F462323

General Info

Members Datasets Scaffolds Average Seq Length
549 301 1098 443

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100038441|Ga0070669_1000384414
Length 462
Sequence MARHYPAFAAVVLDLVGLQMRHGYNHRMAASEQLAMLVQTDRVHRSVYTDPAIFELEMDQVFGRAWLVLGHESQARHPGDYFTTRMGREPVVVVRKDDGEIGVLVNRCAHRGATVCAEGRGNAERFVCPYHGWSYDRTGALQAVPFAGGYEKGKLPAGLKVVPRVSVYRGFIFASLSSQGEDLEAFLGPARASFDDFVDRAPGGELEVAGGVFKHAYDGNWKLMLENHLDGAHPAWVHASSVAVARGAPEPGKPGEEHYYDIAVRQMRQNGAPDSVWDAIGMWTTPHGHGYMGDYHDDSRLVAGLGNPAFEEYRRRLAAGVGEKEADRILRVTLWNTIIYPNCSFMSQFRQLRIIHPVAVDRSVVCTYSFRMKHAPAQMFRDTVAFANVVNGAGSWVLTDDLEVYERIQRGLSSGAVDWVYLGRGHGRDVDEAHGVRRGATGTSEVFIRAQFEAWLRYMSKP

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 6.74
Rhizosphere 88.16
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100038441 3300005353 Bacteria 3475
2 Ga0065707_10009615 3300005295 Bacteria 2407
3 Ga0070676_10059879 3300005328 Bacteria 2260
4 Ga0070676_10087976 3300005328 Unclassified 1897
5 Ga0070690_100000398 3300005330 Bacteria 21982
6 Ga0068869_100000982 3300005334 Bacteria 16552
7 Ga0070680_100009094 3300005336 Bacteria 7617
8 Ga0070682_100001096 3300005337 Bacteria 15544
9 Ga0068868_100000097 3300005338 Bacteria 54209
10 Ga0068868_100051835 3300005338 Bacteria 3229
11 Ga0068868_100139202 3300005338 Bacteria 1991
12 Ga0070689_100000188 3300005340 Bacteria 37400
13 Ga0070689_100016258 3300005340 Bacteria 5443
14 Ga0070691_10003606 3300005341 Bacteria 6990
15 Ga0070687_100000069 3300005343 Bacteria 33055
16 Ga0070687_100010657 3300005343 Bacteria 3989
17 Ga0070692_10006007 3300005345 Bacteria 5232
18 Ga0070668_100050452 3300005347 Bacteria 3204
19 Ga0070671_100004237 3300005355 Bacteria 11354
20 Ga0070674_100050686 3300005356 Bacteria 2858
21 Ga0070674_100070328 3300005356 Bacteria 2472
22 Ga0070673_100125487 3300005364 Bacteria 2147
23 Ga0070714_100134608 3300005435 Bacteria 2212
24 Ga0070713_100076587 3300005436 Bacteria 2842
25 Ga0070710_10004588 3300005437 Bacteria 6527
26 Ga0070701_10016602 3300005438 Bacteria 3427
27 Ga0070701_10048037 3300005438 Bacteria 2200
28 Ga0070711_100058057 3300005439 Bacteria 2682
29 Ga0070711_100066544 3300005439 Bacteria 2524
30 Ga0070705_100015943 3300005440 Bacteria 3894
31 Ga0070700_100002704 3300005441 Bacteria 9049
32 Ga0070694_100000562 3300005444 Bacteria 20530
33 Ga0070694_100014103 3300005444 Bacteria 5002
34 Ga0070678_100096282 3300005456 Bacteria 2283
35 Ga0070678_100272832 3300005456 Unclassified 1427
36 Ga0070662_100029715 3300005457 Bacteria 3817
37 Ga0070681_10009530 3300005458 Bacteria 9554
38 Ga0068867_100000296 3300005459 Bacteria 32704
39 Ga0068867_100064833 3300005459 Bacteria 2716
40 Ga0068867_100107804 3300005459 Bacteria 2135
41 Ga0070706_100085976 3300005467 Bacteria 2914
42 Ga0070698_100065221 3300005471 Bacteria 3667
43 Ga0070679_100003737 3300005530 Bacteria 13955
44 Ga0070684_100191597 3300005535 Bacteria 1860
45 Ga0070697_100004195 3300005536 Bacteria 11049
46 Ga0070697_100009252 3300005536 Bacteria 7699
47 Ga0070672_100082586 3300005543 Bacteria 2578
48 Ga0070686_100000090 3300005544 Bacteria 63246
49 Ga0070695_100000188 3300005545 Bacteria 29840
50 Ga0070696_100000719 3300005546 Bacteria 21155
51 Ga0070696_100012269 3300005546 Bacteria 5743
52 Ga0070696_100018351 3300005546 Bacteria 4727
53 Ga0070696_100026446 3300005546 Bacteria 3947
54 Ga0070693_100038444 3300005547 Bacteria 2674
55 Ga0070693_100099886 3300005547 Bacteria 1766
56 Ga0070665_100105461 3300005548 Unclassified 2820
57 Ga0070704_100000064 3300005549 Bacteria 34900
58 Ga0068855_100000833 3300005563 Bacteria 38155
59 Ga0070664_100212118 3300005564 Unclassified 1731
60 Ga0068854_100035460 3300005578 Bacteria 3491
61 Ga0068856_100017695 3300005614 Bacteria 6911
62 Ga0070702_100000002 3300005615 Bacteria 83999
63 Ga0068852_100044863 3300005616 Bacteria 3757
64 Ga0068859_100000195 3300005617 Bacteria 59015
65 Ga0068864_100036408 3300005618 Bacteria 4195
66 Ga0068864_100060541 3300005618 Bacteria 3278
67 Ga0068866_10000037 3300005718 Bacteria 50738
68 Ga0068861_100000043 3300005719 Bacteria 57807
69 Ga0068861_100018060 3300005719 Bacteria 5016
70 Ga0068858_100001438 3300005842 Bacteria 24478
71 Ga0068858_100020205 3300005842 Bacteria 6227
72 Ga0068860_100037967 3300005843 Bacteria 4609
73 Ga0068862_100002188 3300005844 Bacteria 17538
74 Ga0068862_100014461 3300005844 Bacteria 6548
75 Ga0081455_10003399 3300005937 Bacteria 18319
76 Ga0081455_10003542 3300005937 Bacteria 17909
77 Ga0081455_10004584 3300005937 Bacteria 15440
78 Ga0081538_10001949 3300005981 Bacteria 20670
79 Ga0081538_10008855 3300005981 Bacteria 8468
80 Ga0081540_1000313 3300005983 Bacteria 50236
81 Ga0081540_1017098 3300005983 Bacteria 4505
82 Ga0081540_1020004 3300005983 Bacteria 4044
83 Ga0081539_10000233 3300005985 Bacteria 130647
84 Ga0070717_10058410 3300006028 Bacteria 3190
85 Ga0070717_10258354 3300006028 Bacteria 1541
86 Ga0075365_10013347 3300006038 Bacteria 4909
87 Ga0070712_100014497 3300006175 Bacteria 5059
88 Ga0070712_100088226 3300006175 Bacteria 2266
89 Ga0075367_10099728 3300006178 Bacteria 1774
90 Ga0075366_10069709 3300006195 Bacteria 2093
91 Ga0097621_100000045 3300006237 Bacteria 65278
