751185821 Bacteria 6189929
348 2792580168 2791355082 Bacteria 5973319
349 2792750360 2791355123 Bacteria 8049106
350 2793329456 2791355261 Bacteria 6661293
351 2793343744 2791355263 Bacteria 6872478
352 2802718257 2802428858 Bacteria 6636079
353 2802725948 2802428859 Bacteria 6667919
354 2802731340 2802428860 Bacteria 6525526
355 2802736467 2802428861 Bacteria 6534206
356 2802744441 2802428862 Bacteria 6633353
357 2802749970 2802428863 Bacteria 6410669
358 2806045823 2802429633 Bacteria 7341974
359 2806053396 2802429634 Bacteria 7083200
360 2806056563 2802429634 Bacteria 7083200
361 2806061110 2802429635 Bacteria 7650140
362 2806063680 2802429635 Bacteria 7650140
363 2806066236 2802429636 Bacteria 7597525
364 2806073184 2802429637 Bacteria 7067217
365 2819562139 2818991439 Bacteria 6907412
366 2821129094 2821123053 Bacteria 7836056
367 2838077843 2838074704 Bacteria 6785777
368 2838668238 2838661181 Bacteria 7385261
369 2838678881 2838675328 Bacteria 4909118
370 2838717832 2838714209 Bacteria 5525906
371 2838723178 2838719591 Bacteria 5523910
372 2838728549 2838724970 Bacteria 4908691
373 2838741415 2838736955 Bacteria 5760694
374 2840765739 2840764183 Bacteria 6358399
375 2840879557 2840878972 Bacteria 5483153
376 2841845273 2841840854 Bacteria 5761912
377 2841849888 2841846520 Bacteria 5345850
378 2841863671 2841859092 Bacteria 5436171
379 2842128360 2842124991 Bacteria 5346824
380 2842133968 2842130223 Bacteria 4909145
381 2842144976 2842140634 Bacteria 5759631
382 2842155768 2842152218 Bacteria 4908957
383 2842174078 2842170452 Bacteria 5525737
384 2842179582 2842175837 Bacteria 4908771
385 2842191103 2842187318 Bacteria 5524014
386 2842215418 2842211629 Bacteria 5523832
387 2842227943 2842224351 Bacteria 5524473
388 2842520454 2842515876 Bacteria 5436280
389 2842527390 2842521101 Bacteria 6569494
390 2844168077 2844163670 Bacteria 7266046
391 2847418235 2847417321 Bacteria 6913799
392 2854899844 2854896431 Bacteria 5869725
393 2855878809 2855872281 Bacteria 6964271
394 2857536311 2857531043 Bacteria 6754041
395 2876810821 2876808645 Bacteria 8824342
396 2879112140 2879110137 Bacteria 8907982
397 2889917849 2889914905 Bacteria 5702301
398 2896392016 2896384573 Bacteria 7700774
399 2899793756 2899792073 Bacteria 4926588
400 2899807168 2899803654 Bacteria 5577784
401 2913297316 2913295892 Bacteria 6333755
402 2919107222 2919100787 Bacteria 7710546
403 2919118112 2919114240 Bacteria 5700270
404 2920764678 2920760137 Bacteria 7427611
405 2920824992 2920822456 Bacteria 6897201
406 2923562054 2923556063 Bacteria 6793593
407 2926757877 2926754445 Bacteria 5964435
408 2929142741 2929138655 Bacteria 5810547
409 2933010793 2933006813 Bacteria 4912075
410 2933016146 2933011516 Bacteria 5439334
411 2933017057 2933016740 Bacteria 6355406
412 2936386652 2936381700 Bacteria 7006523
413 2937000499 2936996657 Bacteria 6298727
414 2937005219 2937002841 Bacteria 6934057
415 2937011395 2937009748 Bacteria 6746052
416 2937017185 2937016420 Bacteria 6782579
417 2937026127 2937023124 Bacteria 6815156
418 2937034386 2937029754 Bacteria 6424026
419 2937038949 2937036028 Bacteria 6846469
420 2937046613 2937042894 Bacteria 6741576
421 2937055790 2937049772 Bacteria 6757901
