F462274

General Info

Members Datasets Scaffolds Average Seq Length
548 391 386 114

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0000011|Ga0495625_0000011_358703_359116
Length 137
Sequence MRLSFVTYFDHIGNMELKAASASLSALGHESRLAIFRLLVQAGPQGVAAGEIARRLEMIPNTLSANLNILSHAGLIGSRREGRSIIYAADYAAMSGLLSFLMEDCCDGAPEICAPLGDILAKAAACDGTCNTELETA

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
5 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
6 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
7 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
8 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
9 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
10 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
11 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
12 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
13 2643221583 Caulobacter sp. Root655 Isolate Unclassified
14 2643221584 Caulobacter sp. Root656 Isolate Unclassified
15 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
16 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
17 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
18 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
19 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
22 2818991435 Caulobacter henricii 536 Isolate Unclassified
23 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
24 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
25 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
26 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
27 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
28 2849560528 Caulobacter zeae 410 Isolate Unclassified
29 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
30 2851153111 Caulobacter radicis 736 Isolate Unclassified
31 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
32 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
33 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
34 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
35 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
36 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
37 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
38 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
39 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
40 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
41 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
42 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
43 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
44 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
45 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
46 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
47 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
48 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
49 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
50 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
51 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
52 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
53 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
54 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
55 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
56 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
57 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
58 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
59 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
60 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
61 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
62 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
63 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
64 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
65 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
66 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
67 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
68 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
69 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
70 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
71 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
72 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
73 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
74 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
75 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
76 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
77 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
78 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
79 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
80 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
81 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
82 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
83 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
84 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
85 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
86 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
87 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
88 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
89 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
90 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
91 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
92 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
93 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
94 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
95 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
96 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
97 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
98 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
99 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
100 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
101 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
102 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
