F462345

General Info

Members Datasets Scaffolds Average Seq Length
549 216 1098 111

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100476425|Ga0075434_1004764253
Length 131
Sequence MSRKKAQKHNKPLLIFMCLLCLFVATIGFMVDDERRNYDRARLIVDVFFDGKDVTGVASTKDISPGGLYMNTQAEIPEGTLLLIRIPFRTDAQVVCNAVVVYSNPGRGVGLRFQGLSDEVRAILEREVSNG

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
195 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
196 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
197 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
198 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
199 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
200 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.09
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 40.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100476425 3300006871 Bacteria 1269
2 SwRhRL2b_contig_1478571 2162886007 Eukaryota 1795
3 SwRhRL2b_contig_751808 2162886007 Eukaryota 1708
4 MRS1b_contig_352233 2162886011 Bacteria 1334
5 MBSR1b_contig_2331052 2162886012 Bacteria 1260
6 MBSR1b_contig_6335267 2162886012 Bacteria 1258
7 MBSR1b_contig_9475842 2162886012 Bacteria 1306
8 CNAas_1001141 3300000532 Bacteria 2413
9 Ga0065704_10001430 3300005289 Bacteria 7818
10 Ga0065704_10407841 3300005289 Unclassified 745
11 Ga0065712_10001509 3300005290 Bacteria 9177
12 Ga0065712_10107353 3300005290 Bacteria 1897
13 Ga0065715_10093662 3300005293 Bacteria 4605
14 Ga0065715_10096122 3300005293 Bacteria 3939
15 Ga0065715_10108769 3300005293 Unclassified 2701
16 Ga0065715_10117565 3300005293 Bacteria 2343
17 Ga0065715_10276927 3300005293 Unclassified 1096
18 Ga0065715_10338311 3300005293 Bacteria 971
19 Ga0065715_10514903 3300005293 Unclassified 768
20 Ga0065715_10750373 3300005293 Unclassified 630
21 Ga0065715_10917995 3300005293 Unclassified 563
22 Ga0065707_10106887 3300005295 Bacteria 2578
23 Ga0065707_10139535 3300005295 Bacteria 1791
24 Ga0070676_10041759 3300005328 Bacteria 2661
25 Ga0070676_11311655 3300005328 Unclassified 553
26 Ga0070690_100005890 3300005330 Bacteria 6914
27 Ga0070690_100058160 3300005330 Bacteria 2482
28 Ga0070690_100203406 3300005330 Bacteria 1379
29 Ga0070670_100044506 3300005331 Unclassified 3817
30 Ga0070670_100190413 3300005331 Bacteria 1782
31 Ga0070670_100393368 3300005331 Unclassified 1223
32 Ga0070670_101059429 3300005331 Unclassified 739
33 Ga0070670_101388455 3300005331 Unclassified 644
34 Ga0068869_100047423 3300005334 Bacteria 3103
35 Ga0068869_100182270 3300005334 Bacteria 1647
36 Ga0068869_100263297 3300005334 Unclassified 1381
37 Ga0068869_100342208 3300005334 Unclassified 1217
38 Ga0068869_100372616 3300005334 Bacteria 1169
39 Ga0068869_100561987 3300005334 Bacteria 960
40 Ga0068869_101253610 3300005334 Unclassified 653
41 Ga0070666_10040349 3300005335 Unclassified 3115
42 Ga0070666_10281707 3300005335 Unclassified 1182
43 Ga0070680_101317913 3300005336 Unclassified 625
44 Ga0070680_101379964 3300005336 Unclassified 610
45 Ga0070682_100003162 3300005337 Bacteria 9126
46 Ga0070682_100048048 3300005337 Bacteria 2656
47 Ga0068868_100059314 3300005338 Bacteria 3027
48 Ga0068868_100295778 3300005338 Bacteria 1374
49 Ga0068868_100416007 3300005338 Bacteria 1163
50 Ga0068868_102338314 3300005338 Bacteria 510
51 Ga0070660_101683376 3300005339 Unclassified 540
52 Ga0070689_100000612 3300005340 Bacteria 21624
53 Ga0070689_100012650 3300005340 Bacteria 6086
54 Ga0070689_100040418 3300005340 Unclassified 3576
55 Ga0070689_101211386 3300005340 Unclassified 678
56 Ga0070687_100014777 3300005343 Bacteria 3515
57 Ga0070687_100019663 3300005343 Bacteria 3146
58 Ga0070661_100588717 3300005344 Bacteria 898
59 Ga0070692_10005544 3300005345 Bacteria 5396
60 Ga0070692_10025217 3300005345 Bacteria 2929
61 Ga0070692_10131295 3300005345 Unclassified 1408
62 Ga0070692_10171970 3300005345 Unclassified 1249
63 Ga0070692_10357803 3300005345 Unclassified 909
64 Ga0070669_100039016 3300005353 Bacteria 3449
65 Ga0070669_101498718 3300005353 Unclassified 586
66 Ga0070675_100282482 3300005354 Unclassified 1459
67 Ga0070675_100307203 3300005354 Bacteria 1398
68 Ga0070675_100553704 3300005354 Unclassified 1040
69 Ga0070671_100024666 3300005355 Unclassified 4926
70 Ga0070671_100129049 3300005355 Unclassified 2129
71 Ga0070671_100180069 3300005355 Unclassified 1789
72 Ga0070674_100209821 3300005356 Unclassified 1509
73 Ga0070673_100132459 3300005364 Bacteria 2094
74 Ga0070673_100156652 3300005364 Bacteria 1933
75 Ga0070673_100276336 3300005364 Bacteria 1472
76 Ga0070673_102043457 3300005364 Bacteria 544
77 Ga0070688_100021792 3300005365 Bacteria 3746
78 Ga0070659_100901527 3300005366 Unclassified 773
79 Ga0070667_100059988 3300005367 Bacteria 3219
80 Ga0070667_100092541 3300005367 Unclassified 2602
81 Ga0070703_10002705 3300005406 Bacteria 5089
82 Ga0070705_100048924 3300005440 Bacteria 2452
83 Ga0070705_100067135 3300005440 Unclassified 2153
84 Ga0070705_100103836 3300005440 Unclassified 1801
85 Ga0070705_100195245 3300005440 Bacteria 1383
86 Ga0070705_101368548 3300005440 Unclassified 589
87 Ga0070700_100003339 3300005441 Bacteria 8276
88 Ga0070700_101128427 3300005441 Unclassified 651
89 Ga0070694_100007740 3300005444 Bacteria 6556
90 Ga0070694_100034861 3300005444 Bacteria 3322
91 Ga0070694_100041570 3300005444 Unclassified 3067
