F462325

General Info

Members Datasets Scaffolds Average Seq Length
549 261 545 146

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100403177|Ga0070713_1004031771
Length 159
Sequence MPVATRAAWRKPVPVRFQLVIDCADPDRLARFWAAALGYELAPVPAGFATWNDFYRELGVPEEELVDGADRISDPQGHGPSIWFHVVPDAKAVKNRLHLDIHASGERTDSIETRRMRVDAEASRLSGLGATITGALPEEGMDHYAVGMKDPEGNEFDIN

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2862574272 Streptomyces sp. AcE210 Isolate Nodule
4 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
154 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
259 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
260 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 1.28
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0.18
Rhizoplane 9.11
Rhizosphere 88.34
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10390104 3300005327 Bacteria 1195
2 Ga0070683_100336329 3300005329 Bacteria 1438
3 Ga0070690_100423409 3300005330 Bacteria 982
4 Ga0070680_100187081 3300005336 Bacteria 1744
5 Ga0068868_100108562 3300005338 Bacteria 2252
6 Ga0070660_100640277 3300005339 Bacteria 890
7 Ga0070689_100317684 3300005340 Bacteria 1300
8 Ga0070691_10094381 3300005341 Bacteria 1479
9 Ga0070661_100794980 3300005344 Bacteria 776
10 Ga0070675_100438506 3300005354 Bacteria 1170
11 Ga0070671_100350595 3300005355 Bacteria 1260
12 Ga0070673_100255448 3300005364 Bacteria 1529
13 Ga0070659_100939574 3300005366 Bacteria 757
14 Ga0070709_10029204 3300005434 Bacteria 3296
15 Ga0070709_10108063 3300005434 Bacteria 1865
16 Ga0070709_10112002 3300005434 Bacteria 1835
17 Ga0070714_100003216 3300005435 Bacteria 12153
18 Ga0070714_100013335 3300005435 Bacteria 6586
19 Ga0070714_100021844 3300005435 Bacteria 5240
20 Ga0070714_100077393 3300005435 Bacteria 2889
21 Ga0070714_100170219 3300005435 Bacteria 1976
22 Ga0070714_100177506 3300005435 Bacteria 1936
23 Ga0070714_100292660 3300005435 Bacteria 1516
24 Ga0070714_100389988 3300005435 Bacteria 1314
25 Ga0070713_100001723 3300005436 Bacteria 14082
26 Ga0070713_100065369 3300005436 Bacteria 3055
27 Ga0070713_100073786 3300005436 Bacteria 2889
28 Ga0070713_100310765 3300005436 Bacteria 1453
29 Ga0070713_100344305 3300005436 Bacteria 1382
30 Ga0070713_100403177 3300005436 Bacteria 1277
31 Ga0070713_100479585 3300005436 Bacteria 1171
32 Ga0070713_100610737 3300005436 Bacteria 1036
33 Ga0070710_10014750 3300005437 Bacteria 3938
34 Ga0070710_10096638 3300005437 Bacteria 1751
35 Ga0070710_10145693 3300005437 Bacteria 1456
36 Ga0070710_10185771 3300005437 Bacteria 1304
37 Ga0070711_100022377 3300005439 Bacteria 4097
38 Ga0070711_100032325 3300005439 Bacteria 3478
39 Ga0070711_100045608 3300005439 Bacteria 2983
40 Ga0070711_100047469 3300005439 Bacteria 2932
41 Ga0070705_100359066 3300005440 Bacteria 1065
42 Ga0070708_100017074 3300005445 Bacteria 6043
43 Ga0070708_100034575 3300005445 Bacteria 4398
44 Ga0070708_100038151 3300005445 Bacteria 4196
45 Ga0070708_100232644 3300005445 Bacteria 1729
46 Ga0070708_101301221 3300005445 Bacteria 679
47 Ga0070663_100040219 3300005455 Bacteria 3272
48 Ga0070678_100393219 3300005456 Bacteria 1203
49 Ga0070681_10019276 3300005458 Bacteria 6825
50 Ga0070681_10081572 3300005458 Bacteria 3190
51 Ga0068867_101475354 3300005459 Bacteria 633
52 Ga0070706_100003993 3300005467 Bacteria 14361
53 Ga0070706_100004504 3300005467 Bacteria 13424
54 Ga0070706_100018504 3300005467 Bacteria 6423
55 Ga0070706_100484571 3300005467 Bacteria 1151
56 Ga0070706_101043060 3300005467 Bacteria 753
57 Ga0070707_100003743 3300005468 Bacteria 14354
58 Ga0070707_100004726 3300005468 Bacteria 12764
59 Ga0070707_100078585 3300005468 Bacteria 3183
60 Ga0070707_100202380 3300005468 Bacteria 1935
61 Ga0070707_100342473 3300005468 Bacteria 1452
62 Ga0070698_100006410 3300005471 Bacteria 12764
63 Ga0070698_100014708 3300005471 Bacteria 8265
64 Ga0070698_100015939 3300005471 Bacteria 7936
65 Ga0070698_100031905 3300005471 Bacteria 5460
66 Ga0070699_100001840 3300005518 Bacteria 19262
67 Ga0070699_100140687 3300005518 Bacteria 2131
68 Ga0070679_100767011 3300005530 Bacteria 907
69 Ga0070684_100667519 3300005535 Bacteria 968
70 Ga0070697_100010086 3300005536 Bacteria 7369
71 Ga0070697_100191889 3300005536 Bacteria 1734
72 Ga0068853_100654110 3300005539 Bacteria 1000
73 Ga0070672_101355217 3300005543 Bacteria 636
74 Ga0070695_100492583 3300005545 Bacteria 946
75 Ga0070696_100366852 3300005546 Bacteria 1119
76 Ga0070693_100104019 3300005547 Bacteria 1735
77 Ga0070665_100001773 3300005548 Bacteria 24574
78 Ga0070665_100029301 3300005548 Bacteria 5540
79 Ga0068855_100042136 3300005563 Bacteria 5410
80 Ga0068855_100076429 3300005563 Bacteria 3886
81 Ga0070664_100933493 3300005564 Unclassified 814
82 Ga0068857_100870218 3300005577 Bacteria 863
83 Ga0068856_100120733 3300005614 Bacteria 2622
84 Ga0068856_100126636 3300005614 Bacteria 2557
85 Ga0068856_100672419 3300005614 Bacteria 1056
86 Ga0068852_100155982 3300005616 Bacteria 2127
87 Ga0068852_100216817 3300005616 Bacteria 1818
88 Ga0068859_100615629 3300005617 Bacteria 1179
89 Ga0068864_100175286 3300005618 Bacteria 1957
90 Ga0068861_100819218 3300005719 Bacteria 875
91 Ga0068851_10485445 3300005834 Bacteria 739
92 Ga0068863_100018786 3300005841 Bacteria 6615
93 Ga0068858_100028597 3300005842 Bacteria 5177
94 Ga0068860_100056438 3300005843 Bacteria 3733
95 Ga0081455_10259285 3300005937 Bacteria 1267
96 Ga0081455_10419419 3300005937 Unclassified 923
97 Ga0070717_10052210 3300006028 Bacteria 3367
98 Ga0070717_10056246 3300006028 Bacteria 3249
99 Ga0070717_10067905 3300006028 Bacteria 2967
100 Ga0070717_10083120 3300006028 Bacteria 2692
101 Ga0070717_10091010 3300006028 Bacteria 2575
102 Ga0070717_10098603 3300006028 Bacteria 2477
103 Ga0070717_10119488 3300006028 Bacteria 2256
104 Ga0070717_10184412 3300006028 Bacteria 1820
105 Ga0070717_10188673 3300006028 Bacteria 1800
106 Ga0070717_10315200 3300006028 Bacteria 1393
107 Ga0070717_10514566 3300006028 Bacteria 1082
108 Ga0075365_10124849 3300006038 Bacteria 1778
109 Ga0070715_10042823 3300006163 Bacteria 1905
110 Ga0070715_10277055 3300006163 Bacteria 887
111 Ga0070715_10515841 3300006163 Bacteria 687
112 Ga0070716_100000834 3300006173 Bacteria 13301
113 Ga0070716_100007749 3300006173 Bacteria 5301
114 Ga0070716_100013790 3300006173 Bacteria 4126
115 Ga0070716_100028911 3300006173 Bacteria 2991
116 Ga0070716_100058436 3300006173 Bacteria 2219
117 Ga0070716_100060886 3300006173 Bacteria 2182
118 Ga0070712_100100058 3300006175 Bacteria 2141
119 Ga0070712_100269866 3300006175 Bacteria 1366
120 Ga0070712_100315063 3300006175 Bacteria 1271
121 Ga0070712_100477669 3300006175 Bacteria 1042
122 Ga0097621_100110133 3300006237 Bacteria 2326
123 Ga0097621_101645323 3300006237 Bacteria 611
124 Ga0068871_100272902 3300006358 Bacteria 1478
125 Ga0075428_100000913 3300006844 Bacteria 31224
126 Ga0075433_11628469 3300006852 Bacteria 556
127 Ga0075434_100003103 3300006871 Bacteria 14794
128 Ga0075434_100111416 3300006871 Bacteria 2747
129 Ga0075434_100370189 3300006871 Bacteria 1454
130 Ga0075434_100536059 3300006871 Bacteria 1190
131 Ga0068865_100350622 3300006881 Bacteria 1196
132 Ga0075436_100016606 3300006914 Bacteria 5039
133 Ga0075436_100126519 3300006914 Bacteria 1791
134 Ga0075436_100188068 3300006914 Bacteria 1461
135 Ga0075436_100396326 3300006914 Bacteria 1000
136 Ga0097620_100615631 3300006931 Bacteria 1179
137 Ga0075435_100002123 3300007076 Bacteria 13060
138 Ga0075435_100078552 3300007076 Bacteria 2707
139 Ga0075435_100292733 3300007076 Bacteria 1391
140 Ga0075435_100415275 3300007076 Bacteria 1159
141 Ga0099794_10127954 3300007265 Bacteria 1281
142 Ga0099795_10064748 3300007788 Bacteria 1365
143 Ga0105251_10115751 3300009011 Bacteria 1219
144 Ga0105240_10087369 3300009093 Bacteria 3819