103 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
104 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
105 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
106 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
107 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
108 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
109 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
110 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
111 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
112 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
113 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
114 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
115 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
116 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
117 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
118 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
119 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
120 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
121 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
122 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
123 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
124 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
125 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
126 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
127 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
128 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
129 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
130 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
131 3004167301 Mesorhizobium loti 582 Isolate Unclassified
132 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
133 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
134 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
135 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
136 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
137 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
138 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
139 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
140 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
141 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
142 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
143 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
144 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
145 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
146 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
147 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
148 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
149 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
150 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
151 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
154 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
155 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
156 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
157 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
158 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
159 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
160 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
161 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
164 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
168 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
169 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
170 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
171 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
172 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
173 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
174 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
175 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
176 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
177 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
178 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
179 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
180 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
181 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
182 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
183 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
184 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
185 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
186 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
189 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
190 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
191 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
192 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
193 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
194 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
195 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
196 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
197 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
198 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
199 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
200 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
201 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
272 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
273 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
347 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
357 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
358 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
359 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
360 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
361 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
364 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
365 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
366 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
369 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
370 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
373 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
379 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
380 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
383 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
384 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
385 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
386 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
387 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
388 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
389 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
390 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
391 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.26
Metatranscriptomes 0
Isolates 29.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.61
Nodule 22.81
Rhizoplane 3.1
Rhizosphere 45.44
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10040285 3300002067 Bacteria 1364
2 JGI25153J46596_10062364 3300003215 Bacteria 1005
3 rootH1_10048436 3300003316 Bacteria 1195
4 rootH1_10048436 3300003323 Bacteria 11109
5 rootH2_10079304 3300003320 Bacteria 1690
6 rootL2_10127334 3300003322 Bacteria 1448
7 rootL2_10127760 3300003322 Bacteria 1308
8 Ga0055537_1002473 3300003773 Bacteria 6179
9 Ga0055524_1034654 3300003775 Bacteria 1391
10 Ga0055536_1000383 3300003781 Bacteria 32375
11 Ga0055536_1001415 3300003781 Bacteria 14501
12 Ga0055536_1003429 3300003781 Bacteria 8515
13 Ga0055528_1006831 3300003790 Bacteria 5125
14 Ga0055530_10001863 3300003791 Bacteria 14501
15 Ga0055530_10002867 3300003791 Bacteria 10503
16 Ga0055531_10000549 3300003794 Bacteria 33229
17 Ga0055531_10001682 3300003794 Bacteria 15910
18 Ga0065165_1001354 3300005262 Bacteria 27068
19 Ga0065165_1078938 3300005262 Bacteria 858
20 Ga0070658_10938816 3300005327 Bacteria 752
21 Ga0070670_100271186 3300005331 Bacteria 1481
22 Ga0070666_10686418 3300005335 Unclassified 750
23 Ga0070668_100037160 3300005347 Bacteria 3718
24 Ga0070669_100889520 3300005353 Bacteria 760
25 Ga0070671_100021976 3300005355 Bacteria 5211
26 Ga0070674_100111770 3300005356 Bacteria 2007
27 Ga0070674_100222423 3300005356 Bacteria 1469
28 Ga0070674_100745292 3300005356 Bacteria 841
29 Ga0070667_100655805 3300005367 Bacteria 969
30 Ga0070663_101883697 3300005455 Bacteria 537
31 Ga0068867_100645009 3300005459 Bacteria 928
32 Ga0070679_100822662 3300005530 Bacteria 872
33 Ga0068853_100489825 3300005539 Bacteria 1160
34 Ga0068853_100956442 3300005539 Bacteria 824
35 Ga0070665_100043733 3300005548 Bacteria 4500
36 Ga0070665_100545565 3300005548 Bacteria 1171
37 Ga0068855_100388575 3300005563 Unclassified 1531
38 Ga0068854_102236234 3300005578 Bacteria 506
39 Ga0068856_100042207 3300005614 Bacteria 4487
40 Ga0068856_101777313 3300005614 Bacteria 628
41 Ga0068859_100001735 3300005617 Bacteria 22203
42 Ga0068864_100215933 3300005618 Bacteria 1768
43 Ga0068864_102100617 3300005618 Unclassified 571
44 Ga0068866_10810776 3300005718 Bacteria 651
45 Ga0068861_100001768 3300005719 Bacteria 13896
46 Ga0068858_100113514 3300005842 Bacteria 2530
47 Ga0068858_100557960 3300005842 Bacteria 1109
48 Ga0068860_100010755 3300005843 Bacteria 9032
49 Ga0068862_100251660 3300005844 Bacteria 1610
50 Ga0075365_10055453 3300006038 Bacteria 2631
51 Ga0075365_10072218 3300006038 Bacteria 2324
52 Ga0075365_10462976 3300006038 Bacteria 896
53 Ga0075368_10070759 3300006042 Bacteria 1408
54 Ga0075363_100397285 3300006048 Bacteria 810
55 Ga0075363_100543686 3300006048 Bacteria 692
56 Ga0075362_10148606 3300006177 Bacteria 1123
57 Ga0075362_10267208 3300006177 Bacteria 844
58 Ga0075362_10362760 3300006177 Bacteria 727
59 Ga0075367_10046068 3300006178 Bacteria 2561
60 Ga0075367_10173199 3300006178 Bacteria 1345
61 Ga0075367_10182710 3300006178 Bacteria 1308
62 Ga0075369_10010635 3300006186 Bacteria 3604
63 Ga0075369_10167903 3300006186 Bacteria 1007
64 Ga0075366_10066983 3300006195 Bacteria 2137
65 Ga0075366_10288825 3300006195 Bacteria 1003
66 Ga0075366_10353112 3300006195 Bacteria 902
67 Ga0075370_10048079 3300006353 Bacteria 2416
68 Ga0075370_10052527 3300006353 Unclassified 2312
69 Ga0068865_100185857 3300006881 Bacteria 1603
70 Ga0068865_100325846 3300006881 Bacteria 1237
71 Ga0097620_100001735 3300006931 Bacteria 22203
72 Ga0105245_10899139 3300009098 Bacteria 927
73 Ga0105247_10029376 3300009101 Bacteria 3331
74 Ga0105243_10050859 3300009148 Bacteria 3275
75 Ga0105243_10375460 3300009148 Bacteria 1313
76 Ga0105241_12142745 3300009174 Bacteria 553
77 Ga0105248_10010377 3300009177 Bacteria 10256
78 Ga0105248_10023821 3300009177 Bacteria 6805
79 Ga0105238_10649436 3300009551 Bacteria 1065
80 Ga0105238_10683169 3300009551 Bacteria 1038
81 Ga0105249_10068891 3300009553 Bacteria 3264
82 Ga0105249_10989031 3300009553 Unclassified 910
83 Ga0105249_12595114 3300009553 Bacteria 579
84 Ga0105239_10124059 3300010375 Bacteria 2870
85 Ga0105239_10666929 3300010375 Bacteria 1188
86 Ga0163162_12635100 3300013306 Bacteria 579
87 Ga0157372_11342562 3300013307 Bacteria 825
88 Ga0157375_11818756 3300013308 Bacteria 722
89 Ga0163163_11577801 3300014325 Bacteria 717
90 Ga0157380_11553459 3300014326 Bacteria 716
91 Ga0182008_10210617 3300014497 Bacteria 992
92 Ga0157376_10248674 3300014969 Bacteria 1660
93 Ga0157376_10559308 3300014969 Bacteria 1133
94 Ga0182006_1206997 3300015261 Bacteria 649
95 Ga0163161_11568019 3300017792 Bacteria 580
96 Ga0213876_10000170 3300021384 Bacteria 68004
97 Ga0213875_10162632 3300021388 Bacteria 1047
98 Ga0209565_1000065 3300025263 Bacteria 178266
99 Ga0209673_1000818 3300025273 Bacteria 41077
100 Ga0209673_1016453 3300025273 Bacteria 2764
101 Ga0209676_1000043 3300025292 Bacteria 418680
102 Ga0209676_1000184 3300025292 Bacteria 143543