92 Ga0068871_100000040 3300006358 Bacteria 69044
93 Ga0068871_100002037 3300006358 Bacteria 13697
94 Ga0075428_100000047 3300006844 Bacteria 96882
95 Ga0075428_100021608 3300006844 Bacteria 7124
96 Ga0075428_100067046 3300006844 Bacteria 3929
97 Ga0075430_100048041 3300006846 Bacteria 3604
98 Ga0075430_100059555 3300006846 Bacteria 3210
99 Ga0075430_100064289 3300006846 Bacteria 3082
100 Ga0075430_100088866 3300006846 Bacteria 2585
101 Ga0075431_100053487 3300006847 Bacteria 4163
102 Ga0075431_100057586 3300006847 Bacteria 4009
103 Ga0075433_10000605 3300006852 Bacteria 23895
104 Ga0075434_100000414 3300006871 Bacteria 31577
105 Ga0075434_100000554 3300006871 Bacteria 28632
106 Ga0075434_100080149 3300006871 Bacteria 3261
107 Ga0075434_100135422 3300006871 Bacteria 2483
108 Ga0075434_100166485 3300006871 Bacteria 2224
109 Ga0075429_100000067 3300006880 Bacteria 51949
110 Ga0075429_100054870 3300006880 Bacteria 3466
111 Ga0075429_100065289 3300006880 Bacteria 3168
112 Ga0075429_100081289 3300006880 Bacteria 2825
113 Ga0075429_100147417 3300006880 Bacteria 2060
114 Ga0068865_100000343 3300006881 Bacteria 25779
115 Ga0068865_100106674 3300006881 Bacteria 2059
116 Ga0068865_100158596 3300006881 Bacteria 1724
117 Ga0075436_100001082 3300006914 Bacteria 18349
118 Ga0075436_100089098 3300006914 Unclassified 2144
119 Ga0097620_100000195 3300006931 Bacteria 59015
120 Ga0075435_100005507 3300007076 Bacteria 8849
121 Ga0075435_100009593 3300007076 Bacteria 7023
122 Ga0075435_100032669 3300007076 Bacteria 4111
123 Ga0075435_100046139 3300007076 Bacteria 3494
124 Ga0075435_100053714 3300007076 Bacteria 3250
125 Ga0075435_100070202 3300007076 Bacteria 2859
126 Ga0099794_10008099 3300007265 Bacteria 4352
127 Ga0111539_10057421 3300009094 Bacteria 4622
128 Ga0111539_10060108 3300009094 Bacteria 4505
129 Ga0105245_10000306 3300009098 Bacteria 47026
130 Ga0114129_10000040 3300009147 Bacteria 107971
131 Ga0114129_10050610 3300009147 Bacteria 5835
132 Ga0114129_10072760 3300009147 Bacteria 4791
133 Ga0114129_10073943 3300009147 Bacteria 4747
134 Ga0114129_10169937 3300009147 Bacteria 2973
135 Ga0114129_10224125 3300009147 Bacteria 2535
136 Ga0114129_10298472 3300009147 Bacteria 2148
137 Ga0105243_10000035 3300009148 Bacteria 177598
138 Ga0105243_10027450 3300009148 Bacteria 4362
139 Ga0105243_10098449 3300009148 Bacteria 2423
140 Ga0105242_10000097 3300009176 Bacteria 61646
141 Ga0105242_10045246 3300009176 Bacteria 3566
142 Ga0105248_10002392 3300009177 Bacteria 20840
143 Ga0105248_10124109 3300009177 Bacteria 2913
144 Ga0105249_10001837 3300009553 Bacteria 18455
145 Ga0105249_10035051 3300009553 Bacteria 4549
146 Ga0105239_10043450 3300010375 Bacteria 4926
147 Ga0105239_10045568 3300010375 Bacteria 4807
148 Ga0157378_10001996 3300013297 Bacteria 18243
149 Ga0157378_10139603 3300013297 Bacteria 2249
150 Ga0157375_10028268 3300013308 Bacteria 5254
151 Ga0157377_10018828 3300014745 Bacteria 3596
152 Ga0157376_10000403 3300014969 Bacteria 28093
153 Ga0213876_10015217 3300021384 Bacteria 4075
154 Ga0213875_10000023 3300021388 Bacteria 213455
155 Ga0224572_1004319 3300024225 Bacteria 2462
156 Ga0209758_1000158 3300025297 Bacteria 156129
157 Ga0207656_10009542 3300025321 Bacteria 3606
158 Ga0207692_10055714 3300025898 Bacteria 2025
159 Ga0207642_10004703 3300025899 Bacteria 4411
160 Ga0207710_10057640 3300025900 Bacteria 1755
161 Ga0207688_10004951 3300025901 Bacteria 7249
162 Ga0207645_10046417 3300025907 Bacteria 2775
163 Ga0207643_10007658 3300025908 Bacteria 5800
164 Ga0207643_10055952 3300025908 Bacteria 2244
165 Ga0207684_10067285 3300025910 Bacteria 3044
166 Ga0207707_10098849 3300025912 Bacteria 2551
167 Ga0207707_10104629 3300025912 Unclassified 2474
168 Ga0207693_10016629 3300025915 Bacteria 5877
169 Ga0207693_10043293 3300025915 Bacteria 3542
170 Ga0207693_10064489 3300025915 Bacteria 2869
171 Ga0207693_10127708 3300025915 Bacteria 1999
172 Ga0207663_10010449 3300025916 Bacteria 4942
173 Ga0207663_10071313 3300025916 Bacteria 2242
174 Ga0207662_10000006 3300025918 Bacteria 105457
175 Ga0207657_10040052 3300025919 Bacteria 4156
176 Ga0207652_10002034 3300025921 Bacteria 17425
177 Ga0207652_10020614 3300025921 Bacteria 5432
178 Ga0207646_10068748 3300025922 Bacteria 3164
179 Ga0207681_10019362 3300025923 Bacteria 4300
180 Ga0207681_10057510 3300025923 Bacteria 2658
181 Ga0207694_10246735 3300025924 Bacteria 1460
182 Ga0207687_10002839 3300025927 Bacteria 11755
183 Ga0207664_10007955 3300025929 Bacteria 7371
184 Ga0207664_10055431 3300025929 Bacteria 3145
185 Ga0207664_10076184 3300025929 Bacteria 2714
186 Ga0207644_10060518 3300025931 Bacteria 2740
187 Ga0207706_10098543 3300025933 Bacteria 2571
188 Ga0207686_10000690 3300025934 Bacteria 20922
189 Ga0207709_10010138 3300025935 Bacteria 5190
190 Ga0207709_10104138 3300025935 Bacteria 1883
191 Ga0207670_10025617 3300025936 Bacteria 3705
192 Ga0207704_10002301 3300025938 Bacteria 8579
193 Ga0207665_10011501 3300025939 Bacteria 5814
194 Ga0207665_10046792 3300025939 Bacteria 2899
195 Ga0207691_10006839 3300025940 Bacteria 11004
196 Ga0207691_10084488 3300025940 Bacteria 2849
197 Ga0207711_10088759 3300025941 Bacteria 2715