145 Ga0105240_10097567 3300009093 Bacteria 3581
146 Ga0111539_11164484 3300009094 Bacteria 896
147 Ga0105245_10031853 3300009098 Bacteria 4668
148 Ga0105245_10328136 3300009098 Bacteria 1509
149 Ga0105247_10033726 3300009101 Bacteria 3116
150 Ga0105243_10408982 3300009148 Bacteria 1262
151 Ga0105241_10008005 3300009174 Bacteria 7775
152 Ga0105241_10041802 3300009174 Bacteria 3465
153 Ga0105242_10959107 3300009176 Bacteria 860
154 Ga0105248_10015122 3300009177 Bacteria 8500
155 Ga0105248_10697567 3300009177 Bacteria 1145
156 Ga0105237_10456376 3300009545 Bacteria 1284
157 Ga0105237_11650635 3300009545 Bacteria 648
158 Ga0105238_10049368 3300009551 Bacteria 4239
159 Ga0105238_10059290 3300009551 Bacteria 3834
160 Ga0105238_10117612 3300009551 Unclassified 2638
161 Ga0105238_10167320 3300009551 Bacteria 2174
162 Ga0105238_11566081 3300009551 Bacteria 688
163 Ga0105249_10070573 3300009553 Bacteria 3225
164 Ga0105249_10636256 3300009553 Bacteria 1124
165 Ga0099796_10181458 3300010159 Bacteria 845
166 Ga0105239_10661841 3300010375 Bacteria 1193
167 Ga0105246_10007607 3300011119 Bacteria 6646
168 Ga0157373_10303837 3300013100 Bacteria 1133
169 Ga0157373_10362321 3300013100 Bacteria 1035
170 Ga0157371_10221359 3300013102 Bacteria 1359
171 Ga0157370_10144732 3300013104 Bacteria 2213
172 Ga0157369_10154832 3300013105 Bacteria 2422
173 Ga0157369_10822605 3300013105 Bacteria 954
174 Ga0157374_10097982 3300013296 Bacteria 2806
175 Ga0157374_10650177 3300013296 Bacteria 1066
176 Ga0157374_12246318 3300013296 Bacteria 573
177 Ga0157378_10374415 3300013297 Bacteria 1397
178 Ga0163162_11142317 3300013306 Bacteria 883
179 Ga0157372_10992051 3300013307 Bacteria 973
180 Ga0157372_11296355 3300013307 Bacteria 841
181 Ga0163163_10031931 3300014325 Bacteria 5085
182 Ga0163163_10782486 3300014325 Bacteria 1017
183 Ga0157377_10495568 3300014745 Bacteria 853
184 Ga0157376_10222186 3300014969 Bacteria 1750
185 Ga0206356_11510614 3300020070 Bacteria 539
186 Ga0206354_10275428 3300020081 Bacteria 554
187 Ga0206354_11062588 3300020081 Bacteria 1335
188 Ga0206353_10592838 3300020082 Bacteria 1520
189 Ga0206353_10830465 3300020082 Bacteria 572
190 Ga0213875_10000287 3300021388 Bacteria 48929
191 Ga0224712_10182272 3300022467 Bacteria 947
192 Ga0224712_10186064 3300022467 Bacteria 938
193 Ga0207713_1138204 3300025735 Bacteria 798
194 Ga0207692_10006005 3300025898 Bacteria 4909
195 Ga0207692_10034045 3300025898 Bacteria 2463
196 Ga0207692_10228932 3300025898 Bacteria 1105
197 Ga0207692_10295576 3300025898 Bacteria 984
198 Ga0207692_10370002 3300025898 Bacteria 887
199 Ga0207710_10051000 3300025900 Bacteria 1858
200 Ga0207688_10480438 3300025901 Bacteria 777
201 Ga0207647_10004285 3300025904 Bacteria 10585
202 Ga0207685_10094035 3300025905 Bacteria 1269
203 Ga0207685_10131950 3300025905 Bacteria 1110
204 Ga0207685_10360479 3300025905 Bacteria 736
205 Ga0207685_10689472 3300025905 Bacteria 555
206 Ga0207699_10004085 3300025906 Bacteria 6984
207 Ga0207699_10014496 3300025906 Bacteria 4065
208 Ga0207699_10042093 3300025906 Bacteria 2643
209 Ga0207699_10135055 3300025906 Bacteria 1614
210 Ga0207645_10267702 3300025907 Bacteria 1133
211 Ga0207705_10227673 3300025909 Bacteria 1417
212 Ga0207684_10004284 3300025910 Bacteria 13520
213 Ga0207684_10015569 3300025910 Bacteria 6543
214 Ga0207684_10579103 3300025910 Bacteria 959
215 Ga0207654_10905338 3300025911 Bacteria 640
216 Ga0207695_10017586 3300025913 Bacteria 8309
217 Ga0207671_10000315 3300025914 Bacteria 71303
218 Ga0207671_10295242 3300025914 Bacteria 1280
219 Ga0207693_10049412 3300025915 Bacteria 3303
220 Ga0207693_10091310 3300025915 Bacteria 2387
221 Ga0207693_10403355 3300025915 Bacteria 1069
222 Ga0207693_10829757 3300025915 Bacteria 712
223 Ga0207663_10010575 3300025916 Bacteria 4918
224 Ga0207663_10158419 3300025916 Bacteria 1595
225 Ga0207657_10050217 3300025919 Bacteria 3630
226 Ga0207649_11095238 3300025920 Bacteria 628
227 Ga0207652_10346080 3300025921 Bacteria 1342
228 Ga0207646_10004972 3300025922 Bacteria 14202
229 Ga0207646_10011644 3300025922 Bacteria 8505
230 Ga0207646_10030961 3300025922 Bacteria 4846
231 Ga0207646_10051639 3300025922 Bacteria 3678
232 Ga0207694_10006485 3300025924 Bacteria 8903
233 Ga0207694_10015183 3300025924 Bacteria 5809
234 Ga0207694_10218296 3300025924 Bacteria 1555
235 Ga0207659_10305168 3300025926 Bacteria 1309
236 Ga0207687_10361440 3300025927 Bacteria 1185
237 Ga0207687_10758855 3300025927 Bacteria 826
238 Ga0207700_10002340 3300025928 Bacteria 10873
239 Ga0207700_10008872 3300025928 Bacteria 6253
240 Ga0207700_10049616 3300025928 Bacteria 3123
241 Ga0207700_10174139 3300025928 Bacteria 1797
242 Ga0207700_10214165 3300025928 Bacteria 1630
243 Ga0207700_10405572 3300025928 Bacteria 1195
244 Ga0207664_10002824 3300025929 Bacteria 11535
245 Ga0207664_10016883 3300025929 Bacteria 5337
246 Ga0207664_10023592 3300025929 Bacteria 4612
247 Ga0207664_10058606 3300025929 Bacteria 3064
248 Ga0207664_10082530 3300025929 Bacteria 2618
249 Ga0207664_10117183 3300025929 Bacteria 2223
250 Ga0207664_10158240 3300025929 Bacteria 1930
251 Ga0207664_10696164 3300025929 Bacteria 914
252 Ga0207664_10702685 3300025929 Bacteria 909
253 Ga0207664_10717536 3300025929 Bacteria 899
254 Ga0207644_10342550 3300025931 Bacteria 1212
255 Ga0207709_10128188 3300025935 Bacteria 1725
256 Ga0207709_10156243 3300025935 Bacteria 1585
257 Ga0207670_10172834 3300025936 Bacteria 1621
258 Ga0207704_10913834 3300025938 Bacteria 739
259 Ga0207704_11964896 3300025938 Bacteria 503
260 Ga0207665_10001912 3300025939 Bacteria 14048
261 Ga0207665_10004808 3300025939 Bacteria 8993
262 Ga0207665_10025930 3300025939 Bacteria 3867
263 Ga0207665_10131080 3300025939 Bacteria 1780
264 Ga0207711_10104279 3300025941 Bacteria 2512
265 Ga0207711_10490461 3300025941 Bacteria 1145
266 Ga0207661_10396852 3300025944 Bacteria 1250
267 Ga0207661_10586008 3300025944 Bacteria 1023
268 Ga0207679_10370590 3300025945 Bacteria 1253
269 Ga0207667_10221357 3300025949 Bacteria 1939
270 Ga0207651_10567019 3300025960 Bacteria 989
271 Ga0207712_10095845 3300025961 Bacteria 2195
272 Ga0207668_10737515 3300025972 Bacteria 868
273 Ga0207677_10761003 3300026023 Bacteria 864
274 Ga0207703_10017359 3300026035 Bacteria 5619
275 Ga0207639_10136164 3300026041 Bacteria 2040
276 Ga0207678_10061117 3300026067 Bacteria 3240
277 Ga0207678_10209642 3300026067 Bacteria 1667
278 Ga0207702_10054781 3300026078 Bacteria 3380
279 Ga0207702_10270282 3300026078 Bacteria 1603
280 Ga0207702_10392775 3300026078 Bacteria 1336
281 Ga0207641_10105331 3300026088 Bacteria 2491
282 Ga0207641_11503704 3300026088 Bacteria 675
283 Ga0207676_10467951 3300026095 Bacteria 1191
284 Ga0207674_10205128 3300026116 Bacteria 1921
285 Ga0207675_100388319 3300026118 Bacteria 1374
286 Ga0207683_10017933 3300026121 Bacteria 6037
287 Ga0207698_10662151 3300026142 Bacteria 1035
288 Ga0207698_10969304 3300026142 Bacteria 860
289 Ga0268266_10004213 3300028379 Bacteria 13846
290 Ga0268266_10064560 3300028379 Bacteria 3163
291 Ga0268266_10893438 3300028379 Bacteria 859
292 Ga0268266_11191246 3300028379 Bacteria 737
293 Ga0268264_10116742 3300028381 Bacteria 2346
294 Ga0265338_10002786 3300028800 Bacteria 25552
295 Ga0307513_10495101 3300031456 Archaea 940
296 Ga0316214_1001605 3300033545 Bacteria 2674
297 Ga0316212_1003391 3300033547 Bacteria 2300
298 Ga0373959_0013674 3300034820 Bacteria 1467
299 Ga0373959_0177278 3300034820 Bacteria 552
300 Ga0373929_0043553 3300035085 Bacteria 1005
301 Ga0373934_0016555 3300035086 Bacteria 2802
302 Ga0373934_0029806 3300035086 Bacteria 2133
303 Ga0373934_0041987 3300035086 Bacteria 1806
304 Ga0373934_0280451 3300035086 Bacteria 690
305 Ga0373949_0146459 3300035090 Bacteria 680
306 Ga0373952_0093913 3300035092 Bacteria 783