103 Ga0209564_1002646 3300025295 Bacteria 13666
104 Ga0209564_1025384 3300025295 Bacteria 1994
105 Ga0209758_1001185 3300025297 Bacteria 32966
106 Ga0209758_1001639 3300025297 Bacteria 25422
107 Ga0209050_1000548 3300025298 Bacteria 62143
108 Ga0209050_1001080 3300025298 Bacteria 33318
109 Ga0209050_1027809 3300025298 Bacteria 1853
110 Ga0209256_1003381 3300025299 Bacteria 11271
111 Ga0209256_1028783 3300025299 Bacteria 1560
112 Ga0209256_1028789 3300025299 Bacteria 1560
113 Ga0209256_1057964 3300025299 Bacteria 912
114 Ga0209051_1003506 3300025303 Bacteria 10256
115 Ga0209257_1000074 3300025304 Bacteria 325641
116 Ga0209257_1000134 3300025304 Bacteria 207628
117 Ga0209257_1010377 3300025304 Bacteria 4727
118 Ga0207713_1002353 3300025735 Bacteria 13857
119 Ga0207645_10272068 3300025907 Bacteria 1123
120 Ga0207705_11299152 3300025909 Bacteria 556
121 Ga0207652_10305597 3300025921 Bacteria 1436
122 Ga0207681_10011959 3300025923 Bacteria 5345
123 Ga0207694_11128459 3300025924 Bacteria 663
124 Ga0207644_10003100 3300025931 Bacteria 10697
125 Ga0207709_10418402 3300025935 Bacteria 1029
126 Ga0207669_10223446 3300025937 Bacteria 1384
127 Ga0207669_10683223 3300025937 Bacteria 842
128 Ga0207704_10093552 3300025938 Bacteria 1982
129 Ga0207704_10135174 3300025938 Bacteria 1715
130 Ga0207711_10001052 3300025941 Bacteria 26434
131 Ga0207711_10075058 3300025941 Bacteria 2942
132 Ga0207679_11926074 3300025945 Bacteria 539
133 Ga0207667_10212493 3300025949 Bacteria 1983
134 Ga0207667_10351347 3300025949 Unclassified 1504
135 Ga0207651_11406373 3300025960 Bacteria 628
136 Ga0207712_10038029 3300025961 Bacteria 3288
137 Ga0207712_10742681 3300025961 Bacteria 859
138 Ga0207668_10006364 3300025972 Bacteria 6982
139 Ga0207668_10031143 3300025972 Bacteria 3511
140 Ga0207668_11868970 3300025972 Bacteria 542
141 Ga0207640_11164539 3300025981 Bacteria 684
142 Ga0207658_10269101 3300025986 Bacteria 1455
143 Ga0207658_10871997 3300025986 Bacteria 819
144 Ga0207703_10142633 3300026035 Bacteria 2080
145 Ga0207639_10051362 3300026041 Bacteria 3135
146 Ga0207639_10092171 3300026041 Bacteria 2428
147 Ga0207702_10445153 3300026078 Unclassified 1256
148 Ga0207641_10001740 3300026088 Bacteria 21016
149 Ga0207648_10651444 3300026089 Bacteria 973
150 Ga0207648_11149705 3300026089 Bacteria 728
151 Ga0207676_10127551 3300026095 Bacteria 2157
152 Ga0207676_11784032 3300026095 Viruses 614
153 Ga0207674_12182758 3300026116 Bacteria 517
154 Ga0207675_100000016 3300026118 Bacteria 126353
155 Ga0209981_1007543 3300027378 Bacteria 1468
156 Ga0209999_1004640 3300027543 Bacteria 2466
157 Ga0209983_1019688 3300027665 Bacteria 1404
158 Ga0209813_10221209 3300027866 Bacteria 709
159 Ga0268266_10000229 3300028379 Bacteria 96547
160 Ga0268266_10267393 3300028379 Bacteria 1586
161 Ga0268265_10008681 3300028380 Bacteria 6869
162 Ga0268265_10151002 3300028380 Bacteria 1959
163 Ga0268264_10021247 3300028381 Bacteria 5303
164 Ga0307515_10058326 3300028794 Bacteria 5562
165 Ga0265338_10043531 3300028800 Bacteria 4162
166 Ga0265338_10077668 3300028800 Bacteria 2806
167 Ga0265338_10522545 3300028800 Bacteria 834
168 Ga0307408_100654490 3300031548 Bacteria 940
169 Ga0265342_10590668 3300031712 Bacteria 561
170 Ga0307516_10000113 3300031730 Bacteria 93946
171 Ga0307410_11958667 3300031852 Bacteria 522
172 Ga0307406_10539279 3300031901 Bacteria 953
173 Ga0307406_11651876 3300031901 Unclassified 567
174 Ga0307414_10151973 3300032004 Bacteria 1827
175 Ga0307414_10312194 3300032004 Bacteria 1335
176 Ga0307414_10923893 3300032004 Bacteria 801
177 Ga0307411_10282985 3300032005 Bacteria 1321
178 Ga0307415_101024803 3300032126 Bacteria 769
179 Ga0307510_10022030 3300033180 Bacteria 7407
180 Ga0373944_0016569 3300035089 Bacteria 2080
181 Ga0373954_0700861 3300035118 Bacteria 502
182 Ga0373927_0000831 3300035695 Bacteria 23649
183 Ga0373933_0927364 3300035724 Bacteria 573
184 Ga0373937_0265927 3300036401 Bacteria 1618
185 Ga0373937_1490081 3300036401 Bacteria 624
186 Ga0373925_0001906 3300037068 Bacteria 17311
187 Ga0395899_0048856 3300037312 Bacteria 3146
188 Ga0395900_0215918 3300037418 Bacteria 1935
189 Ga0395898_0271180 3300037466 Bacteria 1618
190 Ga0395905_0421425 3300037471 Bacteria 1231
191 Ga0436364_0513955 3300037853 Bacteria 1790
192 Ga0395901_0233140 3300038443 Bacteria 1921
193 Ga0436365_0727276 3300039437 Bacteria 64269
194 Ga0436363_1383154 3300039450 Bacteria 4500
195 Ga0439461_0185939 3300041410 Bacteria 552
196 Ga0451853_2250973 3300041512 Bacteria 524
197 Ga0451853_2872987 3300041512 Bacteria 575
198 Ga0439446_0005037 3300042156 Bacteria 3380
199 Ga0439458_0016406 3300042157 Bacteria 1685
200 Ga0439435_0108157 3300042436 Bacteria 860
201 Ga0439459_0013483 3300042438 Bacteria 1472
202 Ga0495627_000185 3300046453 Bacteria 69533
203 Ga0495590_0375405 3300046457 Bacteria 543
204 Ga0495638_0002128 3300046460 Bacteria 16657
205 Ga0495638_0002643 3300046460 Bacteria 14424
206 Ga0495638_0004335 3300046460 Bacteria 10752
207 Ga0495638_0006082 3300046460 Bacteria 8833
208 Ga0495638_0064070 3300046460 Bacteria 2264
209 Ga0495638_0236568 3300046460 Bacteria 1013
210 Ga0495638_0295765 3300046460 Bacteria 874
211 Ga0495638_0334780 3300046460 Bacteria 804
212 Ga0495650_0000045 3300046471 Bacteria 346204
213 Ga0495585_0295392 3300046492 Bacteria 798
214 Ga0495607_0067923 3300046501 Bacteria 2001
215 Ga0495583_0000069 3300046506 Bacteria 186863
216 Ga0495610_0000101 3300046512 Bacteria 99012
217 Ga0495616_0000270 3300046513 Bacteria 42085
218 Ga0495616_0045459 3300046513 Bacteria 2222
219 Ga0495616_0068098 3300046513 Bacteria 1729
220 Ga0495620_0033849 3300046515 Bacteria 2315
221 Ga0495620_0045054 3300046515 Bacteria 1913
222 Ga0495620_0060553 3300046515 Bacteria 1578
223 Ga0495631_0202816 3300046518 Bacteria 848
224 Ga0495631_0275052 3300046518 Bacteria 717
225 Ga0495632_0001639 3300046519 Bacteria 18335