422 2937067289 2937063883 Bacteria 7199456
423 2937074471 2937071275 Bacteria 6984483
424 2937084876 2937078374 Bacteria 6610289
425 2937090673 2937084907 Bacteria 6618516
426 2937094241 2937091812 Bacteria 6979387
427 2937099519 2937098957 Bacteria 7249374
428 2937109257 2937106411 Bacteria 6947143
429 2937118425 2937113482 Bacteria 6505872
430 2937120762 2937119839 Bacteria 6597547
431 2937130630 2937126314 Bacteria 6771275
432 2937843935 2937843397 Bacteria 5256375
433 2941504283 2941499720 Bacteria 7599444
434 2957376129 2957375807 Bacteria 6425588
435 2957391578 2957388812 Bacteria 6778072
436 2957397485 2957395598 Bacteria 6822399
437 2957409386 2957408893 Bacteria 6558585
438 2957418782 2957415311 Bacteria 6991633
439 2957442223 2957437181 Bacteria 6568994
440 2957444631 2957443900 Bacteria 6869977
441 2957452967 2957450854 Bacteria 6765715
442 2957461367 2957457609 Bacteria 6967680
443 2957470516 2957464669 Bacteria 6568877
444 2957471876 2957471148 Bacteria 6797643
445 2957482205 2957478035 Bacteria 6756658
446 2957485892 2957484790 Bacteria 6703082
447 2957498084 2957491536 Bacteria 6695180
448 2957501230 2957498199 Bacteria 7126688
449 2960587337 2960584000 Bacteria 6864594
450 2960596046 2960591022 Bacteria 6622873
451 2960600547 2960597568 Bacteria 6550735
452 2960607591 2960603979 Bacteria 6898737
453 2960612835 2960610863 Bacteria 6691244
454 2960618456 2960617483 Bacteria 6727748
455 2960629054 2960624210 Bacteria 6875384
456 2960636016 2960631154 Bacteria 6732508
457 2960650897 2960645483 Bacteria 7211087
458 2960654117 2960652885 Bacteria 7083688
459 2960661340 2960660292 Bacteria 7041660
460 2960670647 2960667422 Bacteria 6763020
461 2960685954 2960680706 Bacteria 6624464
462 2960693971 2960693952 Bacteria 6749742
463 2964617162 2964615318 Bacteria 6809089
464 2964625632 2964621998 Bacteria 6834995
465 2964638904 2964636051 Bacteria 7091832
466 2964644312 2964643177 Bacteria 6820887
467 2964654461 2964649959 Bacteria 6675118
468 2964658297 2964656573 Bacteria 7100150
469 2964664785 2964663802 Bacteria 7019362
470 2964679872 2964678106 Bacteria 6792020
471 2964691123 2964685014 Bacteria 6839111
472 2964709098 2964705432 Bacteria 7114648
473 2964713048 2964712639 Bacteria 6695970
474 2967668814 2967664464 Bacteria 6948836
475 2967672392 2967671571 Bacteria 7021409
476 2967680228 2967678726 Bacteria 7264382
477 2967689888 2967686174 Bacteria 6678622
478 2967698396 2967693043 Bacteria 6804451
479 2967707571 2967706974 Bacteria 7186053
480 2967719262 2967714385 Bacteria 7000047
481 2967724032 2967721400 Bacteria 7073753
482 2967733295 2967728569 Bacteria 6641507
483 2967739662 2967735183 Bacteria 6827012
484 2967745770 2967742019 Bacteria 6794534
485 2967751699 2967748971 Bacteria 6733771
486 2967761491 2967755722 Bacteria 6814706
487 2967764366 2967762386 Bacteria 6923502
488 2967773974 2967769361 Bacteria 6587838
489 2967781839 2967775926 Bacteria 6738189
490 2970022070 2970019648 Bacteria 7072033
491 2970029766 2970026789 Bacteria 6785236
492 2970039327 2970033650 Bacteria 7118744
493 2970043672 2970040964 Bacteria 6731123
494 2970049112 2970047711 Bacteria 7088379
495 2970057508 2970054988 Bacteria 6611507
496 2970062688 2970061556 Bacteria 7099761