92 Ga0070694_100119436 3300005444 Bacteria 1890
93 Ga0070694_100300984 3300005444 Bacteria 1229
94 Ga0070694_100728748 3300005444 Unclassified 808
95 Ga0070694_100781833 3300005444 Unclassified 781
96 Ga0070694_100794726 3300005444 Unclassified 775
97 Ga0070694_101357409 3300005444 Unclassified 599
98 Ga0070708_100000002 3300005445 Bacteria 195857
99 Ga0070708_100426190 3300005445 Bacteria 1251
100 Ga0070708_100562008 3300005445 Unclassified 1076
101 Ga0070678_102026187 3300005456 Bacteria 545
102 Ga0070662_101428569 3300005457 Unclassified 596
103 Ga0070681_10019878 3300005458 Bacteria 6728
104 Ga0068867_100016556 3300005459 Bacteria 5235
105 Ga0068867_100158219 3300005459 Bacteria 1785
106 Ga0070685_10027217 3300005466 Bacteria 3158
107 Ga0070706_100004799 3300005467 Bacteria 12957
108 Ga0070706_100018991 3300005467 Bacteria 6340
109 Ga0070706_100167934 3300005467 Unclassified 2049
110 Ga0070706_100500249 3300005467 Unclassified 1131
111 Ga0070707_100004645 3300005468 Bacteria 12857
112 Ga0070707_100057256 3300005468 Bacteria 3739
113 Ga0070698_100026663 3300005471 Bacteria 6012
114 Ga0070698_100057398 3300005471 Bacteria 3939
115 Ga0070698_100478801 3300005471 Bacteria 1182
116 Ga0070699_100000737 3300005518 Bacteria 30330
117 Ga0070699_100020487 3300005518 Bacteria 5704
118 Ga0070699_100037773 3300005518 Bacteria 4180
119 Ga0070699_100919792 3300005518 Unclassified 801
120 Ga0070699_101249095 3300005518 Bacteria 681
121 Ga0070697_100006584 3300005536 Bacteria 9004
122 Ga0070697_100134066 3300005536 Bacteria 2079
123 Ga0070697_100277179 3300005536 Bacteria 1438
124 Ga0070697_101091685 3300005536 Bacteria 710
125 Ga0070697_101522792 3300005536 Unclassified 598
126 Ga0068853_100048217 3300005539 Bacteria 3658
127 Ga0068853_100339238 3300005539 Bacteria 1396
128 Ga0070672_100035713 3300005543 Bacteria 3779
129 Ga0070672_100156745 3300005543 Bacteria 1886
130 Ga0070686_100026452 3300005544 Unclassified 3502
131 Ga0070695_100122861 3300005545 Unclassified 1779
132 Ga0070695_100218244 3300005545 Bacteria 1373
133 Ga0070695_100254973 3300005545 Unclassified 1279
134 Ga0070695_100291452 3300005545 Bacteria 1203
135 Ga0070695_100312368 3300005545 Bacteria 1165
136 Ga0070695_101004413 3300005545 Bacteria 679
137 Ga0070695_101191450 3300005545 Bacteria 626
138 Ga0070695_101340405 3300005545 Unclassified 592
139 Ga0070695_101633019 3300005545 Unclassified 538
140 Ga0070696_100105213 3300005546 Bacteria 2027
141 Ga0070696_100166635 3300005546 Bacteria 1626
142 Ga0070696_100249226 3300005546 Bacteria 1342
143 Ga0070696_100889701 3300005546 Unclassified 738
144 Ga0070693_100000903 3300005547 Bacteria 13222
145 Ga0070693_100020438 3300005547 Bacteria 3492
146 Ga0070693_100069752 3300005547 Bacteria 2066
147 Ga0070693_100078722 3300005547 Bacteria 1959
148 Ga0070693_100855683 3300005547 Unclassified 678
149 Ga0070665_100365152 3300005548 Bacteria 1450
150 Ga0070704_100025661 3300005549 Bacteria 3883
151 Ga0070704_100135843 3300005549 Unclassified 1913
152 Ga0070704_100210443 3300005549 Unclassified 1575
153 Ga0070704_100558635 3300005549 Unclassified 1001
154 Ga0068855_100072964 3300005563 Bacteria 3989
155 Ga0070664_100053077 3300005564 Unclassified 3435
156 Ga0070664_100340781 3300005564 Bacteria 1362
157 Ga0068857_100172245 3300005577 Bacteria 1968
158 Ga0068857_100185730 3300005577 Unclassified 1892
159 Ga0068857_100661506 3300005577 Bacteria 990
160 Ga0068857_100816388 3300005577 Unclassified 891
161 Ga0068857_101632513 3300005577 Unclassified 630
162 Ga0068854_100055430 3300005578 Unclassified 2854
163 Ga0068854_100360417 3300005578 Bacteria 1193
164 Ga0068854_100658849 3300005578 Unclassified 900
165 Ga0070702_100006571 3300005615 Bacteria 5514
166 Ga0070702_100017083 3300005615 Bacteria 3735
167 Ga0070702_100029631 3300005615 Bacteria 2979
168 Ga0070702_100514005 3300005615 Bacteria 882
169 Ga0070702_100795052 3300005615 Unclassified 731
170 Ga0070702_101499481 3300005615 Unclassified 555
171 Ga0068852_100219219 3300005616 Bacteria 1809
172 Ga0068852_102433202 3300005616 Unclassified 544
173 Ga0068859_100017761 3300005617 Bacteria 7151
174 Ga0068859_100053862 3300005617 Bacteria 4046
175 Ga0068859_100082993 3300005617 Bacteria 3247
176 Ga0068859_100107599 3300005617 Bacteria 2849
177 Ga0068859_100159968 3300005617 Unclassified 2331
178 Ga0068859_100289635 3300005617 Bacteria 1730
179 Ga0068859_100725222 3300005617 Bacteria 1084
180 Ga0068859_100997684 3300005617 Bacteria 919
181 Ga0068859_101131513 3300005617 Unclassified 861
182 Ga0068859_101527621 3300005617 Unclassified 737
183 Ga0068864_100042088 3300005618 Unclassified 3908
184 Ga0068864_100045580 3300005618 Unclassified 3761
185 Ga0068864_100625439 3300005618 Bacteria 1047
186 Ga0068864_100862842 3300005618 Unclassified 892
187 Ga0068864_100911542 3300005618 Unclassified 868
188 Ga0068866_10004032 3300005718 Bacteria 6037
189 Ga0068866_10124677 3300005718 Unclassified 1456
190 Ga0068866_10570938 3300005718 Bacteria 759
191 Ga0068861_100017661 3300005719 Bacteria 5070
192 Ga0068861_100138648 3300005719 Bacteria 1982
193 Ga0068861_101226245 3300005719 Bacteria 726
194 Ga0068861_101911208 3300005719 Unclassified 590
195 Ga0068851_10001871 3300005834 Bacteria 9248
196 Ga0068851_10379013 3300005834 Unclassified 828
197 Ga0068851_10434139 3300005834 Unclassified 778