226 Ga0495632_0019948 3300046519 Bacteria 3641
227 Ga0495637_0007373 3300046520 Bacteria 5456
228 Ga0495643_0102959 3300046522 Bacteria 1461
229 Ga0495652_0286827 3300046529 Bacteria 1203
230 Ga0495654_0000018 3300046530 Bacteria 293124
231 Ga0495598_0094996 3300046537 Bacteria 978
232 Ga0495609_0042281 3300046538 Bacteria 2047
233 Ga0495597_0305479 3300046542 Bacteria 617
234 Ga0495633_0182165 3300046558 Bacteria 967
235 Ga0495668_0010475 3300046616 Bacteria 5607
236 Ga0495668_0117517 3300046616 Bacteria 1454
237 Ga0495668_0153503 3300046616 Bacteria 1261
238 Ga0495668_0192050 3300046616 Bacteria 1118
239 Ga0495625_0000011 3300046660 Bacteria 377120
240 Ga0495625_0004251 3300046660 Bacteria 13639
241 Ga0495625_0018102 3300046660 Bacteria 5507
242 Ga0495625_0038770 3300046660 Bacteria 3484
243 Ga0495625_0038875 3300046660 Bacteria 3478
244 Ga0495625_0229110 3300046660 Bacteria 1214
245 Ga0495625_0238375 3300046660 Bacteria 1185
246 Ga0495625_0334343 3300046660 Bacteria 961
247 Ga0495625_0499637 3300046660 Bacteria 744
248 Ga0495613_0004913 3300046689 Bacteria 10050
249 Ga0495671_0420412 3300046692 Bacteria 639
250 Ga0495649_0000410 3300046694 Bacteria 37291
251 Ga0495589_0011440 3300046794 Bacteria 4607
252 Ga0495660_0003649 3300046810 Bacteria 9474
253 Ga0495660_0025938 3300046810 Bacteria 3325
254 Ga0495660_0098389 3300046810 Bacteria 1509
255 Ga0495660_0150406 3300046810 Bacteria 1150
256 Ga0495660_0232594 3300046810 Bacteria 863
257 Ga0495636_0392775 3300047318 Bacteria 660
258 Ga0495672_0004230 3300047320 Bacteria 11857
259 Ga0495683_0227584 3300047323 Bacteria 828
260 Ga0495687_074075 3300047443 Bacteria 1355
261 Ga0495685_211015 3300047447 Bacteria 621
262 Ga0495673_0000056 3300047469 Bacteria 245918
263 Ga0495673_0004713 3300047469 Bacteria 8461
264 Ga0495681_0215420 3300047470 Bacteria 772
265 Ga0495684_0960771 3300047471 Bacteria 546
266 Ga0495686_0002660 3300047472 Bacteria 16456
267 Ga0495686_0027835 3300047472 Bacteria 3685
268 Ga0495686_0036965 3300047472 Bacteria 3131
269 Ga0495686_0057564 3300047472 Bacteria 2426
270 Ga0495686_0089806 3300047472 Bacteria 1867
271 Ga0495626_0080666 3300048091 Bacteria 1446
272 Ga0496100_0346498 3300048903 Bacteria 1121
273 Ga0496101_0261434 3300048904 Bacteria 1350
274 Ga0496102_0434616 3300048905 Bacteria 1232
275 Ga0496102_1147535 3300048905 Bacteria 697
276 Ga0496102_1347196 3300048905 Bacteria 633
277 Ga0496103_0036131 3300048906 Bacteria 3025
278 Ga0496104_1390902 3300048907 Unclassified 605
279 Ga0496105_0361080 3300048908 Bacteria 1159
280 Ga0496106_0084941 3300048909 Bacteria 2436
281 Ga0496107_0000515 3300048910 Bacteria 21514
282 Ga0496108_0915564 3300048911 Bacteria 752
283 Ga0496108_1538126 3300048911 Bacteria 552
284 Ga0496109_1030490 3300048912 Bacteria 760
285 Ga0496110_1603214 3300048913 Bacteria 561
286 Ga0496110_1729349 3300048913 Bacteria 536
287 Ga0496113_0295853 3300048916 Bacteria 1296
288 Ga0496113_0458599 3300048916 Bacteria 1024
289 Ga0496116_0033073 3300048919 Bacteria 3675
290 Ga0496117_0132052 3300048920 Bacteria 1511
291 Ga0496117_0276796 3300048920 Bacteria 901
292 Ga0496118_0244506 3300048921 Bacteria 1024
293 Ga0496118_0263893 3300048921 Bacteria 970
294 Ga0496118_0395755 3300048921 Unclassified 719
295 Ga0496119_0081684 3300048922 Bacteria 1860
296 Ga0496119_0095054 3300048922 Bacteria 1684
297 Ga0496121_0003029 3300048924 Bacteria 24402
298 Ga0496121_0028182 3300048924 Bacteria 5234
299 Ga0496121_0445392 3300048924 Bacteria 836
300 Ga0496124_0019388 3300048927 Bacteria 6332
301 Ga0496124_0193255 3300048927 Bacteria 1555
302 Ga0496124_0222414 3300048927 Bacteria 1418
303 Ga0496125_0096118 3300048928 Bacteria 2201
304 Ga0496126_0018537 3300048929 Bacteria 6891
305 Ga0496126_0446393 3300048929 Bacteria 1042
306 Ga0495678_103353 3300049459 Bacteria 984
307 Ga0501031_0048745 3300049568 Bacteria 2760
308 Ga0501032_0005964 3300049569 Bacteria 8992
309 Ga0501033_0001165 3300049570 Bacteria 23773
310 Ga0501034_0003552 3300049571 Bacteria 17717
311 Ga0501034_0007716 3300049571 Bacteria 11447
312 Ga0501034_0400557 3300049571 Bacteria 1295
313 Ga0501034_0797676 3300049571 Bacteria 837
314 Ga0501034_0907994 3300049571 Bacteria 768
315 Ga0501036_0001542 3300049572 Bacteria 17810
316 Ga0501037_0015285 3300049573 Bacteria 5647
317 Ga0501038_0002111 3300049574 Bacteria 18438
318 Ga0501039_0072148 3300049575 Bacteria 2683
319 Ga0501040_0526279 3300049576 Bacteria 853
320 Ga0501043_0245372 3300049579 Bacteria 1380
321 Ga0501043_0605249 3300049579 Bacteria 809
322 Ga0501046_0118561 3300049580 Bacteria 2016
323 Ga0501046_1203382 3300049580 Bacteria 520
324 Ga0501047_0017806 3300049581 Bacteria 6805
325 Ga0501047_0035248 3300049581 Bacteria 4834
326 Ga0501047_0164339 3300049581 Bacteria 2091
327 Ga0501047_0236430 3300049581 Bacteria 1679
328 Ga0501048_0250877 3300049582 Bacteria 1256
329 Ga0501070_0021981 3300049586 Bacteria 5345
330 Ga0501238_000513 3300049671 Bacteria 4442
331 Ga0501269_059526 3300049766 Unclassified 538
332 Ga0501035_0009079 3300049822 Bacteria 9244
333 Ga0501035_0128634 3300049822 Bacteria 2209
334 Ga0501035_0914295 3300049822 Bacteria 694
335 Ga0501044_0008547 3300049823 Bacteria 11220
336 Ga0501044_0122160 3300049823 Bacteria 2604
337 nmdc:mga03683_120808_c1 3300050489 Bacteria 1165
338 nmdc:mga03683_137393_c1 3300050489 Bacteria 1097
339 nmdc:mga03683_235208_c1 3300050489 Bacteria 848
340 nmdc:mga03683_256227_c1 3300050489 Bacteria 813
341 nmdc:mga03n38_446052_c1 3300050490 Bacteria 719
342 nmdc:mga03n38_546801_c1 3300050490 Bacteria 655
343 nmdc:mga00v17_102797_c1 3300050491 Bacteria 1805
344 nmdc:mga00v17_801163_c1 3300050491 Bacteria 600
345 nmdc:mga0yw44_371475_c1 3300050492 Bacteria 965
346 nmdc:mga0yw44_67650_c1 3300050492 Bacteria 2208
347 nmdc:mga0k408_124863_c2 3300050493 Bacteria 667
348 nmdc:mga0k408_496795_c1 3300050493 Bacteria 723