198 Ga0207689_10000082 3300025942 Bacteria 76708
199 Ga0207689_10018333 3300025942 Bacteria 5907
200 Ga0207667_10054691 3300025949 Bacteria 4198
201 Ga0207640_10001404 3300025981 Bacteria 13006
202 Ga0207677_10013069 3300026023 Bacteria 4797
203 Ga0207677_10117685 3300026023 Bacteria 1992
204 Ga0207703_10009391 3300026035 Bacteria 7688
205 Ga0207703_10164246 3300026035 Bacteria 1947
206 Ga0207678_10057963 3300026067 Bacteria 3333
207 Ga0207708_10000936 3300026075 Bacteria 21857
208 Ga0207708_10004812 3300026075 Bacteria 9943
209 Ga0207702_10013289 3300026078 Bacteria 6847
210 Ga0207641_10010400 3300026088 Bacteria 7646
211 Ga0207648_10000300 3300026089 Bacteria 53912
212 Ga0207648_10008622 3300026089 Bacteria 9853
213 Ga0207648_10010566 3300026089 Bacteria 8736
214 Ga0207648_10170263 3300026089 Bacteria 1925
215 Ga0207676_10014798 3300026095 Bacteria 5619
216 Ga0207676_10020465 3300026095 Bacteria 4842
217 Ga0207674_10258354 3300026116 Bacteria 1689
218 Ga0207675_100000064 3300026118 Bacteria 79279
219 Ga0207675_100022516 3300026118 Bacteria 5866
220 Ga0207683_10052593 3300026121 Bacteria 3569
221 Ga0209999_1004851 3300027543 Bacteria 2419
222 Ga0209588_1001621 3300027671 Bacteria 5917
223 Ga0209966_1001810 3300027695 Bacteria 3617
224 Ga0207428_10001387 3300027907 Bacteria 25585
225 Ga0268265_10002988 3300028380 Bacteria 12355
226 Ga0268265_10005451 3300028380 Bacteria 8692
227 Ga0268264_10001394 3300028381 Bacteria 22601
228 Ga0265338_10011981 3300028800 Bacteria 9930
229 Ga0307511_10000103 3300030521 Bacteria 75234
230 Ga0265332_10038476 3300031238 Bacteria 2073
231 Ga0265340_10000923 3300031247 Bacteria 16698
232 Ga0265340_10032391 3300031247 Bacteria 2609
233 Ga0265339_10000093 3300031249 Bacteria 75604
234 Ga0265331_10024279 3300031250 Bacteria 3069
235 Ga0265316_10034370 3300031344 Bacteria 4119
236 Ga0307408_100046870 3300031548 Bacteria 3093
237 Ga0265313_10000171 3300031595 Bacteria 68612
238 Ga0265314_10086687 3300031711 Bacteria 2049
239 Ga0265342_10000024 3300031712 Bacteria 171500
240 Ga0265342_10081742 3300031712 Bacteria 1865
241 Ga0307416_100027258 3300032002 Bacteria 4227
242 Ga0307416_100027450 3300032002 Bacteria 4216
243 Ga0373930_0009822 3300034816 Bacteria 1700
244 Ga0373926_0010302 3300035083 Bacteria 3131
245 Ga0373928_0014108 3300035084 Bacteria 1611
246 Ga0373934_0013755 3300035086 Bacteria 3062
247 Ga0373934_0024738 3300035086 Bacteria 2322
248 Ga0373940_0001999 3300035088 Bacteria 3859
249 Ga0373944_0038538 3300035089 Bacteria 1468
250 Ga0373932_0030523 3300035112 Bacteria 1494
251 Ga0373936_0008644 3300035113 Bacteria 3834
252 Ga0373936_0013435 3300035113 Bacteria 3125
253 Ga0373939_0000881 3300035114 Bacteria 7446
254 Ga0373954_0000195 3300035118 Bacteria 21980
255 Ga0373954_0001100 3300035118 Bacteria 10800
256 Ga0373954_0006844 3300035118 Bacteria 4975
257 Ga0373956_0023635 3300035119 Bacteria 2639
258 Ga0373960_0020139 3300035121 Bacteria 1761
259 Ga0373943_0000146 3300035170 Bacteria 27320
260 Ga0373946_0011552 3300035171 Bacteria 3297
261 Ga0373955_0022200 3300035172 Bacteria 3216
262 Ga0373961_0004750 3300035241 Bacteria 3268
263 Ga0373962_0006052 3300035242 Bacteria 2924
264 Ga0373924_0009173 3300035410 Bacteria 3620
265 Ga0373924_0022063 3300035410 Bacteria 2487
266 Ga0373931_0001822 3300035691 Bacteria 9268
267 Ga0373931_0003466 3300035691 Bacteria 7086
268 Ga0373931_0005626 3300035691 Bacteria 5813
269 Ga0373931_0030036 3300035691 Bacteria 2796
270 Ga0373935_0015101 3300035692 Bacteria 4663
271 Ga0373935_0029961 3300035692 Bacteria 3369
272 Ga0373935_0038001 3300035692 Bacteria 3013
273 Ga0373935_0123446 3300035692 Bacteria 1732
274 Ga0373935_0132365 3300035692 Bacteria 1677
275 Ga0373927_0001644 3300035695 Bacteria 16755
276 Ga0373927_0007053 3300035695 Bacteria 7622
277 Ga0373927_0018712 3300035695 Bacteria 4545
278 Ga0373927_0046091 3300035695 Bacteria 2821
279 Ga0373933_0005541 3300035724 Bacteria 6879
280 Ga0373933_0005942 3300035724 Bacteria 6640
281 Ga0373933_0029184 3300035724 Bacteria 3187
282 Ga0373947_0004463 3300035725 Bacteria 8212
283 Ga0373947_0059343 3300035725 Bacteria 2319
284 Ga0373937_0001045 3300036401 Bacteria 23385
285 Ga0373937_0097584 3300036401 Bacteria 2726
286 Ga0373937_0190204 3300036401 Bacteria 1929
287 Ga0373925_0010337 3300037068 Bacteria 6771
288 Ga0373925_0021542 3300037068 Bacteria 4697
289 Ga0373925_0056269 3300037068 Bacteria 2946
290 Ga0373925_0092328 3300037068 Bacteria 2316
291 Ga0436364_0604811 3300037853 Bacteria 2562
292 Ga0436364_0849285 3300037853 Bacteria 39310
293 Ga0436364_0855567 3300037853 Bacteria 1904
294 Ga0436365_0085928 3300039437 Plasmid 2630
295 Ga0436365_0611401 3300039437 Bacteria 3586
296 Ga0436365_1237657 3300039437 Bacteria 2879
297 Ga0436365_1839981 3300039437 Bacteria 9162
298 Ga0451807_0683397 3300041486 Bacteria 3178
299 Ga0439441_000454 3300042001 Bacteria 4390
300 Ga0439443_003700 3300042003 Bacteria 1950
301 Ga0439435_0000080 3300042436 Bacteria 11608
302 Ga0439435_0001252 3300042436 Bacteria 4611
303 Ga0439460_0008396 3300042461 Bacteria 2608
304 Ga0466966_0069264 3300044684 Bacteria 2213
305 Ga0466964_0023429 3300044706 Bacteria 2400
306 Ga0451576_0000822 3300045051 Bacteria 60600