307 Ga0373923_0005841 3300035111 Bacteria 4202
308 Ga0373923_0128996 3300035111 Bacteria 1135
309 Ga0373932_0159379 3300035112 Bacteria 780
310 Ga0373936_0100930 3300035113 Bacteria 1217
311 Ga0373936_0132236 3300035113 Bacteria 1073
312 Ga0373939_0043680 3300035114 Bacteria 1361
313 Ga0373945_0183514 3300035116 Bacteria 862
314 Ga0373945_0214838 3300035116 Bacteria 803
315 Ga0373953_0000273 3300035117 Bacteria 14158
316 Ga0373954_0015889 3300035118 Bacteria 3366
317 Ga0373954_0173113 3300035118 Bacteria 1058
318 Ga0373956_0005982 3300035119 Bacteria 4866
319 Ga0373956_0109521 3300035119 Bacteria 1285
320 Ga0373957_0018282 3300035120 Bacteria 2453
321 Ga0373960_0022337 3300035121 Bacteria 1693
322 Ga0373943_0165913 3300035170 Bacteria 1205
323 Ga0373946_0041626 3300035171 Bacteria 1885
324 Ga0373955_0016582 3300035172 Bacteria 3630
325 Ga0373955_0043306 3300035172 Bacteria 2421
326 Ga0373955_0108293 3300035172 Bacteria 1604
327 Ga0373955_0667433 3300035172 Bacteria 638
328 Ga0373924_0003998 3300035410 Bacteria 5119
329 Ga0373924_0009102 3300035410 Bacteria 3633
330 Ga0373924_0130104 3300035410 Bacteria 1095
331 Ga0373924_0218520 3300035410 Bacteria 842
332 Ga0373931_0109005 3300035691 Bacteria 1568
333 Ga0373931_0315271 3300035691 Bacteria 970
334 Ga0373935_0283246 3300035692 Bacteria 1167
335 Ga0373927_0066943 3300035695 Bacteria 2324
336 Ga0373927_0076588 3300035695 Bacteria 2166
337 Ga0373933_0000230 3300035724 Bacteria 37223
338 Ga0373933_0661671 3300035724 Bacteria 686
339 Ga0373947_0005305 3300035725 Bacteria 7537
340 Ga0373937_0009275 3300036401 Bacteria 8543
341 Ga0373937_0076497 3300036401 Bacteria 3091
342 Ga0373937_0261661 3300036401 Bacteria 1631
343 Ga0373937_0283176 3300036401 Bacteria 1565
344 Ga0373937_0701409 3300036401 Bacteria 959
345 Ga0373925_0000028 3300037068 Bacteria 149654
346 Ga0373925_0002973 3300037068 Bacteria 13381
347 Ga0373925_0017113 3300037068 Bacteria 5248
348 Ga0373925_0032021 3300037068 Bacteria 3868
349 Ga0373925_0100378 3300037068 Unclassified 2224
350 Ga0373925_0301640 3300037068 Bacteria 1293
351 Ga0373925_1611224 3300037068 Bacteria 530
352 Ga0436364_0154596 3300037853 Bacteria 62862
353 Ga0466969_0016390 3300044656 Bacteria 3876
354 Ga0466969_0066981 3300044656 Bacteria 1733
355 Ga0466969_0215177 3300044656 Bacteria 875
356 Ga0466966_0299803 3300044684 Bacteria 966
357 Ga0466961_0110911 3300044693 Bacteria 1726
358 Ga0466961_0137878 3300044693 Bacteria 1528
359 Ga0466961_0406119 3300044693 Bacteria 826
360 Ga0466963_0147160 3300044694 Bacteria 1635
361 Ga0466963_0202421 3300044694 Bacteria 1389
362 Ga0466963_0217799 3300044694 Bacteria 1337
363 Ga0466971_0015573 3300044719 Bacteria 3349
364 Ga0466970_0122853 3300044765 Bacteria 1423
365 Ga0466970_0271267 3300044765 Bacteria 953
366 Ga0466959_0012597 3300045049 Bacteria 6117
367 Ga0466959_0031393 3300045049 Bacteria 3931
368 Ga0466959_0275941 3300045049 Bacteria 1155
369 Ga0466958_0451819 3300045836 Bacteria 832
370 Ga0495592_0000225 3300046454 Bacteria 48726
371 Ga0495592_0047732 3300046454 Bacteria 3188
372 Ga0495603_0884056 3300046455 Bacteria 508
373 Ga0495629_0031279 3300046459 Bacteria 3769
374 Ga0495641_0027740 3300046461 Bacteria 2749
375 Ga0495641_0324007 3300046461 Bacteria 695
376 Ga0495651_0000372 3300046462 Bacteria 34624
377 Ga0495651_0001205 3300046462 Bacteria 19949
378 Ga0495651_0002613 3300046462 Bacteria 13936
379 Ga0495651_0004212 3300046462 Bacteria 11022
380 Ga0495651_0012103 3300046462 Bacteria 6638
381 Ga0495651_0026345 3300046462 Bacteria 4529
382 Ga0495653_0001165 3300046463 Bacteria 20276
383 Ga0495653_0019554 3300046463 Bacteria 5491
384 Ga0495653_0093543 3300046463 Bacteria 2192
385 Ga0495653_0147527 3300046463 Bacteria 1647
386 Ga0495653_0249503 3300046463 Bacteria 1178
387 Ga0495580_0071610 3300046472 Bacteria 2422
388 Ga0495582_0000278 3300046473 Bacteria 28660
389 Ga0495582_0020174 3300046473 Bacteria 3647
390 Ga0495639_0151541 3300046475 Bacteria 1119
391 Ga0495662_0071405 3300046476 Bacteria 1682
392 Ga0495664_0016303 3300046477 Bacteria 4231
393 Ga0495608_0009631 3300046511 Bacteria 6740
394 Ga0495608_0045349 3300046511 Bacteria 2930
395 Ga0495618_0234935 3300046514 Bacteria 1153
396 Ga0495628_0001692 3300046516 Bacteria 20136
397 Ga0495628_0033223 3300046516 Bacteria 4159
398 Ga0495628_0038319 3300046516 Bacteria 3837
399 Ga0495628_0050615 3300046516 Bacteria 3285
400 Ga0495630_0138402 3300046517 Bacteria 1850
401 Ga0495652_0005278 3300046529 Bacteria 12187
402 Ga0495652_0022737 3300046529 Bacteria 5564
403 Ga0495652_0070767 3300046529 Bacteria 2914
404 Ga0495652_0190464 3300046529 Bacteria 1565
405 Ga0495652_0416173 3300046529 Bacteria 948
406 Ga0495665_0013675 3300046531 Bacteria 4385
407 Ga0495640_0061139 3300046533 Bacteria 2560
408 Ga0495640_0171900 3300046533 Bacteria 1384
409 Ga0495586_0171227 3300046535 Bacteria 1227
410 Ga0495587_0019232 3300046536 Bacteria 4229
411 Ga0495587_0022032 3300046536 Bacteria 3926
412 Ga0495645_0048434 3300046543 Bacteria 3095
413 Ga0495667_0000050 3300046559 Bacteria 111239
414 Ga0495667_0025351 3300046559 Bacteria 3996
415 Ga0495667_0031847 3300046559 Bacteria 3536
416 Ga0495667_0046818 3300046559 Bacteria 2858
417 Ga0495667_0147073 3300046559 Bacteria 1517
418 Ga0495634_0101027 3300046642 Bacteria 1863
419 Ga0495635_0038673 3300046663 Bacteria 3302
420 Ga0495635_0046593 3300046663 Bacteria 2990
421 Ga0495635_0256879 3300046663 Bacteria 1177
422 Ga0495635_0274454 3300046663 Bacteria 1133
423 Ga0495657_0000009 3300046675 Bacteria 217555
424 Ga0495657_0010848 3300046675 Bacteria 6840
425 Ga0495657_0027553 3300046675 Bacteria 4008
426 Ga0495657_0047572 3300046675 Bacteria 2898
427 Ga0495599_0000033 3300046678 Bacteria 106425
428 Ga0495599_0068670 3300046678 Bacteria 2212
429 Ga0495599_0483193 3300046678 Bacteria 731
430 Ga0495623_0000190 3300046679 Bacteria 39055
431 Ga0495623_0063125 3300046679 Bacteria 2320
432 Ga0495646_0040390 3300046680 Bacteria 2874
433 Ga0495646_0095254 3300046680 Bacteria 1713
434 Ga0495646_0181080 3300046680 Bacteria 1156
435 Ga0495647_0102963 3300046681 Bacteria 1184
436 Ga0495647_0158781 3300046681 Unclassified 973
437 Ga0495658_0000239 3300046683 Bacteria 31506
438 Ga0495658_0041322 3300046683 Bacteria 2568
439 Ga0495613_0001169 3300046689 Bacteria 20035
440 Ga0495613_0484183 3300046689 Bacteria 835
441 Ga0495624_0025196 3300046690 Bacteria 3908
442 Ga0495600_0003236 3300046809 Bacteria 9528
443 Ga0495600_0028709 3300046809 Bacteria 3600
444 Ga0495600_0049346 3300046809 Bacteria 2746
445 Ga0495600_0060822 3300046809 Bacteria 2466
446 Ga0495581_0001258 3300047315 Bacteria 13929
447 Ga0495581_0076950 3300047315 Bacteria 1930
448 Ga0495604_0024802 3300047317 Bacteria 4784
449 Ga0495604_0053798 3300047317 Bacteria 3109
450 Ga0495604_0115026 3300047317 Bacteria 1955
451 Ga0495674_0111789 3300047319 Bacteria 2315
452 Ga0495674_0246935 3300047319 Bacteria 1469
453 Ga0495674_0629944 3300047319 Bacteria 847
454 Ga0495676_0187264 3300047321 Unclassified 1446
455 Ga0495676_0244094 3300047321 Bacteria 1228
456 Ga0495680_0004462 3300047322 Bacteria 13381
457 Ga0495680_0011899 3300047322 Bacteria 7678
458 Ga0495680_0039452 3300047322 Bacteria 3767
459 Ga0495680_0056976 3300047322 Bacteria 3024
460 Ga0495680_0073614 3300047322 Bacteria 2595
461 Ga0495675_0082505 3300047444 Bacteria 2024
462 Ga0495675_0095714 3300047444 Bacteria 1861
463 Ga0495675_0235589 3300047444 Bacteria 1103
464 Ga0495684_0041264 3300047471 Bacteria 3536
465 Ga0495684_0499199 3300047471 Bacteria 837
466 Ga0495593_0025382 3300047673 Bacteria 3280
467 Ga0495602_0013650 3300048088 Bacteria 8289
468 Ga0495602_0054604 3300048088 Bacteria 3525
469 Ga0495602_0056143 3300048088 Bacteria 3464
470 Ga0495602_0143686 3300048088 Bacteria 1885