349 nmdc:mga06z11_129653_c1 3300050494 Bacteria 1415
350 nmdc:mga06z11_308077_c1 3300050494 Bacteria 943
351 nmdc:mga04h51_251315_c1 3300050495 Bacteria 709
352 nmdc:mga07m45_21674_c2 3300050496 Bacteria 3015
353 nmdc:mga07m45_59911_c1 3300050496 Unclassified 2154
354 nmdc:mga07m45_94145_c1 3300050496 Bacteria 1717
355 nmdc:mga0sz30_3064_c1 3300050516 Bacteria 5987
356 nmdc:mga0sz30_7104_c1 3300050516 Bacteria 3726
357 Ga0500610_0067284 3300053079 Bacteria 1868
358 Ga0495655_0216969 3300053083 Bacteria 631
359 Ga0500578_0634153 3300053086 Bacteria 583
360 Ga0500641_0162941 3300053096 Bacteria 961
361 Ga0500555_059050 3300053103 Bacteria 1035
362 Ga0500556_0000838 3300053104 Bacteria 17665
363 Ga0500562_000627 3300053108 Bacteria 8521
364 Ga0500592_065272 3300053116 Bacteria 597
365 Ga0500595_028428 3300053119 Bacteria 1906
366 Ga0500608_000135 3300053122 Bacteria 30072
367 Ga0500618_000178 3300053125 Bacteria 52653
368 Ga0500658_0016923 3300053134 Bacteria 2719
369 Ga0500658_0060530 3300053134 Bacteria 1573
370 Ga0500559_0000031 3300053136 Bacteria 114782
371 Ga0500559_0000048 3300053136 Bacteria 93755
372 Ga0500559_0000984 3300053136 Bacteria 17768
373 Ga0500559_0060209 3300053136 Bacteria 1691
374 Ga0500573_0000002 3300053140 Bacteria 407088
375 Ga0500577_0025511 3300053142 Bacteria 2001
376 Ga0500604_0028566 3300053151 Bacteria 1621
377 Ga0500604_0043298 3300053151 Bacteria 1367
378 Ga0500616_0241543 3300053153 Bacteria 776
379 Ga0500620_000034 3300053155 Bacteria 26345
380 Ga0500622_0005037 3300053156 Bacteria 8048
381 Ga0500622_0005173 3300053156 Bacteria 7907
382 Ga0500627_0451044 3300053158 Bacteria 541
383 Ga0500634_0293018 3300053161 Bacteria 650
384 Ga0500611_013262 3300053727 Bacteria 1410
385 Ga0500645_002542 3300053730 Bacteria 8050
386 Ga0500609_002050 3300053731 Bacteria 2894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2843744320 2843749077 100
2 iso_pu_bacteria 2849573788 2849576439 100
3 iso_pu_bacteria 2849573788 2849576444 100
4 iso_pu_bacteria 2856328259 2856333774 100
5 iso_pu_bacteria 2857367948 2857369640 100
6 iso_pu_bacteria 2869271264 2869272271 100
7 iso_pu_bacteria 2874162495 2874165156 100
8 iso_pu_bacteria 2876399893 2876404903 100
9 iso_pu_bacteria 2876406927 2876411575 100
10 iso_pu_bacteria 2878781027 2878782897 100
11 iso_pu_bacteria 2884960567 2884961985 100
12 iso_pu_bacteria 2906386501 2906391355 100
13 iso_pu_bacteria 2906408224 2906413579 100
14 iso_pu_bacteria 2922151315 2922157831 100
15 iso_pu_bacteria 2922172374 2922176724 100
16 iso_pu_bacteria 2924748358 2924752274 100
17 iso_pu_bacteria 2928531327 2928534088 100
18 3300003781 Ga0055536_1000383 Ga0055536_100038325 104
19 3300003791 Ga0055530_10002867 Ga0055530_100028673 104
20 3300003794 Ga0055531_10000549 Ga0055531_1000054922 104
21 3300025292 Ga0209676_1000043 Ga0209676_1000043124 104
22 3300025298 Ga0209050_1001080 Ga0209050_100108022 104
23 3300025304 Ga0209257_1000134 Ga0209257_1000134185 104
24 iso_pu_bacteria 2508501127 2509144487 106
25 iso_pu_bacteria 2509276018 2509368214 106
26 iso_pu_bacteria 2509276018 2509372941 106
27 iso_pu_bacteria 2510065059 2510315880 106
28 iso_pu_bacteria 2597489875 2597811821 106
29 iso_pu_bacteria 2643221551 2643776015 106
30 iso_pu_bacteria 2643221555 2643794462 106
31 iso_pu_bacteria 2643221595 2643987719 106
32 iso_pu_bacteria 2643221627 2644156669 106
33 iso_pu_bacteria 2687453392 2688598062 106
34 iso_pu_bacteria 2756170246 2756672147 106
35 iso_pu_bacteria 2791355123 2792751642 106
36 iso_pu_bacteria 2791355123 2792752365 106
37 iso_pu_bacteria 2841734538 2841736831 106
38 iso_pu_bacteria 2844002411 2844007904 106
39 iso_pu_bacteria 2844009547 2844013288 106
40 iso_pu_bacteria 2856334872 2856338164 106
41 iso_pu_bacteria 2856356410 2856359785 106
42 iso_pu_bacteria 2869162929 2869167508 106
43 iso_pu_bacteria 2869169390 2869175160 106
44 iso_pu_bacteria 2869234852 2869237098 106
45 iso_pu_bacteria 2869242130 2869246258 106
46 iso_pu_bacteria 2869249662 2869250390 106
47 iso_pu_bacteria 2869249662 2869256651 106
48 iso_pu_bacteria 2869256925 2869264009 106
49 iso_pu_bacteria 2869264136 2869265672 106
50 iso_pu_bacteria 2869264136 2869268773 106
51 iso_pu_bacteria 2871435913 2871441857 106
52 iso_pu_bacteria 2871451962 2871452629 106
53 iso_pu_bacteria 2871459585 2871463925 106
54 iso_pu_bacteria 2871459585 2871465111 106
55 iso_pu_bacteria 2871466892 2871469320 106
56 iso_pu_bacteria 2871474448 2871480507 106
57 iso_pu_bacteria 2871481445 2871486248 106
58 iso_pu_bacteria 2874109183 2874114074 106
59 iso_pu_bacteria 2874116593 2874117424 106
60 iso_pu_bacteria 2874131515 2874132581 106
61 iso_pu_bacteria 2876386047 2876390565 106
62 iso_pu_bacteria 2876420981 2876421356 106
63 iso_pu_bacteria 2878730984 2878737419 106
64 iso_pu_bacteria 2878774303 2878779450 106
65 iso_pu_bacteria 2878788777 2878795038 106
66 iso_pu_bacteria 2885312484 2885313691 106
67 iso_pu_bacteria 2903513507 2903515208 106
68 iso_pu_bacteria 2906363423 2906367607 106
69 iso_pu_bacteria 2906363423 2906370064 106
70 iso_pu_bacteria 2906370794 2906370932 106
71 iso_pu_bacteria 2906370794 2906371327 106
72 iso_pu_bacteria 2906378014 2906384488 106
73 iso_pu_bacteria 2906393657 2906396461 106
74 iso_pu_bacteria 2906393657 2906398590 106
75 iso_pu_bacteria 2906401398 2906407178 106
76 iso_pu_bacteria 2906427513 2906433895 106
77 iso_pu_bacteria 2920760137 2920761575 106
78 iso_pu_bacteria 2922178524 2922181229 106
79 iso_pu_bacteria 2924710171 2924715110 106
80 iso_pu_bacteria 2924733363 2924734972 106
81 iso_pu_bacteria 2924741084 2924743367 106
82 iso_pu_bacteria 2924762789 2924766517 106
83 iso_pu_bacteria 2937822353 2937822796 106
84 iso_pu_bacteria 2937843397 2937845238 106
85 iso_pu_bacteria 2937843397 2937846423 106
86 iso_pu_bacteria 2937861824 2937862412 106
87 iso_pu_bacteria 2937868953 2937875369 106