307 Ga0451576_0108228 3300045051 Bacteria 2892
308 Ga0451576_0122680 3300045051 Bacteria 2705
309 Ga0466958_0063150 3300045836 Bacteria 2258
310 Ga0466967_0052536 3300045976 Bacteria 3577
311 Ga0495592_0000293 3300046454 Bacteria 42689
312 Ga0495592_0011260 3300046454 Bacteria 6764
313 Ga0495592_0066186 3300046454 Bacteria 2644
314 Ga0495603_0043697 3300046455 Bacteria 2675
315 Ga0495603_0122140 3300046455 Bacteria 1517
316 Ga0495629_0034015 3300046459 Bacteria 3604
317 Ga0495629_0036784 3300046459 Bacteria 3453
318 Ga0495651_0000749 3300046462 Bacteria 25119
319 Ga0495653_0003978 3300046463 Bacteria 11931
320 Ga0495653_0026542 3300046463 Bacteria 4643
321 Ga0495653_0037169 3300046463 Bacteria 3829
322 Ga0495580_0016240 3300046472 Bacteria 5593
323 Ga0495580_0028756 3300046472 Bacteria 4038
324 Ga0495580_0124203 3300046472 Bacteria 1791
325 Ga0495580_0126600 3300046472 Bacteria 1773
326 Ga0495582_0005169 3300046473 Bacteria 7301
327 Ga0495639_0003787 3300046475 Bacteria 6494
328 Ga0495662_0003159 3300046476 Bacteria 8313
329 Ga0495662_0023965 3300046476 Bacteria 2945
330 Ga0495662_0035883 3300046476 Bacteria 2393
331 Ga0495662_0036179 3300046476 Bacteria 2383
332 Ga0495664_0000075 3300046477 Bacteria 48095
333 Ga0495594_0037155 3300046499 Bacteria 2657
334 Ga0495594_0072074 3300046499 Bacteria 1921
335 Ga0495608_0001121 3300046511 Bacteria 19002
336 Ga0495608_0026253 3300046511 Bacteria 3971
337 Ga0495618_0004238 3300046514 Bacteria 8851
338 Ga0495618_0010623 3300046514 Bacteria 5572
339 Ga0495618_0046597 3300046514 Bacteria 2736
340 Ga0495618_0119972 3300046514 Bacteria 1684
341 Ga0495628_0000746 3300046516 Bacteria 30179
342 Ga0495628_0009328 3300046516 Bacteria 8381
343 Ga0495628_0089543 3300046516 Bacteria 2383
344 Ga0495630_0016961 3300046517 Bacteria 5329
345 Ga0495630_0025509 3300046517 Bacteria 4372
346 Ga0495630_0054310 3300046517 Bacteria 3001
347 Ga0495666_0030857 3300046526 Bacteria 2628
348 Ga0495666_0054122 3300046526 Bacteria 1925
349 Ga0495652_0007674 3300046529 Bacteria 9937
350 Ga0495652_0011097 3300046529 Bacteria 8164
351 Ga0495652_0073653 3300046529 Bacteria 2843
352 Ga0495665_0017271 3300046531 Bacteria 3882
353 Ga0495640_0001580 3300046533 Bacteria 17960
354 Ga0495640_0023373 3300046533 Bacteria 4504
355 Ga0495640_0063299 3300046533 Bacteria 2506
356 Ga0495586_0040551 3300046535 Bacteria 2505
357 Ga0495586_0047265 3300046535 Bacteria 2323
358 Ga0495587_0001049 3300046536 Bacteria 18203
359 Ga0495587_0051568 3300046536 Bacteria 2432
360 Ga0495645_0000344 3300046543 Bacteria 32939
361 Ga0495645_0004838 3300046543 Bacteria 9205
362 Ga0495667_0026681 3300046559 Bacteria 3892
363 Ga0495667_0066752 3300046559 Bacteria 2351
364 Ga0495634_0005902 3300046642 Bacteria 9355
365 Ga0495634_0008261 3300046642 Bacteria 7763
366 Ga0495634_0116395 3300046642 Bacteria 1715
367 Ga0495634_0118145 3300046642 Bacteria 1700
368 Ga0495635_0000971 3300046663 Bacteria 18891
369 Ga0495657_0029395 3300046675 Bacteria 3855
370 Ga0495599_0006268 3300046678 Bacteria 7168
371 Ga0495599_0048413 3300046678 Bacteria 2665
372 Ga0495599_0058283 3300046678 Bacteria 2416
373 Ga0495646_0011856 3300046680 Bacteria 5545
374 Ga0495646_0014030 3300046680 Bacteria 5094
375 Ga0495647_0007165 3300046681 Bacteria 3726
376 Ga0495658_0014596 3300046683 Bacteria 4016
377 Ga0495658_0027150 3300046683 Bacteria 3077
378 Ga0495658_0046555 3300046683 Bacteria 2439
379 Ga0495658_0092751 3300046683 Bacteria 1791
380 Ga0495613_0066631 3300046689 Bacteria 2629
381 Ga0495613_0080138 3300046689 Bacteria 2374
382 Ga0495613_0195207 3300046689 Bacteria 1429
383 Ga0495624_0018359 3300046690 Bacteria 4677
384 Ga0495624_0025752 3300046690 Bacteria 3859
385 Ga0495624_0048154 3300046690 Bacteria 2706
386 Ga0495581_0010852 3300047315 Bacteria 5266
387 Ga0495581_0061236 3300047315 Bacteria 2175
388 Ga0495604_0000761 3300047317 Bacteria 27130
389 Ga0495604_0083646 3300047317 Bacteria 2384
390 Ga0495674_0005807 3300047319 Bacteria 11833
391 Ga0495674_0010494 3300047319 Bacteria 8765
392 Ga0495674_0096705 3300047319 Bacteria 2516
393 Ga0495676_0011383 3300047321 Bacteria 8029
394 Ga0495676_0044655 3300047321 Bacteria 3615
395 Ga0495680_0008581 3300047322 Bacteria 9278
396 Ga0495680_0008809 3300047322 Bacteria 9140
397 Ga0495684_0001508 3300047471 Bacteria 18627
398 Ga0495684_0024451 3300047471 Bacteria 4649
399 Ga0495593_0016184 3300047673 Bacteria 4209
400 Ga0495602_0037590 3300048088 Bacteria 4489
401 Ga0496100_0007803 3300048903 Bacteria 5935
402 Ga0496101_0025350 3300048904 Bacteria 4114
403 Ga0496102_0000871 3300048905 Bacteria 28857
404 Ga0496102_0009610 3300048905 Bacteria 8317
405 Ga0496102_0064905 3300048905 Bacteria 3345
406 Ga0496103_0001365 3300048906 Bacteria 16458
407 Ga0496103_0002881 3300048906 Bacteria 10676
408 Ga0496104_0000873 3300048907 Bacteria 25934
409 Ga0496104_0030930 3300048907 Bacteria 4976
410 Ga0496105_0000514 3300048908 Bacteria 25562
411 Ga0496105_0007592 3300048908 Bacteria 8406
412 Ga0496106_0014395 3300048909 Bacteria 5844
413 Ga0496106_0027482 3300048909 Bacteria 4237
414 Ga0496107_0002119 3300048910 Bacteria 12722
415 Ga0496107_0006024 3300048910 Bacteria 8313