471 Ga0495614_0402249 3300048089 Bacteria 643
472 Ga0496100_0018375 3300048903 Bacteria 4146
473 Ga0496100_0077093 3300048903 Unclassified 2240
474 Ga0496100_0224467 3300048903 Bacteria 1380
475 Ga0496100_0238419 3300048903 Bacteria 1341
476 Ga0496100_0475745 3300048903 Unclassified 960
477 Ga0496101_0029283 3300048904 Bacteria 3851
478 Ga0496101_0034859 3300048904 Bacteria 3557
479 Ga0496101_0051214 3300048904 Unclassified 2975
480 Ga0496101_0218047 3300048904 Unclassified 1480
481 Ga0496102_0031920 3300048905 Bacteria 4729
482 Ga0496102_0155822 3300048905 Bacteria 2147
483 Ga0496103_0030088 3300048906 Bacteria 3303
484 Ga0496103_0261837 3300048906 Bacteria 1113
485 Ga0496103_0396335 3300048906 Bacteria 887
486 Ga0496104_0002724 3300048907 Bacteria 15212
487 Ga0496104_0005574 3300048907 Bacteria 11024
488 Ga0496104_0023511 3300048907 Bacteria 5666
489 Ga0496104_0299081 3300048907 Bacteria 1521
490 Ga0496105_0001911 3300048908 Bacteria 14959
491 Ga0496105_0027783 3300048908 Bacteria 4624
492 Ga0496105_0232585 3300048908 Bacteria 1497
493 Ga0496106_0062738 3300048909 Bacteria 2822
494 Ga0496106_0370295 3300048909 Bacteria 1151
495 Ga0496107_0040456 3300048910 Bacteria 3346
496 Ga0496108_0021354 3300048911 Bacteria 5320
497 Ga0496108_0111013 3300048911 Bacteria 2345
498 Ga0496108_0279962 3300048911 Unclassified 1452
499 Ga0496109_0041527 3300048912 Bacteria 4166
500 Ga0496109_0057707 3300048912 Bacteria 3544
501 Ga0496109_0554675 3300048912 Bacteria 1084
502 Ga0496109_0734549 3300048912 Bacteria 925
503 Ga0496110_0093290 3300048913 Bacteria 2695
504 Ga0496110_0172120 3300048913 Unclassified 1965
505 Ga0496110_0270089 3300048913 Bacteria 1548
506 Ga0496110_0419143 3300048913 Bacteria 1221
507 Ga0496111_0362982 3300048914 Bacteria 1072
508 Ga0496112_0039448 3300048915 Bacteria 4615
509 Ga0496112_0061405 3300048915 Bacteria 3704
510 Ga0496112_0091593 3300048915 Bacteria 3009
511 Ga0496112_0548130 3300048915 Bacteria 1090
512 Ga0496113_0020019 3300048916 Bacteria 4695
513 Ga0496113_0039106 3300048916 Bacteria 3490
514 Ga0496113_0095888 3300048916 Bacteria 2293
515 Ga0496114_0011068 3300048917 Bacteria 7198
516 Ga0496114_0141425 3300048917 Bacteria 2084
517 Ga0496115_0000838 3300048918 Bacteria 22462
518 Ga0496115_0020588 3300048918 Bacteria 5089
519 Ga0496115_0032547 3300048918 Bacteria 4113
520 Ga0496115_0088234 3300048918 Bacteria 2532
521 Ga0496115_0247511 3300048918 Bacteria 1468
522 Ga0496119_0154275 3300048922 Bacteria 1228
523 nmdc:mga0yw44_30588_c1 3300050492 Bacteria 3122
524 nmdc:mga0n895_1332762_c1 3300050512 Bacteria 688
525 nmdc:mga0n895_33674_c1 3300050512 Bacteria 4925
526 nmdc:mga0n895_347481_c1 3300050512 Bacteria 1502
527 nmdc:mga0n895_563112_c1 3300050512 Bacteria 1145
528 nmdc:mga0n895_568374_c1 3300050512 Bacteria 1139
529 nmdc:mga0rr50_575114_c1 3300050513 Bacteria 960
530 nmdc:mga0rr50_77995_c1 3300050513 Bacteria 2548
531 nmdc:mga08x19_175529_c1 3300050514 Bacteria 1461
532 nmdc:mga08x19_71131_c1 3300050514 Bacteria 2268
533 nmdc:mga0a205_145244_c1 3300050515 Bacteria 2272
534 nmdc:mga0a205_8859_c1 3300050515 Bacteria 9168
535 Ga0495601_0180199 3300053077 Bacteria 1381
536 Ga0495601_0439964 3300053077 Bacteria 844
537 Ga0495612_0026442 3300053078 Bacteria 2332
538 Ga0495595_0017730 3300053084 Bacteria 3066
539 Ga0495595_0053343 3300053084 Bacteria 1878
540 Ga0495595_0115678 3300053084 Bacteria 1303
541 Ga0500644_0248225 3300053088 Bacteria 750
542 Ga0500660_126139 3300053100 Bacteria 1053
543 Ga0500630_052254 3300053159 Bacteria 1972
544 Ga0466962_0021003 3300061719 Bacteria 3137
545 Ga0466962_0117191 3300061719 Bacteria 1284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0324007 Ga0495641_0324007_216_605 129
2 3300009551 Ga0105238_10167320 Ga0105238_101673203 139
3 3300048912 Ga0496109_0554675 Ga0496109_0554675_309_728 139
4 3300009093 Ga0105240_10097567 Ga0105240_100975672 140
5 3300014745 Ga0157377_10495568 Ga0157377_104955681 140
6 3300034820 Ga0373959_0177278 Ga0373959_0177278_119_541 140
7 3300050512 nmdc:mga0n895_33674_c1 nmdc:mga0n895_33674_c1_3823_4245 140
8 3300050513 nmdc:mga0rr50_77995_c1 nmdc:mga0rr50_77995_c1_1402_1824 140
9 3300050514 nmdc:mga08x19_71131_c1 nmdc:mga08x19_71131_c1_820_1242 140
10 3300050515 nmdc:mga0a205_8859_c1 nmdc:mga0a205_8859_c1_5995_6417 140
11 3300007788 Ga0099795_10064748 Ga0099795_100647482 141
12 3300009093 Ga0105240_10087369 Ga0105240_100873694 141
13 3300010159 Ga0099796_10181458 Ga0099796_101814582 141
14 3300035086 Ga0373934_0016555 Ga0373934_0016555_1131_1556 141
15 3300035086 Ga0373934_0041987 Ga0373934_0041987_1059_1484 141
16 3300035086 Ga0373934_0280451 Ga0373934_0280451_208_633 141
17 3300035111 Ga0373923_0005841 Ga0373923_0005841_1767_2192 141
18 3300035113 Ga0373936_0132236 Ga0373936_0132236_158_583 141
19 3300035114 Ga0373939_0043680 Ga0373939_0043680_65_490 141
20 3300035116 Ga0373945_0214838 Ga0373945_0214838_252_677 141
21 3300035117 Ga0373953_0000273 Ga0373953_0000273_9318_9743 141
22 3300035118 Ga0373954_0015889 Ga0373954_0015889_943_1368 141
23 3300035119 Ga0373956_0005982 Ga0373956_0005982_3822_4247 141
24 3300035172 Ga0373955_0016582 Ga0373955_0016582_363_788 141
25 3300035172 Ga0373955_0108293 Ga0373955_0108293_472_897 141
26 3300035172 Ga0373955_0667433 Ga0373955_0667433_174_599 141
27 3300035410 Ga0373924_0003998 Ga0373924_0003998_357_782 141
28 3300035410 Ga0373924_0130104 Ga0373924_0130104_634_1059 141
29 3300035410 Ga0373924_0218520 Ga0373924_0218520_363_788 141
30 3300035691 Ga0373931_0315271 Ga0373931_0315271_331_756 141
31 3300035724 Ga0373933_0000230 Ga0373933_0000230_36747_37172 141
32 3300036401 Ga0373937_0009275 Ga0373937_0009275_90_515 141
33 3300036401 Ga0373937_0076497 Ga0373937_0076497_1507_1932 141
34 3300036401 Ga0373937_0261661 Ga0373937_0261661_1108_1533 141
35 3300037068 Ga0373925_0002973 Ga0373925_0002973_1804_2229 141
36 3300037068 Ga0373925_0017113 Ga0373925_0017113_4281_4706 141
37 3300037068 Ga0373925_0032021 Ga0373925_0032021_544_969 141
38 3300037068 Ga0373925_0301640 Ga0373925_0301640_558_983 141
39 3300044656 Ga0466969_0215177 Ga0466969_0215177_46_471 141
40 3300044694 Ga0466963_0147160 Ga0466963_0147160_1009_1434 141
41 3300045049 Ga0466959_0012597 Ga0466959_0012597_4017_4442 141
42 3300046454 Ga0495592_0000225 Ga0495592_0000225_48250_48675 141
43 3300046455 Ga0495603_0884056 Ga0495603_0884056_41_466 141
44 3300046462 Ga0495651_0001205 Ga0495651_0001205_5577_6002 141
45 3300046462 Ga0495651_0002613 Ga0495651_0002613_6987_7412 141
46 3300046462 Ga0495651_0004212 Ga0495651_0004212_8698_9123 141
47 3300046463 Ga0495653_0001165 Ga0495653_0001165_783_1208 141
48 3300046463 Ga0495653_0019554 Ga0495653_0019554_4381_4806 141
49 3300046463 Ga0495653_0093543 Ga0495653_0093543_1313_1738 141
50 3300046463 Ga0495653_0147527 Ga0495653_0147527_23_448 141
51 3300046511 Ga0495608_0009631 Ga0495608_0009631_2984_3409 141
52 3300046514 Ga0495618_0234935 Ga0495618_0234935_694_1119 141
53 3300046516 Ga0495628_0001692 Ga0495628_0001692_2914_3339 141
54 3300046516 Ga0495628_0038319 Ga0495628_0038319_1810_2235 141
55 3300046517 Ga0495630_0138402 Ga0495630_0138402_531_956 141
56 3300046529 Ga0495652_0022737 Ga0495652_0022737_3476_3901 141
57 3300046529 Ga0495652_0070767 Ga0495652_0070767_2081_2506 141
58 3300046529 Ga0495652_0416173 Ga0495652_0416173_314_739 141
59 3300046533 Ga0495640_0171900 Ga0495640_0171900_754_1179 141
60 3300046536 Ga0495587_0022032 Ga0495587_0022032_2326_2751 141
61 3300046559 Ga0495667_0000050 Ga0495667_0000050_110763_111188 141
62 3300046559 Ga0495667_0025351 Ga0495667_0025351_1311_1736 141
63 3300046559 Ga0495667_0031847 Ga0495667_0031847_1580_2005 141
64 3300046559 Ga0495667_0046818 Ga0495667_0046818_37_462 141
65 3300046663 Ga0495635_0038673 Ga0495635_0038673_883_1308 141