88 iso_pu_bacteria 2937868953 2937876006 106
89 iso_pu_bacteria 2937980651 2937984475 106
90 iso_pu_bacteria 2958071322 2958073109 106
91 iso_pu_bacteria 2958108152 2958109146 106
92 iso_pu_bacteria 2958122699 2958127490 106
93 iso_pu_bacteria 2958137437 2958138765 106
94 iso_pu_bacteria 2958158011 2958162230 106
95 iso_pu_bacteria 2961136820 2961141976 106
96 iso_pu_bacteria 2961183825 2961187458 106
97 iso_pu_bacteria 2965025482 2965026067 106
98 iso_pu_bacteria 2965032056 2965040007 106
99 iso_pu_bacteria 2965040258 2965041459 106
100 iso_pu_bacteria 2965040258 2965045565 106
101 iso_pu_bacteria 2965047637 2965052577 106
102 iso_pu_bacteria 2965089291 2965090061 106
103 iso_pu_bacteria 2965089291 2965091210 106
104 iso_pu_bacteria 2965102966 2965104589 106
105 iso_pu_bacteria 2965110997 2965115692 106
106 iso_pu_bacteria 2968138860 2968139827 106
107 iso_pu_bacteria 2970489779 2970493262 106
108 iso_pu_bacteria 2970510686 2970512611 106
109 iso_pu_bacteria 2970524798 2970526534 106
110 iso_pu_bacteria 2970532167 2970538704 106
111 iso_pu_bacteria 2970540015 2970545023 106
112 iso_pu_bacteria 2970547951 2970551761 106
113 iso_pu_bacteria 2970619444 2970624779 106
114 iso_pu_bacteria 2970627176 2970627487 106
115 iso_pu_bacteria 2977851361 2977857348 106
116 iso_pu_bacteria 2977872689 2977877829 106
117 iso_pu_bacteria 2977898635 2977903827 106
118 iso_pu_bacteria 2977907340 2977907643 106
119 iso_pu_bacteria 2977915119 2977917136 106
120 iso_pu_bacteria 2977915119 2977918857 106
121 iso_pu_bacteria 2977935797 2977936651 106
122 iso_pu_bacteria 2977950692 2977951086 106
123 iso_pu_bacteria 2977950692 2977956466 106
124 iso_pu_bacteria 2977957713 2977959912 106
125 iso_pu_bacteria 2979764755 2979771247 106
126 iso_pu_bacteria 2979772303 2979779167 106
127 iso_pu_bacteria 2979793036 2979799703 106
128 iso_pu_bacteria 2987645492 2987646243 106
129 iso_pu_bacteria 2987666974 2987667106 106
130 iso_pu_bacteria 2987673487 2987674687 106
131 iso_pu_bacteria 2996386984 2996388944 106
132 iso_pu_bacteria 3004167301 3004168373 106
133 iso_pu_bacteria 3004195979 3004198794 106
134 iso_pu_bacteria 3004195979 3004199383 106
135 iso_pu_bacteria 3004232784 3004239450 106
136 iso_pu_bacteria 3004239961 3004240032 106
137 iso_pu_bacteria 3004248173 3004254208 106
138 iso_pu_bacteria 3004268573 3004272978 106
139 iso_pu_bacteria 649633066 649872597 106
140 iso_pu_bacteria 8004300914 8004304070 106
141 iso_pu_bacteria 8004312739 8004315647 106
142 iso_pu_bacteria 8004361976 8004365174 106
143 iso_pu_bacteria 8004361976 8004366822 106
144 iso_pu_bacteria 8004395343 8004399341 106
145 iso_pu_bacteria 8004633249 8004635250 106
146 iso_pu_bacteria 8004695233 8004701599 106
147 iso_pu_bacteria 8004727605 8004733244 106
148 iso_pu_bacteria 8055617313 8055618357 106
149 3300021388 Ga0213875_10162632 Ga0213875_101626322 107
150 3300037853 Ga0436364_0513955 Ga0436364_0513955_1013_1387 107
151 iso_pu_bacteria 2856342000 2856344627 107
152 iso_pu_bacteria 2889790730 2889793525 107
153 iso_pu_bacteria 2889914905 2889918168 107
154 iso_pu_bacteria 2937836603 2937841317 107
155 3300006177 Ga0075362_10267208 Ga0075362_102672082 108
156 iso_pu_bacteria 2510917020 2511124401 108
157 iso_pu_bacteria 2582581279 2585146850 108
158 iso_pu_bacteria 2582581280 2585152347 108
159 iso_pu_bacteria 2582581293 2585198946 108
160 iso_pu_bacteria 2643221545 2643751595 108
161 iso_pu_bacteria 2643221552 2643782513 108
162 iso_pu_bacteria 2643221583 2643926098 108
163 iso_pu_bacteria 2643221584 2643928720 108
164 iso_pu_bacteria 2643221691 2644511354 108
165 iso_pu_bacteria 2791355048 2792458921 108
166 iso_pu_bacteria 2791355048 2792462245 108
167 iso_pu_bacteria 2818991435 2819535634 108
168 iso_pu_bacteria 2818991454 2819644909 108
169 iso_pu_bacteria 2849560528 2849563762 108
170 iso_pu_bacteria 2851153111 2851154938 108
171 iso_pu_bacteria 2857504554 2857507214 108
172 iso_pu_bacteria 2898329390 2898331474 108
173 3300006178 Ga0075367_10173199 Ga0075367_101731992 109
174 3300025960 Ga0207651_11406373 Ga0207651_114063732 109
175 3300031548 Ga0307408_100654490 Ga0307408_1006544902 109
176 3300031901 Ga0307406_10539279 Ga0307406_105392792 109
177 3300032004 Ga0307414_10151973 Ga0307414_101519733 109
178 3300032004 Ga0307414_10312194 Ga0307414_103121942 109
179 3300032004 Ga0307414_10923893 Ga0307414_109238932 109
180 3300032005 Ga0307411_10282985 Ga0307411_102829853 109
181 3300046694 Ga0495649_0000410 Ga0495649_0000410_3541_3885 109
182 3300047469 Ga0495673_0004713 Ga0495673_0004713_7606_7953 109
183 3300047472 Ga0495686_0027835 Ga0495686_0027835_894_1265 109
184 3300053096 Ga0500641_0162941 Ga0500641_0162941_582_923 109
185 3300053140 Ga0500573_0000002 Ga0500573_0000002_50825_51178 109
186 3300005356 Ga0070674_100111770 Ga0070674_1001117701 110
187 3300005356 Ga0070674_100222423 Ga0070674_1002224232 110
188 3300005356 Ga0070674_100745292 Ga0070674_1007452922 110
189 3300005367 Ga0070667_100655805 Ga0070667_1006558052 110
190 3300005455 Ga0070663_101883697 Ga0070663_1018836971 110
191 3300005530 Ga0070679_100822662 Ga0070679_1008226622 110
192 3300005539 Ga0068853_100489825 Ga0068853_1004898252 110
193 3300005539 Ga0068853_100956442 Ga0068853_1009564422 110
194 3300005548 Ga0070665_100043733 Ga0070665_1000437337 110
195 3300005548 Ga0070665_100545565 Ga0070665_1005455652 110
196 3300005563 Ga0068855_100388575 Ga0068855_1003885752 110
197 3300005578 Ga0068854_102236234 Ga0068854_1022362341 110
198 3300005614 Ga0068856_101777313 Ga0068856_1017773132 110
199 3300005718 Ga0068866_10810776 Ga0068866_108107762 110
200 3300006038 Ga0075365_10055453 Ga0075365_100554535 110
201 3300006038 Ga0075365_10072218 Ga0075365_100722182 110
202 3300006038 Ga0075365_10462976 Ga0075365_104629762 110
203 3300006042 Ga0075368_10070759 Ga0075368_100707592 110
204 3300006048 Ga0075363_100397285 Ga0075363_1003972852 110