198 Ga0068870_10194178 3300005840 Bacteria 1227
199 Ga0068863_100017530 3300005841 Bacteria 6865
200 Ga0068863_100128484 3300005841 Unclassified 2418
201 Ga0068863_101018812 3300005841 Unclassified 831
202 Ga0068863_101903022 3300005841 Bacteria 605
203 Ga0068858_100092131 3300005842 Unclassified 2821
204 Ga0068858_100103976 3300005842 Unclassified 2650
205 Ga0068858_100138130 3300005842 Unclassified 2287
206 Ga0068858_100254717 3300005842 Bacteria 1668
207 Ga0068858_100515183 3300005842 Bacteria 1156
208 Ga0068858_100515926 3300005842 Bacteria 1155
209 Ga0068858_100857966 3300005842 Unclassified 887
210 Ga0068860_100021560 3300005843 Bacteria 6238
211 Ga0068860_100072920 3300005843 Bacteria 3263
212 Ga0068860_100096142 3300005843 Unclassified 2823
213 Ga0068860_100359941 3300005843 Bacteria 1433
214 Ga0068862_100016377 3300005844 Bacteria 6170
215 Ga0068862_101742480 3300005844 Unclassified 632
216 Ga0068862_101823994 3300005844 Unclassified 618
217 Ga0097621_100002105 3300006237 Bacteria 13646
218 Ga0097621_100007513 3300006237 Bacteria 7803
219 Ga0097621_100065509 3300006237 Unclassified 2990
220 Ga0097621_100444140 3300006237 Unclassified 1168
221 Ga0068871_100003157 3300006358 Bacteria 11318
222 Ga0068871_100005138 3300006358 Bacteria 9147
223 Ga0068871_100066371 3300006358 Bacteria 2957
224 Ga0068871_100161049 3300006358 Unclassified 1919
225 Ga0068871_100434874 3300006358 Unclassified 1174
226 Ga0075428_100415217 3300006844 Bacteria 1442
227 Ga0075428_102320113 3300006844 Unclassified 552
228 Ga0075430_100531989 3300006846 Unclassified 969
229 Ga0075431_100288858 3300006847 Bacteria 1659
230 Ga0075431_100498162 3300006847 Bacteria 1210
231 Ga0075431_102182564 3300006847 Unclassified 508
232 Ga0075433_10144822 3300006852 Bacteria 2112
233 Ga0075433_10189392 3300006852 Bacteria 1830
234 Ga0075433_10278593 3300006852 Bacteria 1482
235 Ga0075433_10475432 3300006852 Unclassified 1101
236 Ga0075433_10664837 3300006852 Unclassified 913
237 Ga0075433_10711753 3300006852 Unclassified 879
238 Ga0075433_10743488 3300006852 Unclassified 858
239 Ga0075434_101627701 3300006871 Bacteria 654
240 Ga0075434_102458146 3300006871 Unclassified 522
241 Ga0075429_100103940 3300006880 Bacteria 2480
242 Ga0075429_100755266 3300006880 Bacteria 852
243 Ga0068865_100977054 3300006881 Bacteria 740
244 Ga0097620_100017761 3300006931 Bacteria 7151
245 Ga0097620_100053860 3300006931 Bacteria 4046
246 Ga0097620_100082992 3300006931 Bacteria 3247
247 Ga0097620_100107605 3300006931 Bacteria 2849
248 Ga0097620_100159963 3300006931 Unclassified 2331
249 Ga0097620_100289632 3300006931 Bacteria 1730
250 Ga0097620_100725224 3300006931 Bacteria 1084
251 Ga0097620_100997681 3300006931 Bacteria 919
252 Ga0097620_101131518 3300006931 Unclassified 861
253 Ga0097620_101527487 3300006931 Unclassified 737
254 Ga0075435_101465566 3300007076 Unclassified 598
255 Ga0099794_10190010 3300007265 Bacteria 1050
256 Ga0105251_10063863 3300009011 Bacteria 1727
257 Ga0105251_10513458 3300009011 Bacteria 561
258 Ga0111539_10038957 3300009094 Bacteria 5732
259 Ga0111539_10396034 3300009094 Unclassified 1608
260 Ga0105245_10022958 3300009098 Bacteria 5474
261 Ga0105245_10311449 3300009098 Bacteria 1548
262 Ga0105245_10713412 3300009098 Bacteria 1037
263 Ga0105247_10001282 3300009101 Bacteria 18542
264 Ga0105247_10617100 3300009101 Bacteria 806
265 Ga0105247_11598214 3300009101 Unclassified 535
266 Ga0114129_10013646 3300009147 Bacteria 11575
267 Ga0114129_10035246 3300009147 Bacteria 7070
268 Ga0114129_10496174 3300009147 Bacteria 1595
269 Ga0114129_11147881 3300009147 Unclassified 970
270 Ga0105243_10007873 3300009148 Bacteria 8187
271 Ga0105243_10244182 3300009148 Unclassified 1600
272 Ga0105243_10918160 3300009148 Unclassified 872
273 Ga0105243_12040294 3300009148 Unclassified 608
274 Ga0105241_10008276 3300009174 Bacteria 7657
275 Ga0105241_10138671 3300009174 Bacteria 1978
276 Ga0105241_10307852 3300009174 Bacteria 1362
277 Ga0105241_10358583 3300009174 Bacteria 1268
278 Ga0105241_11070618 3300009174 Unclassified 758
279 Ga0105241_12371479 3300009174 Unclassified 529
280 Ga0105242_10031724 3300009176 Bacteria 4223
281 Ga0105242_10387222 3300009176 Bacteria 1301
282 Ga0105242_11486485 3300009176 Unclassified 708
283 Ga0105248_10006824 3300009177 Bacteria 12513
284 Ga0105248_10025648 3300009177 Bacteria 6555
285 Ga0105248_10236387 3300009177 Bacteria 2057
286 Ga0105248_10674541 3300009177 Unclassified 1166
287 Ga0105248_10893007 3300009177 Unclassified 1003
288 Ga0105248_11523982 3300009177 Unclassified 757
289 Ga0105248_12325024 3300009177 Unclassified 610
290 Ga0105237_10000623 3300009545 Bacteria 49504
291 Ga0105237_10804721 3300009545 Bacteria 947
292 Ga0105238_10002542 3300009551 Bacteria 18230
293 Ga0105249_10082173 3300009553 Bacteria 2997
294 Ga0105249_10149047 3300009553 Bacteria 2250
295 Ga0105249_10423842 3300009553 Bacteria 1365
296 Ga0105249_10835516 3300009553 Bacteria 986
297 Ga0105239_10263214 3300010375 Bacteria 1938
298 Ga0105239_10806988 3300010375 Unclassified 1075
299 Ga0105246_10105687 3300011119 Bacteria 2058
300 Ga0105246_10327567 3300011119 Bacteria 1247
301 Ga0105246_10443986 3300011119 Unclassified 1088
302 Ga0105246_10757474 3300011119 Unclassified 857
303 Ga0105246_11087455 3300011119 Bacteria 729
304 Ga0105246_11151545 3300011119 Bacteria 711