66 3300046663 Ga0495635_0274454 Ga0495635_0274454_233_658 141
67 3300046675 Ga0495657_0000009 Ga0495657_0000009_103036_103461 141
68 3300046675 Ga0495657_0010848 Ga0495657_0010848_4905_5330 141
69 3300046675 Ga0495657_0027553 Ga0495657_0027553_925_1350 141
70 3300046678 Ga0495599_0000033 Ga0495599_0000033_2993_3418 141
71 3300046678 Ga0495599_0483193 Ga0495599_0483193_48_473 141
72 3300046679 Ga0495623_0000190 Ga0495623_0000190_32655_33080 141
73 3300046680 Ga0495646_0040390 Ga0495646_0040390_1626_2051 141
74 3300046680 Ga0495646_0181080 Ga0495646_0181080_446_871 141
75 3300046689 Ga0495613_0484183 Ga0495613_0484183_18_443 141
76 3300046809 Ga0495600_0003236 Ga0495600_0003236_3426_3851 141
77 3300046809 Ga0495600_0049346 Ga0495600_0049346_1541_1966 141
78 3300047317 Ga0495604_0024802 Ga0495604_0024802_2678_3103 141
79 3300047317 Ga0495604_0053798 Ga0495604_0053798_645_1070 141
80 3300047319 Ga0495674_0111789 Ga0495674_0111789_1461_1886 141
81 3300047319 Ga0495674_0629944 Ga0495674_0629944_381_806 141
82 3300047322 Ga0495680_0004462 Ga0495680_0004462_8510_8935 141
83 3300047322 Ga0495680_0011899 Ga0495680_0011899_5575_6000 141
84 3300047322 Ga0495680_0039452 Ga0495680_0039452_449_874 141
85 3300047322 Ga0495680_0056976 Ga0495680_0056976_2410_2835 141
86 3300047444 Ga0495675_0095714 Ga0495675_0095714_627_1052 141
87 3300047444 Ga0495675_0235589 Ga0495675_0235589_363_788 141
88 3300047471 Ga0495684_0499199 Ga0495684_0499199_251_676 141
89 3300048088 Ga0495602_0054604 Ga0495602_0054604_522_947 141
90 3300048088 Ga0495602_0056143 Ga0495602_0056143_2988_3413 141
91 3300048906 Ga0496103_0396335 Ga0496103_0396335_187_612 141
92 3300048911 Ga0496108_0111013 Ga0496108_0111013_1569_1994 141
93 3300050512 nmdc:mga0n895_568374_c1 nmdc:mga0n895_568374_c1_198_623 141
94 3300050515 nmdc:mga0a205_145244_c1 nmdc:mga0a205_145244_c1_1480_1905 141
95 3300053077 Ga0495601_0439964 Ga0495601_0439964_289_714 141
96 3300053078 Ga0495612_0026442 Ga0495612_0026442_367_792 141
97 3300053084 Ga0495595_0053343 Ga0495595_0053343_972_1397 141
98 3300053084 Ga0495595_0115678 Ga0495595_0115678_228_653 141
99 3300053088 Ga0500644_0248225 Ga0500644_0248225_189_614 141
100 iso_pu_bacteria 2551306166 2552109889 143
101 iso_pu_bacteria 2558860112 2558909882 143
102 iso_pu_bacteria 2862574272 2862582165 143
103 iso_pu_bacteria 2870782633 2870783240 143
104 3300009148 Ga0105243_10408982 Ga0105243_104089822 145
105 3300009177 Ga0105248_10697567 Ga0105248_106975672 145
106 3300009551 Ga0105238_11566081 Ga0105238_115660812 145
107 3300009553 Ga0105249_10070573 Ga0105249_100705732 145
108 3300013306 Ga0163162_11142317 Ga0163162_111423171 145
109 3300048905 Ga0496102_0155822 Ga0496102_0155822_1563_2000 145
110 3300048906 Ga0496103_0261837 Ga0496103_0261837_24_461 145
111 3300050492 nmdc:mga0yw44_30588_c1 nmdc:mga0yw44_30588_c1_1265_1702 145
112 3300005329 Ga0070683_100336329 Ga0070683_1003363292 146
113 3300005330 Ga0070690_100423409 Ga0070690_1004234092 146
114 3300005336 Ga0070680_100187081 Ga0070680_1001870813 146
115 3300005340 Ga0070689_100317684 Ga0070689_1003176843 146
116 3300005341 Ga0070691_10094381 Ga0070691_100943811 146
117 3300005344 Ga0070661_100794980 Ga0070661_1007949801 146
118 3300005354 Ga0070675_100438506 Ga0070675_1004385062 146
119 3300005355 Ga0070671_100350595 Ga0070671_1003505952 146
120 3300005364 Ga0070673_100255448 Ga0070673_1002554482 146
121 3300005440 Ga0070705_100359066 Ga0070705_1003590661 146
122 3300005456 Ga0070678_100393219 Ga0070678_1003932192 146
123 3300005458 Ga0070681_10019276 Ga0070681_100192765 146
124 3300005530 Ga0070679_100767011 Ga0070679_1007670111 146
125 3300005539 Ga0068853_100654110 Ga0068853_1006541102 146
126 3300005543 Ga0070672_101355217 Ga0070672_1013552171 146
127 3300005547 Ga0070693_100104019 Ga0070693_1001040192 146
128 3300005548 Ga0070665_100029301 Ga0070665_1000293016 146
129 3300005563 Ga0068855_100076429 Ga0068855_1000764296 146
130 3300005577 Ga0068857_100870218 Ga0068857_1008702181 146
131 3300005614 Ga0068856_100120733 Ga0068856_1001207333 146
132 3300005616 Ga0068852_100216817 Ga0068852_1002168172 146
133 3300005617 Ga0068859_100615629 Ga0068859_1006156292 146
134 3300005618 Ga0068864_100175286 Ga0068864_1001752861 146
135 3300005834 Ga0068851_10485445 Ga0068851_104854451 146
136 3300005841 Ga0068863_100018786 Ga0068863_1000187866 146
137 3300005842 Ga0068858_100028597 Ga0068858_1000285975 146
138 3300005843 Ga0068860_100056438 Ga0068860_1000564383 146
139 3300006028 Ga0070717_10091010 Ga0070717_100910102 146
140 3300006173 Ga0070716_100058436 Ga0070716_1000584362 146
141 3300006237 Ga0097621_100110133 Ga0097621_1001101332 146
142 3300006358 Ga0068871_100272902 Ga0068871_1002729022 146
143 3300006881 Ga0068865_100350622 Ga0068865_1003506222 146
144 3300006931 Ga0097620_100615631 Ga0097620_1006156312 146
145 3300009011 Ga0105251_10115751 Ga0105251_101157511 146
146 3300009098 Ga0105245_10031853 Ga0105245_100318532 146
147 3300009101 Ga0105247_10033726 Ga0105247_100337262 146
148 3300009174 Ga0105241_10041802 Ga0105241_100418022 146
149 3300009177 Ga0105248_10015122 Ga0105248_100151224 146
150 3300009551 Ga0105238_10059290 Ga0105238_100592902 146
151 3300009553 Ga0105249_10636256 Ga0105249_106362562 146
152 3300011119 Ga0105246_10007607 Ga0105246_100076076 146
153 3300013100 Ga0157373_10362321 Ga0157373_103623211 146
154 3300013102 Ga0157371_10221359 Ga0157371_102213591 146
155 3300013104 Ga0157370_10144732 Ga0157370_101447323 146
156 3300013296 Ga0157374_10097982 Ga0157374_100979821 146
157 3300013297 Ga0157378_10374415 Ga0157378_103744152 146
158 3300014325 Ga0163163_10031931 Ga0163163_100319311 146
159 3300020070 Ga0206356_11510614 Ga0206356_115106141 146
160 3300020081 Ga0206354_11062588 Ga0206354_110625882 146
161 3300025735 Ga0207713_1138204 Ga0207713_11382041 146
162 3300025900 Ga0207710_10051000 Ga0207710_100510001 146
163 3300025901 Ga0207688_10480438 Ga0207688_104804381 146
164 3300025905 Ga0207685_10094035 Ga0207685_100940351 146
165 3300025907 Ga0207645_10267702 Ga0207645_102677021 146
166 3300025909 Ga0207705_10227673 Ga0207705_102276731 146
167 3300025915 Ga0207693_10091310 Ga0207693_100913102 146
168 3300025919 Ga0207657_10050217 Ga0207657_100502172 146
169 3300025920 Ga0207649_11095238 Ga0207649_110952381 146
170 3300025921 Ga0207652_10346080 Ga0207652_103460801 146
171 3300025924 Ga0207694_10015183 Ga0207694_100151834 146
172 3300025926 Ga0207659_10305168 Ga0207659_103051682 146
173 3300025927 Ga0207687_10758855 Ga0207687_107588552 146
174 3300025928 Ga0207700_10008872 Ga0207700_100088726 146
175 3300025929 Ga0207664_10058606 Ga0207664_100586062 146
176 3300025931 Ga0207644_10342550 Ga0207644_103425502 146
177 3300025935 Ga0207709_10156243 Ga0207709_101562433 146
178 3300025936 Ga0207670_10172834 Ga0207670_101728343 146
179 3300025941 Ga0207711_10104279 Ga0207711_101042791 146
180 3300025944 Ga0207661_10396852 Ga0207661_103968522 146
181 3300025945 Ga0207679_10370590 Ga0207679_103705902 146
182 3300025949 Ga0207667_10221357 Ga0207667_102213572 146
183 3300025960 Ga0207651_10567019 Ga0207651_105670192 146
184 3300025972 Ga0207668_10737515 Ga0207668_107375151 146
185 3300026023 Ga0207677_10761003 Ga0207677_107610032 146
186 3300026035 Ga0207703_10017359 Ga0207703_100173595 146
187 3300026041 Ga0207639_10136164 Ga0207639_101361642 146
188 3300026078 Ga0207702_10270282 Ga0207702_102702822 146
189 3300026088 Ga0207641_10105331 Ga0207641_101053313 146
190 3300026095 Ga0207676_10467951 Ga0207676_104679512 146
191 3300026116 Ga0207674_10205128 Ga0207674_102051283 146
192 3300026121 Ga0207683_10017933 Ga0207683_100179335 146
193 3300026142 Ga0207698_10662151 Ga0207698_106621512 146
194 3300028379 Ga0268266_10064560 Ga0268266_100645603 146