497 2970071507 2970068827 Bacteria 7123112
498 2970082314 2970076120 Bacteria 6697332
499 2970089863 2970088815 Bacteria 6933825
500 2970105373 2970102677 Bacteria 6812532
501 2970113443 2970109326 Bacteria 6863976
502 2970119224 2970116247 Bacteria 6501857
503 2970128455 2970122695 Bacteria 6625855
504 2970134554 2970129317 Bacteria 6806560
505 2970140371 2970136068 Bacteria 7207982
506 2970145684 2970143518 Bacteria 6446480
507 2970163762 2970156795 Bacteria 7168044
508 2970165050 2970164137 Bacteria 6861252
509 2970177185 2970170962 Bacteria 6876229
510 2970180450 2970177841 Bacteria 6768001
511 2970186608 2970184632 Bacteria 7054431
512 2970194553 2970191845 Bacteria 7032787
513 2977527628 2977523885 Bacteria 6960446
514 2977536649 2977530762 Bacteria 6951399
515 2977542932 2977537788 Bacteria 6929320
516 2977550489 2977544691 Bacteria 6875412
517 2977554242 2977551784 Bacteria 7125765
518 2977562335 2977558990 Bacteria 6863948
519 2977568460 2977565890 Bacteria 6901543
520 2977576163 2977572785 Bacteria 6763888
521 2977582082 2977579622 Bacteria 6772100
522 2979103235 2979100975 Bacteria 5423623
523 2984514083 2984509177 Bacteria 5274802
524 2984523114 2984518228 Bacteria 5277463
525 2984542349 2984537506 Bacteria 5277481
526 2984606336 2984601300 Bacteria 5455244
527 2989776513 2989771324 Bacteria 5605128
528 2996315966 2996310559 Bacteria 6357320
529 2996338979 2996336353 Bacteria 5511628
530 2996891136 2996887358 Bacteria 5795980
531 2996895741 2996893221 Bacteria 5823108
532 3003935111 3003930520 Bacteria 5667563
533 3005416247 3005409236 Bacteria 7188837
534 3005456993 3005452660 Bacteria 5889319
535 643825208 643692032 Bacteria 6891900
536 648738005 648276728 Bacteria 6968865
537 8003574504 8003570095 Bacteria 5747666
538 8003998092 8003992118 Bacteria 7266902
539 8004005089 8003999396 Bacteria 7063185
540 8005260413 8005258706 Bacteria 6184835
541 8005294084 8005289223 Bacteria 6634003
542 8005325663 8005321885 Bacteria 5795980
543 8005384493 8005382845 Bacteria 6732062
544 8005431868 8005430974 Bacteria 6689030
545 8005547307 8005542996 Bacteria 7077758
546 8005693186 8005688590 Bacteria 6610080
547 8018129464 8018127388 Bacteria 7351159
548 8049298570 8049293176 Bacteria 6128433
549 8054562269 8054558443 Bacteria 5204801
550 Ga0496122_0370728
551 JGI25158J39367_1009106
552 JGI25159J45721_1000046
553 JGI25159J45721_1000411
554 JGI25151J46595_10021936
555 JGI25153J46596_10004207
556 JGI25153J46596_10025985
557 JGI25160J50197_1000001
558 JGI25160J50197_1000024
559 JGI25161J50226_1000001
560 JGI25161J50226_1000086
561 JGI25161J50226_1000831
562 Ga0006562J51391_1011398
563 Ga0055526_1002839
564 Ga0055526_1004669
565 Ga0055526_1006971
566 Ga0055524_1000850
567 Ga0055524_1000924
568 Ga0055524_1007266
569 Ga0055524_1007969
570 Ga0055524_1008839
571 Ga0055536_1000446
572 Ga0055536_1002129
573 Ga0055528_1001807
574 Ga0055528_1004016
575 Ga0055528_1006715
576 Ga0055540_1003792
577 Ga0055540_1004533
578 Ga0055540_1005387
579 Ga0055540_1029977
580 Ga0055540_1034505
581 Ga0055531_10006243
582 Ga0055531_10020727
583 Ga0058692_1011733
584 Ga0058692_1012442
585 Ga0055543_1000003
586 Ga0055543_1000013
587 Ga0055543_1000066
588 Ga0065165_1000068