305 Ga0157342_1036639 3300012507 Unclassified 641
306 Ga0157373_10058093 3300013100 Bacteria 2743
307 Ga0157373_10346676 3300013100 Bacteria 1059
308 Ga0157371_10303191 3300013102 Unclassified 1157
309 Ga0157374_10012044 3300013296 Bacteria 7509
310 Ga0157374_10053315 3300013296 Bacteria 3770
311 Ga0157374_10871264 3300013296 Unclassified 918
312 Ga0157374_11441840 3300013296 Unclassified 711
313 Ga0157378_10000124 3300013297 Bacteria 74694
314 Ga0157378_10057801 3300013297 Bacteria 3457
315 Ga0157378_10784093 3300013297 Bacteria 978
316 Ga0157378_10933278 3300013297 Bacteria 900
317 Ga0157378_11713217 3300013297 Unclassified 676
318 Ga0163162_10001242 3300013306 Bacteria 23843
319 Ga0163162_10031242 3300013306 Bacteria 5282
320 Ga0163162_10038376 3300013306 Unclassified 4780
321 Ga0163162_10882639 3300013306 Bacteria 1008
322 Ga0157372_10007544 3300013307 Bacteria 11569
323 Ga0157372_10541277 3300013307 Unclassified 1357
324 Ga0157375_10042472 3300013308 Bacteria 4400
325 Ga0157375_10059184 3300013308 Bacteria 3794
326 Ga0157375_10068207 3300013308 Bacteria 3558
327 Ga0157375_10555613 3300013308 Bacteria 1309
328 Ga0157375_10753662 3300013308 Bacteria 1125
329 Ga0157375_10970824 3300013308 Bacteria 991
330 Ga0157375_11209108 3300013308 Unclassified 887
331 Ga0157375_12340424 3300013308 Bacteria 637
332 Ga0157375_13082038 3300013308 Unclassified 556
333 Ga0163163_10001013 3300014325 Bacteria 23790
334 Ga0163163_10022553 3300014325 Bacteria 5965
335 Ga0163163_10051050 3300014325 Unclassified 4076
336 Ga0163163_10089001 3300014325 Bacteria 3099
337 Ga0163163_10120056 3300014325 Bacteria 2662
338 Ga0163163_10190121 3300014325 Bacteria 2101
339 Ga0163163_10494873 3300014325 Bacteria 1284
340 Ga0163163_10647508 3300014325 Bacteria 1120
341 Ga0157380_10207878 3300014326 Unclassified 1742
342 Ga0157380_10630124 3300014326 Unclassified 1066
343 Ga0157377_10011015 3300014745 Bacteria 4498
344 Ga0157377_10235766 3300014745 Bacteria 1179
345 Ga0157377_10638531 3300014745 Unclassified 765
346 Ga0157379_10074645 3300014968 Unclassified 3036
347 Ga0157376_10004750 3300014969 Bacteria 9453
348 Ga0157376_10011606 3300014969 Bacteria 6504
349 Ga0157376_10071405 3300014969 Bacteria 2950
350 Ga0182005_1149188 3300015265 Unclassified 679
351 Ga0163161_10010511 3300017792 Bacteria 6411
352 Ga0207697_10011112 3300025315 Bacteria 3816
353 Ga0207656_10048032 3300025321 Bacteria 1837
354 Ga0207656_10582201 3300025321 Unclassified 571
355 Ga0207653_10019334 3300025885 Bacteria 2147
356 Ga0207642_10110848 3300025899 Bacteria 1397
357 Ga0207642_10929053 3300025899 Unclassified 558
358 Ga0207710_10000737 3300025900 Bacteria 18074
359 Ga0207688_10309821 3300025901 Bacteria 967
360 Ga0207680_10030609 3300025903 Unclassified 3038
361 Ga0207680_10943643 3300025903 Unclassified 618
362 Ga0207647_10041000 3300025904 Bacteria 2913
363 Ga0207647_10082105 3300025904 Bacteria 1931
364 Ga0207647_10489429 3300025904 Unclassified 686
365 Ga0207645_10075311 3300025907 Bacteria 2160
366 Ga0207643_10001198 3300025908 Bacteria 15332
367 Ga0207643_10989927 3300025908 Unclassified 544
368 Ga0207684_10039002 3300025910 Unclassified 4031
369 Ga0207684_10228489 3300025910 Bacteria 1605
370 Ga0207684_10441620 3300025910 Bacteria 1117
371 Ga0207684_10777034 3300025910 Bacteria 811
372 Ga0207654_10135599 3300025911 Bacteria 1563
373 Ga0207654_10259480 3300025911 Bacteria 1168
374 Ga0207654_10595837 3300025911 Unclassified 788
375 Ga0207654_10638897 3300025911 Unclassified 762
376 Ga0207707_10019143 3300025912 Bacteria 5975
377 Ga0207695_10245431 3300025913 Unclassified 1691
378 Ga0207671_10001989 3300025914 Bacteria 22543
379 Ga0207671_10037818 3300025914 Bacteria 3578
380 Ga0207662_10013862 3300025918 Bacteria 4511
381 Ga0207662_10022710 3300025918 Bacteria 3600
382 Ga0207646_10092418 3300025922 Bacteria 2708
383 Ga0207681_10752551 3300025923 Bacteria 812
384 Ga0207650_10049670 3300025925 Bacteria 3098
385 Ga0207650_10092966 3300025925 Unclassified 2308
386 Ga0207650_10567297 3300025925 Unclassified 952
387 Ga0207650_11717196 3300025925 Unclassified 532
388 Ga0207659_10077262 3300025926 Bacteria 2450
389 Ga0207659_10099963 3300025926 Unclassified 2185
390 Ga0207659_10258396 3300025926 Bacteria 1416
391 Ga0207687_10130226 3300025927 Bacteria 1895
392 Ga0207687_10458223 3300025927 Bacteria 1058
393 Ga0207644_10015389 3300025931 Bacteria 5133
394 Ga0207644_10065898 3300025931 Unclassified 2635
395 Ga0207644_10429507 3300025931 Bacteria 1083
396 Ga0207690_11499521 3300025932 Unclassified 564
397 Ga0207686_10268785 3300025934 Bacteria 1253
398 Ga0207709_10116861 3300025935 Unclassified 1794
399 Ga0207670_10001692 3300025936 Bacteria 11499
400 Ga0207670_10523536 3300025936 Bacteria 966
401 Ga0207670_10533816 3300025936 Unclassified 957
402 Ga0207669_10396153 3300025937 Unclassified 1080
403 Ga0207704_10803769 3300025938 Bacteria 785
404 Ga0207704_10818860 3300025938 Unclassified 778
405 Ga0207691_10002677 3300025940 Bacteria 17411
406 Ga0207691_10123619 3300025940 Unclassified 2290
407 Ga0207691_10344343 3300025940 Unclassified 1276
408 Ga0207691_11587660 3300025940 Bacteria 532
409 Ga0207711_10041430 3300025941 Unclassified 3922
410 Ga0207711_10111676 3300025941 Bacteria 2431
411 Ga0207711_10744533 3300025941 Unclassified 914