195 3300028381 Ga0268264_10116742 Ga0268264_101167422 146
196 3300048903 Ga0496100_0018375 Ga0496100_0018375_822_1274 146
197 3300048904 Ga0496101_0034859 Ga0496101_0034859_2698_3150 146
198 3300048906 Ga0496103_0030088 Ga0496103_0030088_2344_2796 146
199 3300048907 Ga0496104_0299081 Ga0496104_0299081_36_488 146
200 3300048909 Ga0496106_0062738 Ga0496106_0062738_483_935 146
201 3300048910 Ga0496107_0040456 Ga0496107_0040456_496_948 146
202 3300048911 Ga0496108_0021354 Ga0496108_0021354_1536_1988 146
203 3300048912 Ga0496109_0057707 Ga0496109_0057707_2794_3246 146
204 3300048913 Ga0496110_0270089 Ga0496110_0270089_554_1006 146
205 3300048914 Ga0496111_0362982 Ga0496111_0362982_458_910 146
206 3300048915 Ga0496112_0061405 Ga0496112_0061405_3002_3454 146
207 3300048916 Ga0496113_0039106 Ga0496113_0039106_2578_3030 146
208 3300048917 Ga0496114_0141425 Ga0496114_0141425_669_1121 146
209 3300048918 Ga0496115_0247511 Ga0496115_0247511_455_907 146
210 3300005327 Ga0070658_10390104 Ga0070658_103901042 147
211 3300005338 Ga0068868_100108562 Ga0068868_1001085621 147
212 3300005339 Ga0070660_100640277 Ga0070660_1006402772 147
213 3300005366 Ga0070659_100939574 Ga0070659_1009395741 147
214 3300005434 Ga0070709_10029204 Ga0070709_100292043 147
215 3300005434 Ga0070709_10108063 Ga0070709_101080632 147
216 3300005434 Ga0070709_10112002 Ga0070709_101120022 147
217 3300005435 Ga0070714_100003216 Ga0070714_1000032162 147
218 3300005435 Ga0070714_100013335 Ga0070714_1000133352 147
219 3300005435 Ga0070714_100021844 Ga0070714_1000218444 147
220 3300005435 Ga0070714_100077393 Ga0070714_1000773933 147
221 3300005435 Ga0070714_100170219 Ga0070714_1001702193 147
222 3300005435 Ga0070714_100177506 Ga0070714_1001775062 147
223 3300005435 Ga0070714_100292660 Ga0070714_1002926602 147
224 3300005435 Ga0070714_100389988 Ga0070714_1003899882 147
225 3300005436 Ga0070713_100001723 Ga0070713_10000172311 147
226 3300005436 Ga0070713_100065369 Ga0070713_1000653693 147
227 3300005436 Ga0070713_100073786 Ga0070713_1000737862 147
228 3300005436 Ga0070713_100310765 Ga0070713_1003107652 147
229 3300005436 Ga0070713_100344305 Ga0070713_1003443052 147
230 3300005436 Ga0070713_100403177 Ga0070713_1004031771 147
231 3300005436 Ga0070713_100479585 Ga0070713_1004795852 147
232 3300005436 Ga0070713_100610737 Ga0070713_1006107372 147
233 3300005437 Ga0070710_10014750 Ga0070710_100147503 147
234 3300005437 Ga0070710_10096638 Ga0070710_100966382 147
235 3300005437 Ga0070710_10145693 Ga0070710_101456931 147
236 3300005437 Ga0070710_10185771 Ga0070710_101857711 147
237 3300005439 Ga0070711_100022377 Ga0070711_1000223775 147
238 3300005439 Ga0070711_100032325 Ga0070711_1000323253 147
239 3300005439 Ga0070711_100045608 Ga0070711_1000456083 147
240 3300005439 Ga0070711_100047469 Ga0070711_1000474693 147
241 3300005445 Ga0070708_100017074 Ga0070708_1000170741 147
242 3300005445 Ga0070708_100034575 Ga0070708_1000345752 147
243 3300005445 Ga0070708_100038151 Ga0070708_1000381514 147
244 3300005445 Ga0070708_100232644 Ga0070708_1002326442 147
245 3300005445 Ga0070708_101301221 Ga0070708_1013012211 147
246 3300005455 Ga0070663_100040219 Ga0070663_1000402193 147
247 3300005458 Ga0070681_10081572 Ga0070681_100815724 147
248 3300005459 Ga0068867_101475354 Ga0068867_1014753541 147
249 3300005467 Ga0070706_100003993 Ga0070706_1000039933 147
250 3300005467 Ga0070706_100004504 Ga0070706_1000045046 147
251 3300005467 Ga0070706_100018504 Ga0070706_1000185042 147
252 3300005467 Ga0070706_100484571 Ga0070706_1004845712 147
253 3300005467 Ga0070706_101043060 Ga0070706_1010430601 147
254 3300005468 Ga0070707_100003743 Ga0070707_1000037433 147
255 3300005468 Ga0070707_100004726 Ga0070707_1000047262 147
256 3300005468 Ga0070707_100078585 Ga0070707_1000785851 147
257 3300005468 Ga0070707_100202380 Ga0070707_1002023802 147
258 3300005468 Ga0070707_100342473 Ga0070707_1003424731 147
259 3300005471 Ga0070698_100006410 Ga0070698_1000064102 147
260 3300005471 Ga0070698_100014708 Ga0070698_1000147089 147
261 3300005471 Ga0070698_100015939 Ga0070698_1000159398 147
262 3300005471 Ga0070698_100031905 Ga0070698_1000319057 147
263 3300005518 Ga0070699_100001840 Ga0070699_10000184013 147
264 3300005518 Ga0070699_100140687 Ga0070699_1001406871 147
265 3300005535 Ga0070684_100667519 Ga0070684_1006675192 147
266 3300005536 Ga0070697_100010086 Ga0070697_1000100865 147
267 3300005536 Ga0070697_100191889 Ga0070697_1001918893 147
268 3300005545 Ga0070695_100492583 Ga0070695_1004925831 147
269 3300005546 Ga0070696_100366852 Ga0070696_1003668522 147
270 3300005548 Ga0070665_100001773 Ga0070665_10000177313 147
271 3300005563 Ga0068855_100042136 Ga0068855_1000421364 147
272 3300005564 Ga0070664_100933493 Ga0070664_1009334932 147
273 3300005614 Ga0068856_100126636 Ga0068856_1001266362 147
274 3300005614 Ga0068856_100672419 Ga0068856_1006724191 147
275 3300005616 Ga0068852_100155982 Ga0068852_1001559822 147
276 3300005719 Ga0068861_100819218 Ga0068861_1008192182 147
277 3300005937 Ga0081455_10259285 Ga0081455_102592851 147
278 3300005937 Ga0081455_10419419 Ga0081455_104194192 147
279 3300006028 Ga0070717_10052210 Ga0070717_100522103 147
280 3300006028 Ga0070717_10056246 Ga0070717_100562461 147
281 3300006028 Ga0070717_10067905 Ga0070717_100679053 147
282 3300006028 Ga0070717_10083120 Ga0070717_100831203 147
283 3300006028 Ga0070717_10098603 Ga0070717_100986033 147
284 3300006028 Ga0070717_10119488 Ga0070717_101194882 147
285 3300006028 Ga0070717_10184412 Ga0070717_101844123 147
286 3300006028 Ga0070717_10188673 Ga0070717_101886732 147
287 3300006028 Ga0070717_10315200 Ga0070717_103152002 147
288 3300006028 Ga0070717_10514566 Ga0070717_105145662 147
289 3300006038 Ga0075365_10124849 Ga0075365_101248492 147
290 3300006163 Ga0070715_10042823 Ga0070715_100428232 147
291 3300006163 Ga0070715_10277055 Ga0070715_102770551 147
292 3300006163 Ga0070715_10515841 Ga0070715_105158411 147
293 3300006173 Ga0070716_100000834 Ga0070716_10000083412 147
294 3300006173 Ga0070716_100007749 Ga0070716_1000077493 147
295 3300006173 Ga0070716_100013790 Ga0070716_1000137905 147
296 3300006173 Ga0070716_100028911 Ga0070716_1000289112 147
297 3300006173 Ga0070716_100060886 Ga0070716_1000608863 147
298 3300006175 Ga0070712_100100058 Ga0070712_1001000582 147
299 3300006175 Ga0070712_100269866 Ga0070712_1002698662 147
300 3300006175 Ga0070712_100315063 Ga0070712_1003150632 147
301 3300006175 Ga0070712_100477669 Ga0070712_1004776692 147
302 3300006237 Ga0097621_101645323 Ga0097621_1016453231 147
303 3300006844 Ga0075428_100000913 Ga0075428_1000009131 147
304 3300006852 Ga0075433_11628469 Ga0075433_116284691 147
305 3300006871 Ga0075434_100003103 Ga0075434_1000031037 147
306 3300006871 Ga0075434_100111416 Ga0075434_1001114163 147
307 3300006871 Ga0075434_100370189 Ga0075434_1003701891 147
308 3300006871 Ga0075434_100536059 Ga0075434_1005360592 147
309 3300006914 Ga0075436_100016606 Ga0075436_1000166062 147
310 3300006914 Ga0075436_100126519 Ga0075436_1001265192 147
311 3300006914 Ga0075436_100188068 Ga0075436_1001880682 147
312 3300006914 Ga0075436_100396326 Ga0075436_1003963262 147
313 3300007076 Ga0075435_100002123 Ga0075435_10000212311 147
314 3300007076 Ga0075435_100078552 Ga0075435_1000785522 147
315 3300007076 Ga0075435_100292733 Ga0075435_1002927333 147
316 3300007076 Ga0075435_100415275 Ga0075435_1004152751 147
317 3300007265 Ga0099794_10127954 Ga0099794_101279543 147
318 3300009094 Ga0111539_11164484 Ga0111539_111644842 147
319 3300009098 Ga0105245_10328136 Ga0105245_103281362 147
320 3300009174 Ga0105241_10008005 Ga0105241_100080054 147
321 3300009176 Ga0105242_10959107 Ga0105242_109591072 147
322 3300009545 Ga0105237_10456376 Ga0105237_104563761 147
323 3300009545 Ga0105237_11650635 Ga0105237_116506351 147