416 Ga0496107_0153554 3300048910 Bacteria 1704
417 Ga0496108_0019125 3300048911 Bacteria 5620
418 Ga0496108_0119526 3300048911 Bacteria 2259
419 Ga0496109_0000836 3300048912 Bacteria 25684
420 Ga0496110_0001539 3300048913 Bacteria 16772
421 Ga0496110_0006117 3300048913 Bacteria 9487
422 Ga0496110_0164608 3300048913 Bacteria 2011
423 Ga0496111_0000072 3300048914 Bacteria 41891
424 Ga0496111_0000657 3300048914 Bacteria 18179
425 Ga0496111_0107751 3300048914 Bacteria 2052
426 Ga0496112_0000112 3300048915 Bacteria 50370
427 Ga0496112_0017151 3300048915 Bacteria 6801
428 Ga0496112_0025527 3300048915 Bacteria 5673
429 Ga0496112_0085632 3300048915 Bacteria 3118
430 Ga0496112_0165525 3300048915 Unclassified 2177
431 Ga0496113_0000058 3300048916 Bacteria 47947
432 Ga0496113_0004381 3300048916 Bacteria 8660
433 Ga0496114_0005363 3300048917 Bacteria 10024
434 Ga0496114_0050456 3300048917 Bacteria 3463
435 Ga0496114_0061668 3300048917 Bacteria 3137
436 Ga0496115_0010436 3300048918 Bacteria 6941
437 Ga0501031_0008260 3300049568 Bacteria 6771
438 Ga0501032_0007732 3300049569 Bacteria 7834
439 Ga0501033_0003135 3300049570 Bacteria 13738
440 Ga0501033_0095187 3300049570 Bacteria 2176
441 Ga0501033_0109179 3300049570 Bacteria 2015
442 Ga0501034_0199136 3300049571 Bacteria 1962
443 Ga0501036_0000778 3300049572 Bacteria 23605
444 Ga0501036_0010462 3300049572 Bacteria 7663
445 Ga0501037_0019898 3300049573 Bacteria 4954
446 Ga0501037_0028461 3300049573 Bacteria 4127
447 Ga0501038_0005237 3300049574 Bacteria 12052
448 Ga0501039_0006572 3300049575 Bacteria 8828
449 Ga0501039_0007730 3300049575 Bacteria 8204
450 Ga0501039_0009480 3300049575 Bacteria 7422
451 Ga0501039_0195019 3300049575 Bacteria 1592
452 Ga0501040_0000808 3300049576 Bacteria 19495
453 Ga0501040_0015444 3300049576 Bacteria 5048
454 Ga0501040_0033715 3300049576 Bacteria 3470
455 Ga0501040_0073139 3300049576 Bacteria 2368
456 Ga0501041_0004667 3300049577 Bacteria 7949
457 Ga0501041_0035544 3300049577 Bacteria 3019
458 Ga0501042_0153948 3300049578 Bacteria 1658
459 Ga0501046_0001302 3300049580 Bacteria 24176
460 Ga0501046_0020754 3300049580 Bacteria 5427
461 Ga0501046_0032409 3300049580 Bacteria 4231
462 Ga0501046_0108375 3300049580 Bacteria 2124
463 Ga0501047_0076609 3300049581 Bacteria 3218
464 Ga0501048_0013701 3300049582 Bacteria 6016
465 Ga0501048_0061024 3300049582 Bacteria 2671
466 Ga0501048_0235905 3300049582 Bacteria 1298
467 Ga0501067_0021963 3300049583 Bacteria 3531
468 Ga0501068_0004020 3300049584 Bacteria 7998
469 Ga0501071_0021503 3300049587 Bacteria 4494
470 Ga0501071_0071535 3300049587 Bacteria 2529
471 Ga0501071_0142582 3300049587 Bacteria 1785
472 Ga0501072_0005483 3300049588 Bacteria 9659
473 Ga0501072_0011559 3300049588 Bacteria 6746
474 Ga0501072_0092778 3300049588 Bacteria 2398
475 Ga0501073_0007025 3300049589 Bacteria 8388
476 Ga0501074_0005879 3300049590 Bacteria 8845
477 Ga0501075_0004928 3300049591 Bacteria 9101
478 Ga0501075_0007259 3300049591 Bacteria 7684
479 Ga0501075_0021950 3300049591 Bacteria 4659
480 Ga0501075_0049529 3300049591 Bacteria 3158
481 Ga0501075_0107201 3300049591 Bacteria 2124
482 Ga0501076_0007242 3300049592 Bacteria 8071
483 Ga0501076_0014667 3300049592 Bacteria 5907
484 Ga0501077_0005485 3300049593 Bacteria 7721
485 Ga0501077_0069007 3300049593 Bacteria 2241
486 Ga0501225_0020618 3300049705 Bacteria 1822
487 Ga0501079_0017859 3300049741 Bacteria 5417
488 Ga0501080_0003556 3300049742 Bacteria 13720
489 Ga0501080_0092186 3300049742 Bacteria 2814
490 Ga0501080_0144603 3300049742 Bacteria 2198
491 Ga0501081_0087848 3300049743 Bacteria 2184
492 Ga0501283_005095 3300049779 Bacteria 1797
493 Ga0501035_0030604 3300049822 Bacteria 4906
494 Ga0501035_0065759 3300049822 Bacteria 3218
495 Ga0501035_0164807 3300049822 Bacteria 1917
496 Ga0501044_0118556 3300049823 Bacteria 2649
497 Ga0501045_0008349 3300049824 Bacteria 7214
498 nmdc:mga00v17_40250_c1 3300050491 Bacteria 2803
499 nmdc:mga0yw44_43494_c1 3300050492 Bacteria 2682
500 nmdc:mga0yw44_45210_c1 3300050492 Bacteria 2639
501 nmdc:mga0k408_65981_c1 3300050493 Bacteria 2107
502 nmdc:mga0k408_74644_c1 3300050493 Bacteria 1981
503 nmdc:mga0k408_925_c1 3300050493 Bacteria 16065
504 nmdc:mga06z11_23815_c1 3300050494 Bacteria 2881
505 nmdc:mga06z11_53573_c1 3300050494 Bacteria 2075
506 nmdc:mga05p37_4606_c1 3300050507 Bacteria 16121
507 nmdc:mga05p37_886_c1 3300050507 Bacteria 33754
508 nmdc:mga09592_221241_c1 3300050508 Bacteria 1640
509 nmdc:mga09592_335_c1 3300050508 Bacteria 34453
510 nmdc:mga0qj67_30374_c1 3300050509 Bacteria 4206
511 nmdc:mga0qj67_6200_c1 3300050509 Bacteria 8774
512 nmdc:mga06r32_21367_c1 3300050510 Bacteria 5976
513 nmdc:mga06r32_44296_c1 3300050510 Bacteria 4237
514 nmdc:mga08y16_1601_c1 3300050511 Bacteria 22883
515 nmdc:mga08y16_34195_c1 3300050511 Bacteria 5339
516 nmdc:mga0n895_231628_c1 3300050512 Bacteria 1875
517 nmdc:mga0n895_2327_c1 3300050512 Bacteria 14807
518 nmdc:mga0n895_28439_c1 3300050512 Bacteria 5317
519 nmdc:mga0n895_86_c1 3300050512 Bacteria 53794
520 nmdc:mga0rr50_17638_c1 3300050513 Bacteria 4772
521 nmdc:mga0rr50_34853_c1 3300050513 Bacteria 3608
522 nmdc:mga0rr50_53580_c1 3300050513 Bacteria 3001