412 Ga0207711_10988290 3300025941 Unclassified 781
413 Ga0207711_11136268 3300025941 Unclassified 722
414 Ga0207711_11393878 3300025941 Unclassified 643
415 Ga0207689_10015191 3300025942 Bacteria 6521
416 Ga0207689_10019472 3300025942 Bacteria 5719
417 Ga0207689_10067418 3300025942 Bacteria 2941
418 Ga0207689_10104167 3300025942 Bacteria 2331
419 Ga0207689_10164489 3300025942 Unclassified 1828
420 Ga0207679_10221058 3300025945 Unclassified 1593
421 Ga0207667_10222853 3300025949 Bacteria 1932
422 Ga0207651_10366608 3300025960 Unclassified 1217
423 Ga0207651_10551623 3300025960 Bacteria 1002
424 Ga0207651_11015233 3300025960 Bacteria 742
425 Ga0207712_10095287 3300025961 Bacteria 2200
426 Ga0207712_10262976 3300025961 Unclassified 1400
427 Ga0207712_10289200 3300025961 Bacteria 1340
428 Ga0207712_10404881 3300025961 Bacteria 1148
429 Ga0207712_10743899 3300025961 Unclassified 858
430 Ga0207640_10224749 3300025981 Bacteria 1440
431 Ga0207658_10072415 3300025986 Unclassified 2612
432 Ga0207677_10294710 3300026023 Unclassified 1338
433 Ga0207677_10318233 3300026023 Bacteria 1292
434 Ga0207677_10523112 3300026023 Unclassified 1029
435 Ga0207703_10073895 3300026035 Unclassified 2821
436 Ga0207703_10395873 3300026035 Unclassified 1281
437 Ga0207703_10541306 3300026035 Unclassified 1097
438 Ga0207703_10567333 3300026035 Bacteria 1071
439 Ga0207703_11095494 3300026035 Unclassified 765
440 Ga0207703_11131794 3300026035 Unclassified 752
441 Ga0207703_11340638 3300026035 Unclassified 688
442 Ga0207639_10084203 3300026041 Bacteria 2525
443 Ga0207639_11600718 3300026041 Unclassified 611
444 Ga0207708_10000063 3300026075 Bacteria 87390
445 Ga0207708_10058923 3300026075 Bacteria 2930
446 Ga0207708_10079509 3300026075 Bacteria 2519
447 Ga0207641_10009707 3300026088 Bacteria 7930
448 Ga0207641_10535496 3300026088 Bacteria 1141
449 Ga0207641_10609618 3300026088 Unclassified 1069
450 Ga0207641_10731027 3300026088 Unclassified 976
451 Ga0207641_10905543 3300026088 Unclassified 876
452 Ga0207648_10025685 3300026089 Bacteria 5244
453 Ga0207648_10035316 3300026089 Unclassified 4404
454 Ga0207676_10008611 3300026095 Bacteria 7250
455 Ga0207676_10014292 3300026095 Bacteria 5708
456 Ga0207676_10127640 3300026095 Bacteria 2157
457 Ga0207676_10168333 3300026095 Bacteria 1907
458 Ga0207676_10507972 3300026095 Bacteria 1145
459 Ga0207676_10830049 3300026095 Unclassified 903
460 Ga0207674_10106764 3300026116 Bacteria 2777
461 Ga0207674_10159329 3300026116 Bacteria 2212
462 Ga0207674_10406716 3300026116 Unclassified 1315
463 Ga0207675_100013773 3300026118 Bacteria 7543
464 Ga0207675_100025910 3300026118 Bacteria 5456
465 Ga0207675_100077424 3300026118 Bacteria 3115
466 Ga0207683_10018607 3300026121 Bacteria 5928
467 Ga0207683_10080241 3300026121 Unclassified 2894
468 Ga0207698_11159080 3300026142 Unclassified 786
469 Ga0207428_10009206 3300027907 Bacteria 8871
470 Ga0268266_11623318 3300028379 Unclassified 622
471 Ga0268265_10106753 3300028380 Unclassified 2275
472 Ga0268265_11033351 3300028380 Unclassified 813
473 Ga0268264_10084752 3300028381 Bacteria 2718
474 Ga0268264_10134070 3300028381 Bacteria 2200
475 Ga0268264_10178698 3300028381 Bacteria 1926
476 Ga0268264_10637635 3300028381 Bacteria 1053
477 Ga0268264_10659402 3300028381 Unclassified 1036
478 Ga0268264_12417435 3300028381 Unclassified 531
479 Ga0307405_10229609 3300031731 Unclassified 1367
480 Ga0307413_10030357 3300031824 Unclassified 3036
481 Ga0307406_10038978 3300031901 Unclassified 2944
482 Ga0307406_11062657 3300031901 Unclassified 697
483 Ga0307407_10572667 3300031903 Unclassified 837
484 Ga0307412_10021285 3300031911 Bacteria 3959
485 Ga0307412_11052109 3300031911 Bacteria 722
486 Ga0307409_100368676 3300031995 Unclassified 1361
487 Ga0307416_100009286 3300032002 Bacteria 6427
488 Ga0307414_10060642 3300032004 Unclassified 2676
489 Ga0307411_10005118 3300032005 Bacteria 6401
490 Ga0307415_102306185 3300032126 Unclassified 528
491 Ga0373959_0134914 3300034820 Bacteria 613
492 Ga0373949_0062871 3300035090 Bacteria 959
493 Ga0373949_0092510 3300035090 Unclassified 820
494 Ga0373939_0162113 3300035114 Unclassified 822
495 Ga0373941_0007727 3300035115 Unclassified 2642
496 Ga0373931_0649867 3300035691 Unclassified 693
497 Ga0373937_0054570 3300036401 Bacteria 3668
498 Ga0395899_0609834 3300037312 Unclassified 694
499 Ga0395900_0409831 3300037418 Bacteria 1318
500 Ga0395900_1089508 3300037418 Unclassified 716
501 Ga0242422_04323 3300038699 Bacteria 897
502 Ga0439448_0004553 3300042005 Bacteria 3915
503 Ga0439455_0022060 3300042012 Bacteria 1523
504 Ga0439458_0002671 3300042157 Bacteria 4304
505 Ga0439444_0051257 3300042437 Unclassified 839
506 Ga0453683_0225575 3300044673 Unclassified 1192
507 Ga0451576_0573986 3300045051 Unclassified 1185
508 Ga0451576_1802261 3300045051 Unclassified 633
509 Ga0451576_1900190 3300045051 Bacteria 614
510 Ga0495621_0254356 3300046539 Unclassified 718
511 Ga0495658_0297362 3300046683 Bacteria 1021
512 Ga0495672_0095772 3300047320 Bacteria 1620
513 Ga0496102_0560895 3300048905 Bacteria 1065
514 Ga0496106_0913007 3300048909 Bacteria 693
515 Ga0496108_0129164 3300048911 Bacteria 2172
516 Ga0496112_0281349 3300048915 Bacteria 1611
517 Ga0496112_0325848 3300048915 Bacteria 1480
518 Ga0496112_0942004 3300048915 Unclassified 785
519 Ga0501292_004922 3300049515 Bacteria 1847