589 Ga0065165_1000098
590 Ga0065165_1004115
591 Ga0065165_1007429
592 Ga0065165_1008694
593 Ga0070683_100447360
594 Ga0070668_100117572
595 Ga0070668_100975016
596 Ga0070675_100661044
597 Ga0070671_100112698
598 Ga0070674_100635227
599 Ga0070673_101728535
600 Ga0070667_100424373
601 Ga0070681_10189247
602 Ga0070665_100024603
603 Ga0068864_101438378
604 Ga0068863_100544969
605 Ga0075365_10000264
606 Ga0075368_10045291
607 Ga0075363_100179893
608 Ga0075363_100696829
609 Ga0075364_10000076
610 Ga0075362_10000099
611 Ga0075367_10000716
612 Ga0075367_10036756
613 Ga0075369_10023255
614 Ga0075366_10001596
615 Ga0075370_10001804
616 Ga0075436_100386004
617 Ga0079104_1000014
618 Ga0079104_1006597
619 Ga0099826_10030091
620 Ga0099826_10086791
621 Ga0105251_10049924
622 Ga0105245_12057235
623 Ga0105248_10996268
624 Ga0105237_11304480
625 Ga0105249_11041355
626 Ga0105035_102994
627 Ga0105239_10782031
628 Ga0105246_10811128
629 Ga0171463_1003
630 Ga0163162_10138647
631 Ga0157515_128610
632 Ga0163163_10752263
633 Ga0183363_1039
634 Ga0214542_1000006
635 Ga0214543_1000005
636 Ga0214543_1000014
637 Ga0228711_1001405
638 Ga0228711_1016339
639 Ga0228710_1017751
640 Ga0228710_1023839
641 Ga0209436_100014
642 Ga0209436_102342
643 Ga0207425_1022064
644 Ga0209129_1005362
645 Ga0209129_1005874
646 Ga0209673_1001283
647 Ga0209673_1003634
648 Ga0209673_1013505
649 Ga0209130_1000003
650 Ga0209130_1000004
651 Ga0209130_1000026
652 Ga0209676_1000837
653 Ga0209676_1044392
654 Ga0209025_1000216
655 Ga0209025_1012765
656 Ga0209025_1033437
657 Ga0209025_1111566
658 Ga0209564_1000013
659 Ga0209564_1000831
660 Ga0209564_1001309
661 Ga0209564_1026899
662 Ga0209564_1031495
663 Ga0209758_1001818
664 Ga0209758_1007539
665 Ga0209758_1009568
666 Ga0209758_1013538
667 Ga0209050_1049937
668 Ga0209256_1000042
669 Ga0209256_1000753
670 Ga0209256_1001748
671 Ga0209256_1008359
672 Ga0207426_1000003
673 Ga0207426_1000006
674 Ga0207426_1000011
675 Ga0207426_1004068
676 Ga0207426_1087798
677 Ga0209051_1003861
678 Ga0209051_1004634
679 Ga0209051_1004688
680 Ga0209051_1005600
681 Ga0209051_1013124
682 Ga0209051_1100849
683 Ga0209257_1006075
684 Ga0209257_1007147
685 Ga0207713_1110393
686 Ga0207707_10156539
687 Ga0207652_10589439
688 Ga0207650_10838191
689 Ga0207650_11043235
690 Ga0207661_10123158
691 Ga0207678_10487984
692 Ga0207678_10551085
693 Ga0207683_10388341
694 Ga0209281_1000032
695 Ga0209281_1000682
696 Ga0209281_1004224
697 Ga0209281_1005038
698 Ga0209371_1001887
699 Ga0209371_1005637
700 Ga0209999_1044717
701 Ga0209282_1000049
702 Ga0209282_1117264
703 Ga0209813_10051369
704 Ga0268266_10026834
705 Ga0268256_1005410
706 Ga0268256_1010572
707 Ga0316181_1153708
708 Ga0307405_10157761
709 Ga0307413_10777123
710 Ga0307406_10091180
711 Ga0307412_10913887
712 Ga0307412_11033151
713 Ga0315914_1000005
714 Ga0315914_1023551
715 Ga0307414_10311333
716 Ga0315913_1002524
717 Ga0315913_1002550
718 Ga0315915_1000004
719 Ga0315915_1018160
720 Ga0439466_0169570
721 Ga0439465_0005716
722 Ga0451807_0626715
723 Ga0451841_0264032
724 Ga0451849_1134801
725 Ga0451855_0080692
726 Ga0451855_0419906
727 Ga0451853_0910860
728 Ga0451853_1360564
729 Ga0439445_0047831
730 Ga0495638_0175805
731 Ga0495585_0070386