523 nmdc:mga0rr50_55202_c1 3300050513 Bacteria 2963
524 nmdc:mga0rr50_98214_c1 3300050513 Bacteria 2295
525 nmdc:mga08x19_192863_c1 3300050514 Bacteria 1394
526 nmdc:mga08x19_2723_c1 3300050514 Bacteria 10682
527 nmdc:mga08x19_72130_c1 3300050514 Unclassified 2252
528 nmdc:mga0a205_505_c1 3300050515 Bacteria 30610
529 Ga0495601_0017224 3300053077 Bacteria 4386
530 Ga0495601_0019008 3300053077 Bacteria 4186
531 Ga0495601_0048065 3300053077 Unclassified 2687
532 Ga0495612_0000793 3300053078 Bacteria 12856
533 Ga0495595_0000144 3300053084 Bacteria 29392
534 Ga0495619_0000443 3300053085 Bacteria 27857
535 Ga0495619_0002225 3300053085 Bacteria 12826
536 Ga0500646_0000453 3300053090 Bacteria 12178
537 Ga0500583_0113564 3300053092 Bacteria 1336
538 Ga0500593_000489 3300053117 Bacteria 15657
539 Ga0500595_010899 3300053119 Bacteria 3584
540 Ga0500568_0018726 3300053139 Bacteria 3022
541 Ga0500616_0028506 3300053153 Bacteria 3076
542 Ga0501084_0001603 3300054114 Bacteria 17927
543 Ga0501084_0229700 3300054114 Bacteria 1566
544 Ga0501082_0007572 3300060353 Bacteria 9367
545 Ga0501082_0015756 3300060353 Bacteria 6502
546 Ga0501082_0189380 3300060353 Bacteria 1790
547 Ga0530510_0009980 3300061734 Bacteria 6661
548 Ga0530510_0010946 3300061734 Bacteria 6364
549 Ga0530510_0091839 3300061734 Bacteria 2215
550 Ga0070669_100038441
551 Ga0065707_10009615
552 Ga0070676_10059879
553 Ga0070676_10087976
554 Ga0070690_100000398
555 Ga0068869_100000982
556 Ga0070680_100009094
557 Ga0070682_100001096
558 Ga0068868_100000097
559 Ga0068868_100051835
560 Ga0068868_100139202
561 Ga0070689_100000188
562 Ga0070689_100016258
563 Ga0070691_10003606
564 Ga0070687_100000069
565 Ga0070687_100010657
566 Ga0070692_10006007
567 Ga0070668_100050452
568 Ga0070671_100004237
569 Ga0070674_100050686
570 Ga0070674_100070328
571 Ga0070673_100125487
572 Ga0070714_100134608
573 Ga0070713_100076587
574 Ga0070710_10004588
575 Ga0070701_10016602
576 Ga0070701_10048037
577 Ga0070711_100058057
578 Ga0070711_100066544
579 Ga0070705_100015943
580 Ga0070700_100002704
581 Ga0070694_100000562
582 Ga0070694_100014103
583 Ga0070678_100096282
584 Ga0070678_100272832
585 Ga0070662_100029715
586 Ga0070681_10009530
587 Ga0068867_100000296
588 Ga0068867_100064833
589 Ga0068867_100107804
590 Ga0070706_100085976
591 Ga0070698_100065221
592 Ga0070679_100003737
593 Ga0070684_100191597
594 Ga0070697_100004195
595 Ga0070697_100009252
596 Ga0070672_100082586
597 Ga0070686_100000090
598 Ga0070695_100000188
599 Ga0070696_100000719
600 Ga0070696_100012269
601 Ga0070696_100018351
602 Ga0070696_100026446
603 Ga0070693_100038444
604 Ga0070693_100099886
605 Ga0070665_100105461
606 Ga0070704_100000064
607 Ga0068855_100000833
608 Ga0070664_100212118
609 Ga0068854_100035460
610 Ga0068856_100017695
611 Ga0070702_100000002
612 Ga0068852_100044863
613 Ga0068859_100000195
614 Ga0068864_100036408
615 Ga0068864_100060541
616 Ga0068866_10000037
617 Ga0068861_100000043
618 Ga0068861_100018060
619 Ga0068858_100001438
620 Ga0068858_100020205
621 Ga0068860_100037967
622 Ga0068862_100002188
623 Ga0068862_100014461
624 Ga0081455_10003399
625 Ga0081455_10003542
626 Ga0081455_10004584
627 Ga0081538_10001949
628 Ga0081538_10008855
629 Ga0081540_1000313
630 Ga0081540_1017098
631 Ga0081540_1020004
632 Ga0081539_10000233
633 Ga0070717_10058410
634 Ga0070717_10258354
635 Ga0075365_10013347
636 Ga0070712_100014497
637 Ga0070712_100088226
638 Ga0075367_10099728
639 Ga0075366_10069709
640 Ga0097621_100000045
641 Ga0068871_100000040
642 Ga0068871_100002037
643 Ga0075428_100000047
644 Ga0075428_100021608
645 Ga0075428_100067046
646 Ga0075430_100048041
647 Ga0075430_100059555
648 Ga0075430_100064289
649 Ga0075430_100088866
650 Ga0075431_100053487
651 Ga0075431_100057586
652 Ga0075433_10000605
653 Ga0075434_100000414
654 Ga0075434_100000554
655 Ga0075434_100080149
656 Ga0075434_100135422
657 Ga0075434_100166485
658 Ga0075429_100000067
659 Ga0075429_100054870
660 Ga0075429_100065289
661 Ga0075429_100081289
662 Ga0075429_100147417
663 Ga0068865_100000343
664 Ga0068865_100106674
665 Ga0068865_100158596
666 Ga0075436_100001082
667 Ga0075436_100089098
668 Ga0097620_100000195
669 Ga0075435_100005507
670 Ga0075435_100009593
671 Ga0075435_100032669
672 Ga0075435_100046139
673 Ga0075435_100053714
674 Ga0075435_100070202
675 Ga0099794_10008099
676 Ga0111539_10057421
677 Ga0111539_10060108
678 Ga0105245_10000306
679 Ga0114129_10000040
680 Ga0114129_10050610
681 Ga0114129_10072760
682 Ga0114129_10073943
683 Ga0114129_10169937
684 Ga0114129_10224125
685 Ga0114129_10298472
686 Ga0105243_10000035
687 Ga0105243_10027450
688 Ga0105243_10098449
689 Ga0105242_10000097
690 Ga0105242_10045246
691 Ga0105248_10002392
692 Ga0105248_10124109
693 Ga0105249_10001837
694 Ga0105249_10035051
695 Ga0105239_10043450
696 Ga0105239_10045568
697 Ga0157378_10001996
698 Ga0157378_10139603
699 Ga0157375_10028268
700 Ga0157377_10018828
701 Ga0157376_10000403
702 Ga0213876_10015217
703 Ga0213875_10000023
704 Ga0224572_1004319
705 Ga0209758_1000158
706 Ga0207656_10009542
707 Ga0207692_10055714
708 Ga0207642_10004703
709 Ga0207710_10057640
710 Ga0207688_10004951
711 Ga0207645_10046417
712 Ga0207643_10007658