324 3300009551 Ga0105238_10049368 Ga0105238_100493682 147
325 3300009551 Ga0105238_10117612 Ga0105238_101176123 147
326 3300010375 Ga0105239_10661841 Ga0105239_106618412 147
327 3300013100 Ga0157373_10303837 Ga0157373_103038372 147
328 3300013105 Ga0157369_10154832 Ga0157369_101548322 147
329 3300013105 Ga0157369_10822605 Ga0157369_108226051 147
330 3300013296 Ga0157374_10650177 Ga0157374_106501772 147
331 3300013296 Ga0157374_12246318 Ga0157374_122463181 147
332 3300013307 Ga0157372_10992051 Ga0157372_109920512 147
333 3300013307 Ga0157372_11296355 Ga0157372_112963551 147
334 3300014325 Ga0163163_10782486 Ga0163163_107824862 147
335 3300014969 Ga0157376_10222186 Ga0157376_102221862 147
336 3300020081 Ga0206354_10275428 Ga0206354_102754281 147
337 3300020082 Ga0206353_10592838 Ga0206353_105928382 147
338 3300020082 Ga0206353_10830465 Ga0206353_108304651 147
339 3300021388 Ga0213875_10000287 Ga0213875_1000028732 147
340 3300022467 Ga0224712_10182272 Ga0224712_101822721 147
341 3300022467 Ga0224712_10186064 Ga0224712_101860642 147
342 3300025898 Ga0207692_10006005 Ga0207692_100060054 147
343 3300025898 Ga0207692_10034045 Ga0207692_100340452 147
344 3300025898 Ga0207692_10228932 Ga0207692_102289321 147
345 3300025898 Ga0207692_10295576 Ga0207692_102955762 147
346 3300025898 Ga0207692_10370002 Ga0207692_103700022 147
347 3300025904 Ga0207647_10004285 Ga0207647_100042855 147
348 3300025905 Ga0207685_10131950 Ga0207685_101319502 147
349 3300025905 Ga0207685_10360479 Ga0207685_103604791 147
350 3300025905 Ga0207685_10689472 Ga0207685_106894721 147
351 3300025906 Ga0207699_10004085 Ga0207699_100040856 147
352 3300025906 Ga0207699_10014496 Ga0207699_100144962 147
353 3300025906 Ga0207699_10042093 Ga0207699_100420933 147
354 3300025906 Ga0207699_10135055 Ga0207699_101350551 147
355 3300025910 Ga0207684_10004284 Ga0207684_100042846 147
356 3300025910 Ga0207684_10015569 Ga0207684_100155694 147
357 3300025910 Ga0207684_10579103 Ga0207684_105791032 147
358 3300025911 Ga0207654_10905338 Ga0207654_109053381 147
359 3300025913 Ga0207695_10017586 Ga0207695_100175862 147
360 3300025914 Ga0207671_10000315 Ga0207671_1000031561 147
361 3300025914 Ga0207671_10295242 Ga0207671_102952421 147
362 3300025915 Ga0207693_10049412 Ga0207693_100494122 147
363 3300025915 Ga0207693_10403355 Ga0207693_104033551 147
364 3300025915 Ga0207693_10829757 Ga0207693_108297571 147
365 3300025916 Ga0207663_10010575 Ga0207663_100105751 147
366 3300025916 Ga0207663_10158419 Ga0207663_101584192 147
367 3300025922 Ga0207646_10004972 Ga0207646_1000497213 147
368 3300025922 Ga0207646_10011644 Ga0207646_100116449 147
369 3300025922 Ga0207646_10030961 Ga0207646_100309616 147
370 3300025922 Ga0207646_10051639 Ga0207646_100516392 147
371 3300025924 Ga0207694_10006485 Ga0207694_100064852 147
372 3300025924 Ga0207694_10218296 Ga0207694_102182963 147
373 3300025927 Ga0207687_10361440 Ga0207687_103614401 147
374 3300025928 Ga0207700_10002340 Ga0207700_100023405 147
375 3300025928 Ga0207700_10049616 Ga0207700_100496162 147
376 3300025928 Ga0207700_10174139 Ga0207700_101741393 147
377 3300025928 Ga0207700_10214165 Ga0207700_102141652 147
378 3300025928 Ga0207700_10405572 Ga0207700_104055722 147
379 3300025929 Ga0207664_10002824 Ga0207664_100028246 147
380 3300025929 Ga0207664_10016883 Ga0207664_100168834 147
381 3300025929 Ga0207664_10023592 Ga0207664_100235923 147
382 3300025929 Ga0207664_10082530 Ga0207664_100825302 147
383 3300025929 Ga0207664_10117183 Ga0207664_101171832 147
384 3300025929 Ga0207664_10158240 Ga0207664_101582401 147
385 3300025929 Ga0207664_10696164 Ga0207664_106961641 147
386 3300025929 Ga0207664_10702685 Ga0207664_107026851 147
387 3300025929 Ga0207664_10717536 Ga0207664_107175362 147
388 3300025935 Ga0207709_10128188 Ga0207709_101281882 147
389 3300025938 Ga0207704_10913834 Ga0207704_109138341 147
390 3300025938 Ga0207704_11964896 Ga0207704_119648961 147
391 3300025939 Ga0207665_10001912 Ga0207665_1000191215 147
392 3300025939 Ga0207665_10004808 Ga0207665_100048083 147
393 3300025939 Ga0207665_10025930 Ga0207665_100259301 147
394 3300025939 Ga0207665_10131080 Ga0207665_101310803 147
395 3300025941 Ga0207711_10490461 Ga0207711_104904612 147
396 3300025944 Ga0207661_10586008 Ga0207661_105860082 147
397 3300025961 Ga0207712_10095845 Ga0207712_100958452 147
398 3300026067 Ga0207678_10061117 Ga0207678_100611172 147
399 3300026067 Ga0207678_10209642 Ga0207678_102096423 147
400 3300026078 Ga0207702_10054781 Ga0207702_100547813 147
401 3300026078 Ga0207702_10392775 Ga0207702_103927753 147
402 3300026088 Ga0207641_11503704 Ga0207641_115037041 147
403 3300026118 Ga0207675_100388319 Ga0207675_1003883191 147
404 3300026142 Ga0207698_10969304 Ga0207698_109693041 147
405 3300028379 Ga0268266_10004213 Ga0268266_1000421315 147
406 3300028379 Ga0268266_10893438 Ga0268266_108934381 147
407 3300028379 Ga0268266_11191246 Ga0268266_111912461 147
408 3300028800 Ga0265338_10002786 Ga0265338_1000278610 147
409 3300031456 Ga0307513_10495101 Ga0307513_104951011 147
410 3300033545 Ga0316214_1001605 Ga0316214_10016052 147
411 3300033547 Ga0316212_1003391 Ga0316212_10033913 147
412 3300034820 Ga0373959_0013674 Ga0373959_0013674_832_1275 147
413 3300035085 Ga0373929_0043553 Ga0373929_0043553_473_916 147
414 3300035086 Ga0373934_0029806 Ga0373934_0029806_1021_1464 147
415 3300035090 Ga0373949_0146459 Ga0373949_0146459_128_571 147
416 3300035092 Ga0373952_0093913 Ga0373952_0093913_148_591 147
417 3300035111 Ga0373923_0128996 Ga0373923_0128996_341_784 147
418 3300035112 Ga0373932_0159379 Ga0373932_0159379_216_659 147
419 3300035113 Ga0373936_0100930 Ga0373936_0100930_407_850 147
420 3300035116 Ga0373945_0183514 Ga0373945_0183514_193_636 147
421 3300035118 Ga0373954_0173113 Ga0373954_0173113_493_939 147
422 3300035119 Ga0373956_0109521 Ga0373956_0109521_670_1113 147
423 3300035120 Ga0373957_0018282 Ga0373957_0018282_923_1366 147
424 3300035121 Ga0373960_0022337 Ga0373960_0022337_430_873 147
425 3300035170 Ga0373943_0165913 Ga0373943_0165913_707_1150 147
426 3300035171 Ga0373946_0041626 Ga0373946_0041626_931_1374 147
427 3300035172 Ga0373955_0043306 Ga0373955_0043306_1591_2034 147
428 3300035410 Ga0373924_0009102 Ga0373924_0009102_2425_2868 147
429 3300035691 Ga0373931_0109005 Ga0373931_0109005_786_1229 147
430 3300035692 Ga0373935_0283246 Ga0373935_0283246_258_701 147
431 3300035695 Ga0373927_0066943 Ga0373927_0066943_30_473 147
432 3300035695 Ga0373927_0076588 Ga0373927_0076588_1468_1911 147
433 3300035724 Ga0373933_0661671 Ga0373933_0661671_198_641 147
434 3300035725 Ga0373947_0005305 Ga0373947_0005305_1066_1509 147
435 3300036401 Ga0373937_0283176 Ga0373937_0283176_179_622 147
436 3300036401 Ga0373937_0701409 Ga0373937_0701409_218_664 147
437 3300037068 Ga0373925_0000028 Ga0373925_0000028_127733_128176 147
438 3300037068 Ga0373925_0100378 Ga0373925_0100378_1560_2003 147
439 3300037068 Ga0373925_1611224 Ga0373925_1611224_19_462 147
440 3300037853 Ga0436364_0154596 Ga0436364_0154596_44886_45362 147
441 3300044656 Ga0466969_0016390 Ga0466969_0016390_1800_2243 147
442 3300044656 Ga0466969_0066981 Ga0466969_0066981_465_908 147
443 3300044684 Ga0466966_0299803 Ga0466966_0299803_125_568 147
444 3300044693 Ga0466961_0110911 Ga0466961_0110911_610_1053 147
445 3300044693 Ga0466961_0137878 Ga0466961_0137878_678_1121 147
446 3300044693 Ga0466961_0406119 Ga0466961_0406119_68_511 147
447 3300044694 Ga0466963_0202421 Ga0466963_0202421_177_620 147
448 3300044694 Ga0466963_0217799 Ga0466963_0217799_77_556 147
449 3300044719 Ga0466971_0015573 Ga0466971_0015573_82_525 147
450 3300044765 Ga0466970_0122853 Ga0466970_0122853_785_1228 147
451 3300044765 Ga0466970_0271267 Ga0466970_0271267_28_507 147
452 3300045049 Ga0466959_0031393 Ga0466959_0031393_1497_1940 147