732 Ga0495606_0015680
733 Ga0495616_0254165
734 Ga0495643_0102947
735 Ga0495648_0416662
736 Ga0495633_0277279
737 Ga0495656_0145228
738 Ga0495625_0688889
739 Ga0495588_0109624
740 Ga0495649_0149797
741 Ga0495681_0061544
742 Ga0496100_0318259
743 Ga0496102_0127023
744 Ga0496103_0396711
745 Ga0496104_0033326
746 Ga0496105_0008791
747 Ga0496105_0539492
748 Ga0496105_0696979
749 Ga0496106_0000095
750 Ga0496106_0779404
751 Ga0496107_0810638
752 Ga0496111_0398901
753 Ga0496113_0091681
754 Ga0496113_0467337
755 Ga0496114_0084002
756 Ga0496114_0297322
757 Ga0496117_0366945
758 Ga0496118_0530097
759 Ga0496119_0044968
760 Ga0496121_0023018
761 Ga0496121_0041249
762 Ga0496121_0057382
763 Ga0496121_0436479
764 Ga0496122_0030550
765 Ga0496122_0082045
766 Ga0496123_0047730
767 Ga0496124_0011936
768 Ga0496124_0018584
769 Ga0496124_0187199
770 Ga0496124_0352536
771 Ga0496125_0020969
772 Ga0496125_0038179
773 Ga0496125_0403302
774 Ga0496126_0073740
775 Ga0496126_0207064
776 Ga0501032_0051455
777 Ga0501033_0370417
778 Ga0501034_0009627
779 Ga0501036_0245093
780 Ga0501036_0568097
781 Ga0501038_0024792
782 Ga0501038_0061675
783 Ga0501038_0430438
784 Ga0501039_0328090
785 Ga0501039_0900243
786 Ga0501043_0095091
787 Ga0501043_0683615
788 Ga0501046_0172633
789 Ga0501047_0034780
790 Ga0501047_0068153
791 Ga0501068_0228490
792 Ga0501072_0106345
793 Ga0501083_0008495
794 Ga0501083_0032671
795 Ga0501035_0060729
796 Ga0501044_0249704
797 Ga0501044_0976769
798 Ga0501045_1376968
799 nmdc:mga03683_178_c1
800 nmdc:mga03n38_115053_c1
801 nmdc:mga00v17_63_c1
802 nmdc:mga0yw44_309172_c1
803 nmdc:mga0yw44_641_c1
804 nmdc:mga0k408_4555_c1
805 nmdc:mga06z11_187018_c1
806 nmdc:mga06z11_664_c1
807 nmdc:mga04h51_61392_c1
808 nmdc:mga07m45_3057_c1
809 nmdc:mga07m45_344289_c1
810 nmdc:mga08y16_307669_c1
811 Ga0500644_0032696
812 Ga0500568_0000644
813 Ga0500568_0033197
814 Ga0500568_0161931
815 Ga0500604_0016401
816 Ga0500616_0004286
817 Ga0500622_0000228
818 Ga0500622_0002622
819 Ga0500627_0116774
820 Ga0590075_009620
821 Ga0501082_0187810
822 2509390260
823 2510306568
824 2511186628
825 2511196654
826 2511499738
827 2512530658
828 2512974902
829 2513603763
830 2513870004
831 2513883004
832 2513903059
833 2513986473
834 2514001988
835 2514004280
836 2514592013
837 2516208982
838 2516897297
839 2517567549
840 2524453003
841 2535519608
842 2537874276
843 2551681509
844 2551688935
845 2551695865
846 2551697570
847 2551713696
848 2551723457
849 2551727561
850 2551734267
851 2551742864
852 2585168559
853 2585169326
854 2585200175
855 2585226770
856 2585270194
857 2585390581
858 2585394353
859 2585401816
860 2585550185
861 2585820205
862 2600195898
863 2601612706
864 2601749438
865 2643803321
866 2643922134
867 2644008194
868 2644049432
869 2644049866
870 2644063686
871 2644104322
872 2644129475
873 2644148861
874 2644194174
875 2644203885
876 2644204229
877 2644208197
878 2644239307
879 2644313315
880 2644334185
881 2644374965
882 2644414449
883 2644447977
884 2644482466
885 2644482778
886 2644495958
887 2644547238
888 2644612940
889 2644651955
890 2644676295
891 2644690450
892 2692316699
893 2720609877
894 2739033853
895 2739306686
896 2753460931
897 2792580168
898 2792750360
899 2793329456
900 2793343744