713 Ga0207643_10055952
714 Ga0207684_10067285
715 Ga0207707_10098849
716 Ga0207707_10104629
717 Ga0207693_10016629
718 Ga0207693_10043293
719 Ga0207693_10064489
720 Ga0207693_10127708
721 Ga0207663_10010449
722 Ga0207663_10071313
723 Ga0207662_10000006
724 Ga0207657_10040052
725 Ga0207652_10002034
726 Ga0207652_10020614
727 Ga0207646_10068748
728 Ga0207681_10019362
729 Ga0207681_10057510
730 Ga0207694_10246735
731 Ga0207687_10002839
732 Ga0207664_10007955
733 Ga0207664_10055431
734 Ga0207664_10076184
735 Ga0207644_10060518
736 Ga0207706_10098543
737 Ga0207686_10000690
738 Ga0207709_10010138
739 Ga0207709_10104138
740 Ga0207670_10025617
741 Ga0207704_10002301
742 Ga0207665_10011501
743 Ga0207665_10046792
744 Ga0207691_10006839
745 Ga0207691_10084488
746 Ga0207711_10088759
747 Ga0207689_10000082
748 Ga0207689_10018333
749 Ga0207667_10054691
750 Ga0207640_10001404
751 Ga0207677_10013069
752 Ga0207677_10117685
753 Ga0207703_10009391
754 Ga0207703_10164246
755 Ga0207678_10057963
756 Ga0207708_10000936
757 Ga0207708_10004812
758 Ga0207702_10013289
759 Ga0207641_10010400
760 Ga0207648_10000300
761 Ga0207648_10008622
762 Ga0207648_10010566
763 Ga0207648_10170263
764 Ga0207676_10014798
765 Ga0207676_10020465
766 Ga0207674_10258354
767 Ga0207675_100000064
768 Ga0207675_100022516
769 Ga0207683_10052593
770 Ga0209999_1004851
771 Ga0209588_1001621
772 Ga0209966_1001810
773 Ga0207428_10001387
774 Ga0268265_10002988
775 Ga0268265_10005451
776 Ga0268264_10001394
777 Ga0265338_10011981
778 Ga0307511_10000103
779 Ga0265332_10038476
780 Ga0265340_10000923
781 Ga0265340_10032391
782 Ga0265339_10000093
783 Ga0265331_10024279
784 Ga0265316_10034370
785 Ga0307408_100046870
786 Ga0265313_10000171
787 Ga0265314_10086687
788 Ga0265342_10000024
789 Ga0265342_10081742
790 Ga0307416_100027258
791 Ga0307416_100027450
792 Ga0373930_0009822
793 Ga0373926_0010302
794 Ga0373928_0014108
795 Ga0373934_0013755
796 Ga0373934_0024738
797 Ga0373940_0001999
798 Ga0373944_0038538
799 Ga0373932_0030523
800 Ga0373936_0008644
801 Ga0373936_0013435
802 Ga0373939_0000881
803 Ga0373954_0000195
804 Ga0373954_0001100
805 Ga0373954_0006844
806 Ga0373956_0023635
807 Ga0373960_0020139
808 Ga0373943_0000146
809 Ga0373946_0011552
810 Ga0373955_0022200
811 Ga0373961_0004750
812 Ga0373962_0006052
813 Ga0373924_0009173
814 Ga0373924_0022063
815 Ga0373931_0001822
816 Ga0373931_0003466
817 Ga0373931_0005626
818 Ga0373931_0030036
819 Ga0373935_0015101
820 Ga0373935_0029961
821 Ga0373935_0038001
822 Ga0373935_0123446
823 Ga0373935_0132365
824 Ga0373927_0001644
825 Ga0373927_0007053
826 Ga0373927_0018712
827 Ga0373927_0046091
828 Ga0373933_0005541
829 Ga0373933_0005942
830 Ga0373933_0029184
831 Ga0373947_0004463
832 Ga0373947_0059343
833 Ga0373937_0001045
834 Ga0373937_0097584
835 Ga0373937_0190204
836 Ga0373925_0010337
837 Ga0373925_0021542
838 Ga0373925_0056269
839 Ga0373925_0092328
840 Ga0436364_0604811
841 Ga0436364_0849285
842 Ga0436364_0855567
843 Ga0436365_0085928
844 Ga0436365_0611401
845 Ga0436365_1237657
846 Ga0436365_1839981
847 Ga0451807_0683397
848 Ga0439441_000454
849 Ga0439443_003700
850 Ga0439435_0000080
851 Ga0439435_0001252
852 Ga0439460_0008396
853 Ga0466966_0069264
854 Ga0466964_0023429
855 Ga0451576_0000822
856 Ga0451576_0108228
857 Ga0451576_0122680
858 Ga0466958_0063150
859 Ga0466967_0052536
860 Ga0495592_0000293
861 Ga0495592_0011260
862 Ga0495592_0066186
863 Ga0495603_0043697
864 Ga0495603_0122140
865 Ga0495629_0034015
866 Ga0495629_0036784
867 Ga0495651_0000749
868 Ga0495653_0003978
869 Ga0495653_0026542
870 Ga0495653_0037169
871 Ga0495580_0016240
872 Ga0495580_0028756
873 Ga0495580_0124203
874 Ga0495580_0126600
875 Ga0495582_0005169
876 Ga0495639_0003787
877 Ga0495662_0003159
878 Ga0495662_0023965
879 Ga0495662_0035883
880 Ga0495662_0036179
881 Ga0495664_0000075
882 Ga0495594_0037155
883 Ga0495594_0072074
884 Ga0495608_0001121
885 Ga0495608_0026253
886 Ga0495618_0004238
887 Ga0495618_0010623
888 Ga0495618_0046597
889 Ga0495618_0119972
890 Ga0495628_0000746
891 Ga0495628_0009328
892 Ga0495628_0089543
893 Ga0495630_0016961
894 Ga0495630_0025509
895 Ga0495630_0054310
896 Ga0495666_0030857
897 Ga0495666_0054122
898 Ga0495652_0007674
899 Ga0495652_0011097
900 Ga0495652_0073653
901 Ga0495665_0017271
902 Ga0495640_0001580
903 Ga0495640_0023373
904 Ga0495640_0063299
905 Ga0495586_0040551
906 Ga0495586_0047265
907 Ga0495587_0001049
908 Ga0495587_0051568
909 Ga0495645_0000344
910 Ga0495645_0004838
911 Ga0495667_0026681
912 Ga0495667_0066752
913 Ga0495634_0005902
914 Ga0495634_0008261
915 Ga0495634_0116395
916 Ga0495634_0118145
917 Ga0495635_0000971
918 Ga0495657_0029395
919 Ga0495599_0006268
920 Ga0495599_0048413
921 Ga0495599_0058283
922 Ga0495646_0011856
923 Ga0495646_0014030
924 Ga0495647_0007165
925 Ga0495658_0014596
926 Ga0495658_0027150
927 Ga0495658_0046555
928 Ga0495658_0092751
929 Ga0495613_0066631
930 Ga0495613_0080138
931 Ga0495613_0195207
932 Ga0495624_0018359
933 Ga0495624_0025752
934 Ga0495624_0048154
935 Ga0495581_0010852
936 Ga0495581_0061236
937 Ga0495604_0000761
938 Ga0495604_0083646
939 Ga0495674_0005807
940 Ga0495674_0010494
941 Ga0495674_0096705
942 Ga0495676_0011383
943 Ga0495676_0044655
944 Ga0495680_0008581