520 Ga0501297_078987 3300049520 Unclassified 531
521 Ga0501298_108925 3300049521 Unclassified 640
522 Ga0501299_157183 3300049522 Unclassified 578
523 Ga0501207_014042 3300049654 Unclassified 1219
524 Ga0501208_165117 3300049655 Unclassified 505
525 Ga0501217_074256 3300049661 Bacteria 931
526 Ga0501223_006830 3300049663 Bacteria 2346
527 Ga0501224_033293 3300049664 Unclassified 773
528 Ga0501233_089180 3300049668 Unclassified 803
529 Ga0501243_008375 3300049675 Unclassified 1592
530 Ga0501249_024204 3300049679 Bacteria 1337
531 Ga0501252_076961 3300049682 Unclassified 547
532 Ga0501257_006605 3300049686 Bacteria 2575
533 Ga0501257_034939 3300049686 Bacteria 1221
534 Ga0501225_0002504 3300049705 Bacteria 5686
535 Ga0501268_035056 3300049765 Bacteria 924
536 nmdc:mga05p37_23028_c1 3300050507 Bacteria 7556
537 nmdc:mga05p37_54714_c1 3300050507 Bacteria 4909
538 nmdc:mga09592_152067_c1 3300050508 Bacteria 1997
539 nmdc:mga0qj67_468031_c1 3300050509 Unclassified 1015
540 nmdc:mga06r32_1228028_c1 3300050510 Bacteria 695
541 nmdc:mga06r32_1460740_c1 3300050510 Unclassified 625
542 nmdc:mga08y16_15429_c1 3300050511 Bacteria 8034
543 nmdc:mga08y16_1795932_c1 3300050511 Unclassified 566
544 nmdc:mga0n895_1331022_c1 3300050512 Bacteria 688
545 nmdc:mga0a205_112918_c2 3300050515 Bacteria 1615
546 nmdc:mga0a205_209096_c1 3300050515 Bacteria 1840
547 nmdc:mga0a205_279565_c1 3300050515 Unclassified 1545
548 nmdc:mga0a205_55927_c1 3300050515 Bacteria 3810
549 nmdc:mga0a205_681451_c1 3300050515 Unclassified 878
550 Ga0075434_100476425
551 SwRhRL2b_contig_1478571
552 SwRhRL2b_contig_751808
553 MRS1b_contig_352233
554 MBSR1b_contig_2331052
555 MBSR1b_contig_6335267
556 MBSR1b_contig_9475842
557 CNAas_1001141
558 Ga0065704_10001430
559 Ga0065704_10407841
560 Ga0065712_10001509
561 Ga0065712_10107353
562 Ga0065715_10093662
563 Ga0065715_10096122
564 Ga0065715_10108769
565 Ga0065715_10117565
566 Ga0065715_10276927
567 Ga0065715_10338311
568 Ga0065715_10514903
569 Ga0065715_10750373
570 Ga0065715_10917995
571 Ga0065707_10106887
572 Ga0065707_10139535
573 Ga0070676_10041759
574 Ga0070676_11311655
575 Ga0070690_100005890
576 Ga0070690_100058160
577 Ga0070690_100203406
578 Ga0070670_100044506
579 Ga0070670_100190413
580 Ga0070670_100393368
581 Ga0070670_101059429
582 Ga0070670_101388455
583 Ga0068869_100047423
584 Ga0068869_100182270
585 Ga0068869_100263297
586 Ga0068869_100342208
587 Ga0068869_100372616
588 Ga0068869_100561987
589 Ga0068869_101253610
590 Ga0070666_10040349
591 Ga0070666_10281707
592 Ga0070680_101317913
593 Ga0070680_101379964
594 Ga0070682_100003162
595 Ga0070682_100048048
596 Ga0068868_100059314
597 Ga0068868_100295778
598 Ga0068868_100416007
599 Ga0068868_102338314
600 Ga0070660_101683376
601 Ga0070689_100000612
602 Ga0070689_100012650
603 Ga0070689_100040418
604 Ga0070689_101211386
605 Ga0070687_100014777
606 Ga0070687_100019663
607 Ga0070661_100588717
608 Ga0070692_10005544
609 Ga0070692_10025217
610 Ga0070692_10131295
611 Ga0070692_10171970
612 Ga0070692_10357803
613 Ga0070669_100039016
614 Ga0070669_101498718
615 Ga0070675_100282482
616 Ga0070675_100307203
617 Ga0070675_100553704
618 Ga0070671_100024666
619 Ga0070671_100129049
620 Ga0070671_100180069
621 Ga0070674_100209821
622 Ga0070673_100132459
623 Ga0070673_100156652
624 Ga0070673_100276336
625 Ga0070673_102043457
626 Ga0070688_100021792
627 Ga0070659_100901527
628 Ga0070667_100059988
629 Ga0070667_100092541
630 Ga0070703_10002705
631 Ga0070705_100048924
632 Ga0070705_100067135
633 Ga0070705_100103836
634 Ga0070705_100195245
635 Ga0070705_101368548
636 Ga0070700_100003339
637 Ga0070700_101128427
638 Ga0070694_100007740
639 Ga0070694_100034861
640 Ga0070694_100041570
641 Ga0070694_100119436
642 Ga0070694_100300984
643 Ga0070694_100728748
644 Ga0070694_100781833
645 Ga0070694_100794726
646 Ga0070694_101357409
647 Ga0070708_100000002
648 Ga0070708_100426190
649 Ga0070708_100562008
650 Ga0070678_102026187
651 Ga0070662_101428569
652 Ga0070681_10019878
653 Ga0068867_100016556
654 Ga0068867_100158219
655 Ga0070685_10027217
656 Ga0070706_100004799
657 Ga0070706_100018991
658 Ga0070706_100167934
659 Ga0070706_100500249
660 Ga0070707_100004645
661 Ga0070707_100057256
662 Ga0070698_100026663
663 Ga0070698_100057398
664 Ga0070698_100478801
665 Ga0070699_100000737
666 Ga0070699_100020487
667 Ga0070699_100037773
668 Ga0070699_100919792
669 Ga0070699_101249095
670 Ga0070697_100006584
671 Ga0070697_100134066
672 Ga0070697_100277179
673 Ga0070697_101091685
674 Ga0070697_101522792
675 Ga0068853_100048217
676 Ga0068853_100339238
677 Ga0070672_100035713
678 Ga0070672_100156745
679 Ga0070686_100026452
680 Ga0070695_100122861
681 Ga0070695_100218244
682 Ga0070695_100254973
683 Ga0070695_100291452
684 Ga0070695_100312368
685 Ga0070695_101004413
686 Ga0070695_101191450
687 Ga0070695_101340405
688 Ga0070695_101633019
689 Ga0070696_100105213
690 Ga0070696_100166635
691 Ga0070696_100249226
692 Ga0070696_100889701
693 Ga0070693_100000903
694 Ga0070693_100020438
695 Ga0070693_100069752
696 Ga0070693_100078722
697 Ga0070693_100855683
698 Ga0070665_100365152
699 Ga0070704_100025661
700 Ga0070704_100135843
701 Ga0070704_100210443
702 Ga0070704_100558635
703 Ga0068855_100072964
704 Ga0070664_100053077
705 Ga0070664_100340781
706 Ga0068857_100172245
707 Ga0068857_100185730