901 2802718257
902 2802725948
903 2802731340
904 2802736467
905 2802744441
906 2802749970
907 2806045823
908 2806053396
909 2806056563
910 2806061110
911 2806063680
912 2806066236
913 2806073184
914 2819562139
915 2821129094
916 2838077843
917 2838668238
918 2838678881
919 2838717832
920 2838723178
921 2838728549
922 2838741415
923 2840765739
924 2840879557
925 2841845273
926 2841849888
927 2841863671
928 2842128360
929 2842133968
930 2842144976
931 2842155768
932 2842174078
933 2842179582
934 2842191103
935 2842215418
936 2842227943
937 2842520454
938 2842527390
939 2844168077
940 2847418235
941 2854899844
942 2855878809
943 2857536311
944 2876810821
945 2879112140
946 2889917849
947 2896392016
948 2899793756
949 2899807168
950 2913297316
951 2919107222
952 2919118112
953 2920764678
954 2920824992
955 2923562054
956 2926757877
957 2929142741
958 2933010793
959 2933016146
960 2933017057
961 2936386652
962 2937000499
963 2937005219
964 2937011395
965 2937017185
966 2937026127
967 2937034386
968 2937038949
969 2937046613
970 2937055790
971 2937067289
972 2937074471
973 2937084876
974 2937090673
975 2937094241
976 2937099519
977 2937109257
978 2937118425
979 2937120762
980 2937130630
981 2937843935
982 2941504283
983 2957376129
984 2957391578
985 2957397485
986 2957409386
987 2957418782
988 2957442223
989 2957444631
990 2957452967
991 2957461367
992 2957470516
993 2957471876
994 2957482205
995 2957485892
996 2957498084
997 2957501230
998 2960587337
999 2960596046
1000 2960600547
1001 2960607591
1002 2960612835
1003 2960618456
1004 2960629054
1005 2960636016
1006 2960650897
1007 2960654117
1008 2960661340
1009 2960670647
1010 2960685954
1011 2960693971
1012 2964617162
1013 2964625632
1014 2964638904
1015 2964644312
1016 2964654461
1017 2964658297
1018 2964664785
1019 2964679872
1020 2964691123
1021 2964709098
1022 2964713048
1023 2967668814
1024 2967672392
1025 2967680228
1026 2967689888
1027 2967698396
1028 2967707571
1029 2967719262
1030 2967724032
1031 2967733295
1032 2967739662
1033 2967745770
1034 2967751699
1035 2967761491
1036 2967764366
1037 2967773974
1038 2967781839
1039 2970022070
1040 2970029766
1041 2970039327
1042 2970043672
1043 2970049112
1044 2970057508
1045 2970062688
1046 2970071507
1047 2970082314
1048 2970089863
1049 2970105373
1050 2970113443
1051 2970119224
1052 2970128455
1053 2970134554
1054 2970140371
1055 2970145684
1056 2970163762
1057 2970165050
1058 2970177185
1059 2970180450
1060 2970186608
1061 2970194553
1062 2977527628
1063 2977536649
1064 2977542932
1065 2977550489
1066 2977554242
1067 2977562335
1068 2977568460
1069 2977576163
1070 2977582082
1071 2979103235
1072 2984514083
1073 2984523114
1074 2984542349
1075 2984606336
1076 2989776513
1077 2996315966
1078 2996338979
1079 2996891136
1080 2996895741
1081 3003935111
1082 3005416247
1083 3005456993
1084 643825208
1085 648738005
1086 8003574504
1087 8003998092
1088 8004005089
1089 8005260413
1090 8005294084
1091 8005325663
1092 8005384493
1093 8005431868
1094 8005547307
1095 8005693186
1096 8018129464
1097 8049298570
1098 8054562269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03892

NapB

Nitrate reductase cytochrome c-type subunit (NapB)

31

158

0.93

Map