945 Ga0495680_0008809
946 Ga0495684_0001508
947 Ga0495684_0024451
948 Ga0495593_0016184
949 Ga0495602_0037590
950 Ga0496100_0007803
951 Ga0496101_0025350
952 Ga0496102_0000871
953 Ga0496102_0009610
954 Ga0496102_0064905
955 Ga0496103_0001365
956 Ga0496103_0002881
957 Ga0496104_0000873
958 Ga0496104_0030930
959 Ga0496105_0000514
960 Ga0496105_0007592
961 Ga0496106_0014395
962 Ga0496106_0027482
963 Ga0496107_0002119
964 Ga0496107_0006024
965 Ga0496107_0153554
966 Ga0496108_0019125
967 Ga0496108_0119526
968 Ga0496109_0000836
969 Ga0496110_0001539
970 Ga0496110_0006117
971 Ga0496110_0164608
972 Ga0496111_0000072
973 Ga0496111_0000657
974 Ga0496111_0107751
975 Ga0496112_0000112
976 Ga0496112_0017151
977 Ga0496112_0025527
978 Ga0496112_0085632
979 Ga0496112_0165525
980 Ga0496113_0000058
981 Ga0496113_0004381
982 Ga0496114_0005363
983 Ga0496114_0050456
984 Ga0496114_0061668
985 Ga0496115_0010436
986 Ga0501031_0008260
987 Ga0501032_0007732
988 Ga0501033_0003135
989 Ga0501033_0095187
990 Ga0501033_0109179
991 Ga0501034_0199136
992 Ga0501036_0000778
993 Ga0501036_0010462
994 Ga0501037_0019898
995 Ga0501037_0028461
996 Ga0501038_0005237
997 Ga0501039_0006572
998 Ga0501039_0007730
999 Ga0501039_0009480
1000 Ga0501039_0195019
1001 Ga0501040_0000808
1002 Ga0501040_0015444
1003 Ga0501040_0033715
1004 Ga0501040_0073139
1005 Ga0501041_0004667
1006 Ga0501041_0035544
1007 Ga0501042_0153948
1008 Ga0501046_0001302
1009 Ga0501046_0020754
1010 Ga0501046_0032409
1011 Ga0501046_0108375
1012 Ga0501047_0076609
1013 Ga0501048_0013701
1014 Ga0501048_0061024
1015 Ga0501048_0235905
1016 Ga0501067_0021963
1017 Ga0501068_0004020
1018 Ga0501071_0021503
1019 Ga0501071_0071535
1020 Ga0501071_0142582
1021 Ga0501072_0005483
1022 Ga0501072_0011559
1023 Ga0501072_0092778
1024 Ga0501073_0007025
1025 Ga0501074_0005879
1026 Ga0501075_0004928
1027 Ga0501075_0007259
1028 Ga0501075_0021950
1029 Ga0501075_0049529
1030 Ga0501075_0107201
1031 Ga0501076_0007242
1032 Ga0501076_0014667
1033 Ga0501077_0005485
1034 Ga0501077_0069007
1035 Ga0501225_0020618
1036 Ga0501079_0017859
1037 Ga0501080_0003556
1038 Ga0501080_0092186
1039 Ga0501080_0144603
1040 Ga0501081_0087848
1041 Ga0501283_005095
1042 Ga0501035_0030604
1043 Ga0501035_0065759
1044 Ga0501035_0164807
1045 Ga0501044_0118556
1046 Ga0501045_0008349
1047 nmdc:mga00v17_40250_c1
1048 nmdc:mga0yw44_43494_c1
1049 nmdc:mga0yw44_45210_c1
1050 nmdc:mga0k408_65981_c1
1051 nmdc:mga0k408_74644_c1
1052 nmdc:mga0k408_925_c1
1053 nmdc:mga06z11_23815_c1
1054 nmdc:mga06z11_53573_c1
1055 nmdc:mga05p37_4606_c1
1056 nmdc:mga05p37_886_c1
1057 nmdc:mga09592_221241_c1
1058 nmdc:mga09592_335_c1
1059 nmdc:mga0qj67_30374_c1
1060 nmdc:mga0qj67_6200_c1
1061 nmdc:mga06r32_21367_c1
1062 nmdc:mga06r32_44296_c1
1063 nmdc:mga08y16_1601_c1
1064 nmdc:mga08y16_34195_c1
1065 nmdc:mga0n895_231628_c1
1066 nmdc:mga0n895_2327_c1
1067 nmdc:mga0n895_28439_c1
1068 nmdc:mga0n895_86_c1
1069 nmdc:mga0rr50_17638_c1
1070 nmdc:mga0rr50_34853_c1
1071 nmdc:mga0rr50_53580_c1
1072 nmdc:mga0rr50_55202_c1
1073 nmdc:mga0rr50_98214_c1
1074 nmdc:mga08x19_192863_c1
1075 nmdc:mga08x19_2723_c1
1076 nmdc:mga08x19_72130_c1
1077 nmdc:mga0a205_505_c1
1078 Ga0495601_0017224
1079 Ga0495601_0019008
1080 Ga0495601_0048065
1081 Ga0495612_0000793
1082 Ga0495595_0000144
1083 Ga0495619_0000443
1084 Ga0495619_0002225
1085 Ga0500646_0000453
1086 Ga0500583_0113564
1087 Ga0500593_000489
1088 Ga0500595_010899
1089 Ga0500568_0018726
1090 Ga0500616_0028506
1091 Ga0501084_0001603
1092 Ga0501084_0229700
1093 Ga0501082_0007572
1094 Ga0501082_0015756
1095 Ga0501082_0189380
1096 Ga0530510_0009980
1097 Ga0530510_0010946
1098 Ga0530510_0091839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

65

163

0.94

PF00848

Ring_hydroxyl_A

Ring hydroxylating alpha subunit (catalytic domain)

205

460

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h2t-assembly1.cif.gz_G cryo-em structure of iadd/e dioxygenase bound with iaa 0.8865 3 433
8h2t-assembly1.cif.gz_G cryo-em structure of iadd/e dioxygenase bound with iaa 0.8748 3 433
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.8538 40 148
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.8301 40 148
3eqq-assembly1.cif.gz_A apo toluene 2,3-dioxygenase 0.8233 4 433
ID Description Score Start End Superfamily
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8953 38 160 2.102.10.10
2ckfA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8803 37 154 2.102.10.10
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8705 38 160 2.102.10.10
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8686 38 160 2.102.10.10
3n0qA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8682 37 156 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A382W5S4-F1-model_v4 Rieske domain-containing protein 0.9365 16 115 GO:0005506
GO:0016491
GO:0051537
AF-X8C518-F1-model_v4 deleted 0.9343 7 178
AF-A0A346A1W7-F1-model_v4 Ribosomal subunit interface protein 0.9241 1 432 GO:0005506
GO:0016491
GO:0051537
AF-A0A2V5UHA2-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9241 6 168 GO:0005506
GO:0051213
GO:0051537
AF-A0A522IU37-F1-model_v4 Oxidoreductase 0.9225 2 155 GO:0016491
GO:0046872
GO:0051537

Map