708 Ga0068857_100661506
709 Ga0068857_100816388
710 Ga0068857_101632513
711 Ga0068854_100055430
712 Ga0068854_100360417
713 Ga0068854_100658849
714 Ga0070702_100006571
715 Ga0070702_100017083
716 Ga0070702_100029631
717 Ga0070702_100514005
718 Ga0070702_100795052
719 Ga0070702_101499481
720 Ga0068852_100219219
721 Ga0068852_102433202
722 Ga0068859_100017761
723 Ga0068859_100053862
724 Ga0068859_100082993
725 Ga0068859_100107599
726 Ga0068859_100159968
727 Ga0068859_100289635
728 Ga0068859_100725222
729 Ga0068859_100997684
730 Ga0068859_101131513
731 Ga0068859_101527621
732 Ga0068864_100042088
733 Ga0068864_100045580
734 Ga0068864_100625439
735 Ga0068864_100862842
736 Ga0068864_100911542
737 Ga0068866_10004032
738 Ga0068866_10124677
739 Ga0068866_10570938
740 Ga0068861_100017661
741 Ga0068861_100138648
742 Ga0068861_101226245
743 Ga0068861_101911208
744 Ga0068851_10001871
745 Ga0068851_10379013
746 Ga0068851_10434139
747 Ga0068870_10194178
748 Ga0068863_100017530
749 Ga0068863_100128484
750 Ga0068863_101018812
751 Ga0068863_101903022
752 Ga0068858_100092131
753 Ga0068858_100103976
754 Ga0068858_100138130
755 Ga0068858_100254717
756 Ga0068858_100515183
757 Ga0068858_100515926
758 Ga0068858_100857966
759 Ga0068860_100021560
760 Ga0068860_100072920
761 Ga0068860_100096142
762 Ga0068860_100359941
763 Ga0068862_100016377
764 Ga0068862_101742480
765 Ga0068862_101823994
766 Ga0097621_100002105
767 Ga0097621_100007513
768 Ga0097621_100065509
769 Ga0097621_100444140
770 Ga0068871_100003157
771 Ga0068871_100005138
772 Ga0068871_100066371
773 Ga0068871_100161049
774 Ga0068871_100434874
775 Ga0075428_100415217
776 Ga0075428_102320113
777 Ga0075430_100531989
778 Ga0075431_100288858
779 Ga0075431_100498162
780 Ga0075431_102182564
781 Ga0075433_10144822
782 Ga0075433_10189392
783 Ga0075433_10278593
784 Ga0075433_10475432
785 Ga0075433_10664837
786 Ga0075433_10711753
787 Ga0075433_10743488
788 Ga0075434_101627701
789 Ga0075434_102458146
790 Ga0075429_100103940
791 Ga0075429_100755266
792 Ga0068865_100977054
793 Ga0097620_100017761
794 Ga0097620_100053860
795 Ga0097620_100082992
796 Ga0097620_100107605
797 Ga0097620_100159963
798 Ga0097620_100289632
799 Ga0097620_100725224
800 Ga0097620_100997681
801 Ga0097620_101131518
802 Ga0097620_101527487
803 Ga0075435_101465566
804 Ga0099794_10190010
805 Ga0105251_10063863
806 Ga0105251_10513458
807 Ga0111539_10038957
808 Ga0111539_10396034
809 Ga0105245_10022958
810 Ga0105245_10311449
811 Ga0105245_10713412
812 Ga0105247_10001282
813 Ga0105247_10617100
814 Ga0105247_11598214
815 Ga0114129_10013646
816 Ga0114129_10035246
817 Ga0114129_10496174
818 Ga0114129_11147881
819 Ga0105243_10007873
820 Ga0105243_10244182
821 Ga0105243_10918160
822 Ga0105243_12040294
823 Ga0105241_10008276
824 Ga0105241_10138671
825 Ga0105241_10307852
826 Ga0105241_10358583
827 Ga0105241_11070618
828 Ga0105241_12371479
829 Ga0105242_10031724
830 Ga0105242_10387222
831 Ga0105242_11486485
832 Ga0105248_10006824
833 Ga0105248_10025648
834 Ga0105248_10236387
835 Ga0105248_10674541
836 Ga0105248_10893007
837 Ga0105248_11523982
838 Ga0105248_12325024
839 Ga0105237_10000623
840 Ga0105237_10804721
841 Ga0105238_10002542
842 Ga0105249_10082173
843 Ga0105249_10149047
844 Ga0105249_10423842
845 Ga0105249_10835516
846 Ga0105239_10263214
847 Ga0105239_10806988
848 Ga0105246_10105687
849 Ga0105246_10327567
850 Ga0105246_10443986
851 Ga0105246_10757474
852 Ga0105246_11087455
853 Ga0105246_11151545
854 Ga0157342_1036639
855 Ga0157373_10058093
856 Ga0157373_10346676
857 Ga0157371_10303191
858 Ga0157374_10012044
859 Ga0157374_10053315
860 Ga0157374_10871264
861 Ga0157374_11441840
862 Ga0157378_10000124
863 Ga0157378_10057801
864 Ga0157378_10784093
865 Ga0157378_10933278
866 Ga0157378_11713217
867 Ga0163162_10001242
868 Ga0163162_10031242
869 Ga0163162_10038376
870 Ga0163162_10882639
871 Ga0157372_10007544
872 Ga0157372_10541277
873 Ga0157375_10042472
874 Ga0157375_10059184
875 Ga0157375_10068207
876 Ga0157375_10555613
877 Ga0157375_10753662
878 Ga0157375_10970824
879 Ga0157375_11209108
880 Ga0157375_12340424
881 Ga0157375_13082038
882 Ga0163163_10001013
883 Ga0163163_10022553
884 Ga0163163_10051050
885 Ga0163163_10089001
886 Ga0163163_10120056
887 Ga0163163_10190121
888 Ga0163163_10494873
889 Ga0163163_10647508
890 Ga0157380_10207878
891 Ga0157380_10630124
892 Ga0157377_10011015
893 Ga0157377_10235766
894 Ga0157377_10638531
895 Ga0157379_10074645
896 Ga0157376_10004750
897 Ga0157376_10011606
898 Ga0157376_10071405
899 Ga0182005_1149188
900 Ga0163161_10010511
901 Ga0207697_10011112
902 Ga0207656_10048032
903 Ga0207656_10582201
904 Ga0207653_10019334
905 Ga0207642_10110848
906 Ga0207642_10929053
907 Ga0207710_10000737
908 Ga0207688_10309821
909 Ga0207680_10030609
910 Ga0207680_10943643
911 Ga0207647_10041000
912 Ga0207647_10082105
913 Ga0207647_10489429
914 Ga0207645_10075311
915 Ga0207643_10001198
916 Ga0207643_10989927
917 Ga0207684_10039002
918 Ga0207684_10228489
919 Ga0207684_10441620
920 Ga0207684_10777034
921 Ga0207654_10135599
922 Ga0207654_10259480
923 Ga0207654_10595837
924 Ga0207654_10638897
925 Ga0207707_10019143
926 Ga0207695_10245431
927 Ga0207671_10001989
928 Ga0207671_10037818
929 Ga0207662_10013862
930 Ga0207662_10022710
931 Ga0207646_10092418
932 Ga0207681_10752551
933 Ga0207650_10049670
934 Ga0207650_10092966
935 Ga0207650_10567297