453 3300045049 Ga0466959_0275941 Ga0466959_0275941_141_584 147
454 3300045836 Ga0466958_0451819 Ga0466958_0451819_336_815 147
455 3300046454 Ga0495592_0047732 Ga0495592_0047732_1894_2337 147
456 3300046459 Ga0495629_0031279 Ga0495629_0031279_1755_2198 147
457 3300046461 Ga0495641_0027740 Ga0495641_0027740_401_844 147
458 3300046462 Ga0495651_0000372 Ga0495651_0000372_32398_32841 147
459 3300046462 Ga0495651_0012103 Ga0495651_0012103_2902_3345 147
460 3300046462 Ga0495651_0026345 Ga0495651_0026345_2794_3237 147
461 3300046463 Ga0495653_0249503 Ga0495653_0249503_424_867 147
462 3300046472 Ga0495580_0071610 Ga0495580_0071610_1259_1702 147
463 3300046473 Ga0495582_0000278 Ga0495582_0000278_10230_10673 147
464 3300046473 Ga0495582_0020174 Ga0495582_0020174_1337_1780 147
465 3300046475 Ga0495639_0151541 Ga0495639_0151541_547_990 147
466 3300046476 Ga0495662_0071405 Ga0495662_0071405_449_892 147
467 3300046477 Ga0495664_0016303 Ga0495664_0016303_941_1384 147
468 3300046511 Ga0495608_0045349 Ga0495608_0045349_2259_2702 147
469 3300046516 Ga0495628_0033223 Ga0495628_0033223_472_915 147
470 3300046516 Ga0495628_0050615 Ga0495628_0050615_311_754 147
471 3300046529 Ga0495652_0005278 Ga0495652_0005278_7598_8041 147
472 3300046529 Ga0495652_0190464 Ga0495652_0190464_51_494 147
473 3300046531 Ga0495665_0013675 Ga0495665_0013675_2580_3023 147
474 3300046533 Ga0495640_0061139 Ga0495640_0061139_1895_2338 147
475 3300046535 Ga0495586_0171227 Ga0495586_0171227_620_1063 147
476 3300046536 Ga0495587_0019232 Ga0495587_0019232_85_528 147
477 3300046543 Ga0495645_0048434 Ga0495645_0048434_2444_2887 147
478 3300046559 Ga0495667_0147073 Ga0495667_0147073_179_622 147
479 3300046642 Ga0495634_0101027 Ga0495634_0101027_971_1414 147
480 3300046663 Ga0495635_0046593 Ga0495635_0046593_1267_1710 147
481 3300046663 Ga0495635_0256879 Ga0495635_0256879_621_1064 147
482 3300046675 Ga0495657_0047572 Ga0495657_0047572_36_479 147
483 3300046678 Ga0495599_0068670 Ga0495599_0068670_1188_1631 147
484 3300046679 Ga0495623_0063125 Ga0495623_0063125_943_1386 147
485 3300046680 Ga0495646_0095254 Ga0495646_0095254_1222_1665 147
486 3300046681 Ga0495647_0102963 Ga0495647_0102963_496_939 147
487 3300046681 Ga0495647_0158781 Ga0495647_0158781_49_492 147
488 3300046683 Ga0495658_0000239 Ga0495658_0000239_29544_29987 147
489 3300046683 Ga0495658_0041322 Ga0495658_0041322_163_606 147
490 3300046689 Ga0495613_0001169 Ga0495613_0001169_8828_9271 147
491 3300046690 Ga0495624_0025196 Ga0495624_0025196_867_1310 147
492 3300046809 Ga0495600_0028709 Ga0495600_0028709_3015_3458 147
493 3300046809 Ga0495600_0060822 Ga0495600_0060822_239_682 147
494 3300047315 Ga0495581_0001258 Ga0495581_0001258_3336_3779 147
495 3300047315 Ga0495581_0076950 Ga0495581_0076950_737_1180 147
496 3300047317 Ga0495604_0115026 Ga0495604_0115026_175_618 147
497 3300047319 Ga0495674_0246935 Ga0495674_0246935_848_1291 147
498 3300047321 Ga0495676_0187264 Ga0495676_0187264_804_1247 147
499 3300047321 Ga0495676_0244094 Ga0495676_0244094_329_772 147
500 3300047322 Ga0495680_0073614 Ga0495680_0073614_1337_1780 147
501 3300047444 Ga0495675_0082505 Ga0495675_0082505_1073_1516 147
502 3300047471 Ga0495684_0041264 Ga0495684_0041264_2554_2997 147
503 3300047673 Ga0495593_0025382 Ga0495593_0025382_1904_2347 147
504 3300048088 Ga0495602_0013650 Ga0495602_0013650_2495_2938 147
505 3300048088 Ga0495602_0143686 Ga0495602_0143686_903_1346 147
506 3300048089 Ga0495614_0402249 Ga0495614_0402249_40_483 147
507 3300048903 Ga0496100_0077093 Ga0496100_0077093_1411_1854 147
508 3300048903 Ga0496100_0224467 Ga0496100_0224467_381_860 147
509 3300048903 Ga0496100_0238419 Ga0496100_0238419_31_474 147
510 3300048903 Ga0496100_0475745 Ga0496100_0475745_491_934 147
511 3300048904 Ga0496101_0029283 Ga0496101_0029283_2593_3036 147
512 3300048904 Ga0496101_0051214 Ga0496101_0051214_1068_1511 147
513 3300048904 Ga0496101_0218047 Ga0496101_0218047_991_1434 147
514 3300048905 Ga0496102_0031920 Ga0496102_0031920_1760_2203 147
515 3300048907 Ga0496104_0002724 Ga0496104_0002724_7499_7978 147
516 3300048907 Ga0496104_0005574 Ga0496104_0005574_9208_9651 147
517 3300048907 Ga0496104_0023511 Ga0496104_0023511_1447_1890 147
518 3300048908 Ga0496105_0001911 Ga0496105_0001911_6555_7034 147
519 3300048908 Ga0496105_0027783 Ga0496105_0027783_2825_3268 147
520 3300048908 Ga0496105_0232585 Ga0496105_0232585_69_512 147
521 3300048909 Ga0496106_0370295 Ga0496106_0370295_197_676 147
522 3300048911 Ga0496108_0279962 Ga0496108_0279962_986_1429 147
523 3300048912 Ga0496109_0041527 Ga0496109_0041527_734_1213 147
524 3300048912 Ga0496109_0734549 Ga0496109_0734549_324_767 147
525 3300048913 Ga0496110_0093290 Ga0496110_0093290_2229_2672 147
526 3300048913 Ga0496110_0172120 Ga0496110_0172120_403_846 147
527 3300048913 Ga0496110_0419143 Ga0496110_0419143_461_904 147
528 3300048915 Ga0496112_0039448 Ga0496112_0039448_3258_3737 147
529 3300048915 Ga0496112_0091593 Ga0496112_0091593_795_1238 147
530 3300048915 Ga0496112_0548130 Ga0496112_0548130_409_852 147
531 3300048916 Ga0496113_0020019 Ga0496113_0020019_991_1470 147
532 3300048916 Ga0496113_0095888 Ga0496113_0095888_1769_2212 147
533 3300048917 Ga0496114_0011068 Ga0496114_0011068_5174_5617 147
534 3300048918 Ga0496115_0000838 Ga0496115_0000838_4496_4939 147
535 3300048918 Ga0496115_0020588 Ga0496115_0020588_3889_4332 147
536 3300048918 Ga0496115_0032547 Ga0496115_0032547_2119_2562 147
537 3300048918 Ga0496115_0088234 Ga0496115_0088234_787_1230 147
538 3300048922 Ga0496119_0154275 Ga0496119_0154275_745_1188 147
539 3300050512 nmdc:mga0n895_1332762_c1 nmdc:mga0n895_1332762_c1_213_656 147
540 3300050512 nmdc:mga0n895_347481_c1 nmdc:mga0n895_347481_c1_841_1284 147
541 3300050512 nmdc:mga0n895_563112_c1 nmdc:mga0n895_563112_c1_548_991 147
542 3300050513 nmdc:mga0rr50_575114_c1 nmdc:mga0rr50_575114_c1_425_868 147
543 3300050514 nmdc:mga08x19_175529_c1 nmdc:mga08x19_175529_c1_283_726 147
544 3300053077 Ga0495601_0180199 Ga0495601_0180199_496_939 147
545 3300053084 Ga0495595_0017730 Ga0495595_0017730_208_651 147
546 3300053100 Ga0500660_126139 Ga0500660_126139_45_503 147
547 3300053159 Ga0500630_052254 Ga0500630_052254_268_711 147
548 3300061719 Ga0466962_0021003 Ga0466962_0021003_30_473 147
549 3300061719 Ga0466962_0117191 Ga0466962_0117191_689_1132 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

159

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gkj-assembly1.cif.gz_B structure of endoms in apo form 0.7924 117 145
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7678 1 147
6tmf-assembly1.cif.gz_F structure of an archaeal abce1-bound ribosomal post-splitting complex 0.7594 120 145
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.7542 1 147
1xqa-assembly1.cif.gz_A structure of a possible glyoxalase from bacillus cereus 0.7513 1 146
ID Description Score Start End Superfamily
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8468 1 146 3.10.180.10
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.8242 103 146 3.30.460.40
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8199 1 146 3.10.180.10
6fz6B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7672 118 145 3.20.20.70
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7442 7 146 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3D9ZAU1-F1-model_v4 Glyoxalase-like domain-containing protein 0.9464 1 147
AF-A0A3D9ZAU1-F1-model_v4 Glyoxalase-like domain-containing protein 0.9402 1 147
AF-A0A841FPR1-F1-model_v4 Glyoxalase-like domain-containing protein 0.9386 1 147
AF-A0A841FPR1-F1-model_v4 Glyoxalase-like domain-containing protein 0.9325 1 147
AF-A0A2P7PPZ1-F1-model_v4 deleted 0.9324 1 147

Feature Viewer

pLDDT pTM Quality
93.37 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map