936 Ga0207650_11717196
937 Ga0207659_10077262
938 Ga0207659_10099963
939 Ga0207659_10258396
940 Ga0207687_10130226
941 Ga0207687_10458223
942 Ga0207644_10015389
943 Ga0207644_10065898
944 Ga0207644_10429507
945 Ga0207690_11499521
946 Ga0207686_10268785
947 Ga0207709_10116861
948 Ga0207670_10001692
949 Ga0207670_10523536
950 Ga0207670_10533816
951 Ga0207669_10396153
952 Ga0207704_10803769
953 Ga0207704_10818860
954 Ga0207691_10002677
955 Ga0207691_10123619
956 Ga0207691_10344343
957 Ga0207691_11587660
958 Ga0207711_10041430
959 Ga0207711_10111676
960 Ga0207711_10744533
961 Ga0207711_10988290
962 Ga0207711_11136268
963 Ga0207711_11393878
964 Ga0207689_10015191
965 Ga0207689_10019472
966 Ga0207689_10067418
967 Ga0207689_10104167
968 Ga0207689_10164489
969 Ga0207679_10221058
970 Ga0207667_10222853
971 Ga0207651_10366608
972 Ga0207651_10551623
973 Ga0207651_11015233
974 Ga0207712_10095287
975 Ga0207712_10262976
976 Ga0207712_10289200
977 Ga0207712_10404881
978 Ga0207712_10743899
979 Ga0207640_10224749
980 Ga0207658_10072415
981 Ga0207677_10294710
982 Ga0207677_10318233
983 Ga0207677_10523112
984 Ga0207703_10073895
985 Ga0207703_10395873
986 Ga0207703_10541306
987 Ga0207703_10567333
988 Ga0207703_11095494
989 Ga0207703_11131794
990 Ga0207703_11340638
991 Ga0207639_10084203
992 Ga0207639_11600718
993 Ga0207708_10000063
994 Ga0207708_10058923
995 Ga0207708_10079509
996 Ga0207641_10009707
997 Ga0207641_10535496
998 Ga0207641_10609618
999 Ga0207641_10731027
1000 Ga0207641_10905543
1001 Ga0207648_10025685
1002 Ga0207648_10035316
1003 Ga0207676_10008611
1004 Ga0207676_10014292
1005 Ga0207676_10127640
1006 Ga0207676_10168333
1007 Ga0207676_10507972
1008 Ga0207676_10830049
1009 Ga0207674_10106764
1010 Ga0207674_10159329
1011 Ga0207674_10406716
1012 Ga0207675_100013773
1013 Ga0207675_100025910
1014 Ga0207675_100077424
1015 Ga0207683_10018607
1016 Ga0207683_10080241
1017 Ga0207698_11159080
1018 Ga0207428_10009206
1019 Ga0268266_11623318
1020 Ga0268265_10106753
1021 Ga0268265_11033351
1022 Ga0268264_10084752
1023 Ga0268264_10134070
1024 Ga0268264_10178698
1025 Ga0268264_10637635
1026 Ga0268264_10659402
1027 Ga0268264_12417435
1028 Ga0307405_10229609
1029 Ga0307413_10030357
1030 Ga0307406_10038978
1031 Ga0307406_11062657
1032 Ga0307407_10572667
1033 Ga0307412_10021285
1034 Ga0307412_11052109
1035 Ga0307409_100368676
1036 Ga0307416_100009286
1037 Ga0307414_10060642
1038 Ga0307411_10005118
1039 Ga0307415_102306185
1040 Ga0373959_0134914
1041 Ga0373949_0062871
1042 Ga0373949_0092510
1043 Ga0373939_0162113
1044 Ga0373941_0007727
1045 Ga0373931_0649867
1046 Ga0373937_0054570
1047 Ga0395899_0609834
1048 Ga0395900_0409831
1049 Ga0395900_1089508
1050 Ga0242422_04323
1051 Ga0439448_0004553
1052 Ga0439455_0022060
1053 Ga0439458_0002671
1054 Ga0439444_0051257
1055 Ga0453683_0225575
1056 Ga0451576_0573986
1057 Ga0451576_1802261
1058 Ga0451576_1900190
1059 Ga0495621_0254356
1060 Ga0495658_0297362
1061 Ga0495672_0095772
1062 Ga0496102_0560895
1063 Ga0496106_0913007
1064 Ga0496108_0129164
1065 Ga0496112_0281349
1066 Ga0496112_0325848
1067 Ga0496112_0942004
1068 Ga0501292_004922
1069 Ga0501297_078987
1070 Ga0501298_108925
1071 Ga0501299_157183
1072 Ga0501207_014042
1073 Ga0501208_165117
1074 Ga0501217_074256
1075 Ga0501223_006830
1076 Ga0501224_033293
1077 Ga0501233_089180
1078 Ga0501243_008375
1079 Ga0501249_024204
1080 Ga0501252_076961
1081 Ga0501257_006605
1082 Ga0501257_034939
1083 Ga0501225_0002504
1084 Ga0501268_035056
1085 nmdc:mga05p37_23028_c1
1086 nmdc:mga05p37_54714_c1
1087 nmdc:mga09592_152067_c1
1088 nmdc:mga0qj67_468031_c1
1089 nmdc:mga06r32_1228028_c1
1090 nmdc:mga06r32_1460740_c1
1091 nmdc:mga08y16_15429_c1
1092 nmdc:mga08y16_1795932_c1
1093 nmdc:mga0n895_1331022_c1
1094 nmdc:mga0a205_112918_c2
1095 nmdc:mga0a205_209096_c1
1096 nmdc:mga0a205_279565_c1
1097 nmdc:mga0a205_55927_c1
1098 nmdc:mga0a205_681451_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

34

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.8384 20 110
4xrn-assembly2.cif.gz_B pilz domain with c-di-gmp of a protein from pseudomonas aeruginosa 0.8258 20 109
5vx6-assembly1.cif.gz_A structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.8252 21 110
5y4r-assembly1.cif.gz_D structure of a methyltransferase complex 0.8181 22 110
5y6f-assembly1.cif.gz_A crystal structure of ycgr in complex with c-di-gmp from escherichia coli 0.7997 19 110
ID Description Score Start End Superfamily
5y4rC00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8219 22 110 2.40.10.220
4xrnD00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7793 17 109 2.40.10.220
5ejzA03 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7734 20 111 2.40.10.220
af_O07175_267_353_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.7721 56 84 2.30.42.10
4i86B00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.757 21 110 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A2V8SIH0-F1-model_v4 PilZ domain-containing protein 0.9755 25 111 GO:0035438
AF-A0A838PAD4-F1-model_v4 PilZ domain-containing protein 0.9541 42 110 GO:0035438
AF-A0A2V8SIH0-F1-model_v4 PilZ domain-containing protein 0.9538 25 111 GO:0035438
AF-A0A7W0MHR4-F1-model_v4 PilZ domain-containing protein 0.9435 22 110 GO:0035438
AF-A0A258VAJ3-F1-model_v4 PilZ domain-containing protein 0.9395 26 110 GO:0035438

Map