205 3300006178 Ga0075367_10046068 Ga0075367_100460683 110
206 3300006178 Ga0075367_10182710 Ga0075367_101827102 110
207 3300006186 Ga0075369_10167903 Ga0075369_101679032 110
208 3300006195 Ga0075366_10288825 Ga0075366_102888252 110
209 3300006195 Ga0075366_10353112 Ga0075366_103531122 110
210 3300006881 Ga0068865_100325846 Ga0068865_1003258462 110
211 3300009098 Ga0105245_10899139 Ga0105245_108991392 110
212 3300009148 Ga0105243_10050859 Ga0105243_100508592 110
213 3300009174 Ga0105241_12142745 Ga0105241_121427451 110
214 3300009551 Ga0105238_10683169 Ga0105238_106831691 110
215 3300009553 Ga0105249_12595114 Ga0105249_125951141 110
216 3300010375 Ga0105239_10666929 Ga0105239_106669292 110
217 3300013308 Ga0157375_11818756 Ga0157375_118187562 110
218 3300014325 Ga0163163_11577801 Ga0163163_115778011 110
219 3300014969 Ga0157376_10248674 Ga0157376_102486743 110
220 3300014969 Ga0157376_10559308 Ga0157376_105593082 110
221 3300025298 Ga0209050_1027809 Ga0209050_10278093 110
222 3300025907 Ga0207645_10272068 Ga0207645_102720682 110
223 3300025921 Ga0207652_10305597 Ga0207652_103055972 110
224 3300025935 Ga0207709_10418402 Ga0207709_104184022 110
225 3300025937 Ga0207669_10223446 Ga0207669_102234462 110
226 3300025937 Ga0207669_10683223 Ga0207669_106832232 110
227 3300025938 Ga0207704_10093552 Ga0207704_100935523 110
228 3300025945 Ga0207679_11926074 Ga0207679_119260742 110
229 3300025949 Ga0207667_10351347 Ga0207667_103513472 110
230 3300025972 Ga0207668_11868970 Ga0207668_118689702 110
231 3300025981 Ga0207640_11164539 Ga0207640_111645391 110
232 3300026041 Ga0207639_10051362 Ga0207639_100513623 110
233 3300026041 Ga0207639_10092171 Ga0207639_100921714 110
234 3300026078 Ga0207702_10445153 Ga0207702_104451532 110
235 3300026116 Ga0207674_12182758 Ga0207674_121827581 110
236 3300027378 Ga0209981_1007543 Ga0209981_10075433 110
237 3300027543 Ga0209999_1004640 Ga0209999_10046403 110
238 3300027665 Ga0209983_1019688 Ga0209983_10196883 110
239 3300027866 Ga0209813_10221209 Ga0209813_102212092 110
240 3300028379 Ga0268266_10267393 Ga0268266_102673932 110
241 3300028800 Ga0265338_10522545 Ga0265338_105225451 110
242 3300031712 Ga0265342_10590668 Ga0265342_105906681 110
243 3300031852 Ga0307410_11958667 Ga0307410_119586671 110
244 3300035724 Ga0373933_0927364 Ga0373933_0927364_30_389 110
245 3300036401 Ga0373937_1490081 Ga0373937_1490081_233_592 110
246 3300037312 Ga0395899_0048856 Ga0395899_0048856_20_352 110
247 3300037418 Ga0395900_0215918 Ga0395900_0215918_435_767 110
248 3300037466 Ga0395898_0271180 Ga0395898_0271180_511_843 110
249 3300038443 Ga0395901_0233140 Ga0395901_0233140_1077_1409 110
250 3300041512 Ga0451853_2250973 Ga0451853_2250973_54_386 110
251 3300042157 Ga0439458_0016406 Ga0439458_0016406_159_491 110
252 3300046457 Ga0495590_0375405 Ga0495590_0375405_64_396 110
253 3300046460 Ga0495638_0295765 Ga0495638_0295765_428_760 110
254 3300046515 Ga0495620_0060553 Ga0495620_0060553_1207_1539 110
255 3300046537 Ga0495598_0094996 Ga0495598_0094996_82_414 110
256 3300046616 Ga0495668_0153503 Ga0495668_0153503_749_1081 110
257 3300046660 Ga0495625_0238375 Ga0495625_0238375_437_769 110
258 3300046660 Ga0495625_0499637 Ga0495625_0499637_62_394 110
259 3300046810 Ga0495660_0150406 Ga0495660_0150406_103_435 110
260 3300047318 Ga0495636_0392775 Ga0495636_0392775_109_441 110
261 3300047443 Ga0495687_074075 Ga0495687_074075_459_791 110
262 3300047447 Ga0495685_211015 Ga0495685_211015_39_371 110
263 3300047472 Ga0495686_0057564 Ga0495686_0057564_198_530 110
264 3300047472 Ga0495686_0089806 Ga0495686_0089806_128_460 110
265 3300048091 Ga0495626_0080666 Ga0495626_0080666_75_407 110
266 3300048905 Ga0496102_1147535 Ga0496102_1147535_191_523 110
267 3300048905 Ga0496102_1347196 Ga0496102_1347196_157_501 110
268 3300048908 Ga0496105_0361080 Ga0496105_0361080_43_375 110
269 3300048911 Ga0496108_0915564 Ga0496108_0915564_24_356 110
270 3300048911 Ga0496108_1538126 Ga0496108_1538126_76_408 110
271 3300048912 Ga0496109_1030490 Ga0496109_1030490_174_506 110
272 3300048913 Ga0496110_1603214 Ga0496110_1603214_149_481 110
273 3300048913 Ga0496110_1729349 Ga0496110_1729349_85_417 110
274 3300048916 Ga0496113_0295853 Ga0496113_0295853_792_1124 110
275 3300048920 Ga0496117_0276796 Ga0496117_0276796_177_509 110
276 3300048921 Ga0496118_0263893 Ga0496118_0263893_381_713 110
277 3300048922 Ga0496119_0081684 Ga0496119_0081684_1487_1819 110
278 3300048924 Ga0496121_0445392 Ga0496121_0445392_31_363 110
279 3300048927 Ga0496124_0193255 Ga0496124_0193255_941_1273 110
280 3300049568 Ga0501031_0048745 Ga0501031_0048745_1496_1828 110
281 3300049569 Ga0501032_0005964 Ga0501032_0005964_7242_7574 110
282 3300049570 Ga0501033_0001165 Ga0501033_0001165_8176_8508 110
283 3300049571 Ga0501034_0003552 Ga0501034_0003552_7233_7565 110
284 3300049571 Ga0501034_0007716 Ga0501034_0007716_5489_5821 110
285 3300049571 Ga0501034_0797676 Ga0501034_0797676_238_612 110
286 3300049571 Ga0501034_0907994 Ga0501034_0907994_170_502 110
287 3300049572 Ga0501036_0001542 Ga0501036_0001542_6988_7320 110
288 3300049573 Ga0501037_0015285 Ga0501037_0015285_1801_2133 110
289 3300049574 Ga0501038_0002111 Ga0501038_0002111_10865_11197 110
290 3300049575 Ga0501039_0072148 Ga0501039_0072148_928_1260 110
291 3300049579 Ga0501043_0245372 Ga0501043_0245372_899_1231 110
292 3300049580 Ga0501046_0118561 Ga0501046_0118561_1333_1665 110
293 3300049581 Ga0501047_0017806 Ga0501047_0017806_1789_2121 110
294 3300049581 Ga0501047_0164339 Ga0501047_0164339_441_773 110
295 3300049582 Ga0501048_0250877 Ga0501048_0250877_143_475 110
296 3300049586 Ga0501070_0021981 Ga0501070_0021981_3515_3847 110
297 3300049822 Ga0501035_0009079 Ga0501035_0009079_7242_7574 110
298 3300049822 Ga0501035_0128634 Ga0501035_0128634_67_399 110
299 3300049822 Ga0501035_0914295 Ga0501035_0914295_210_542 110
300 3300049823 Ga0501044_0008547 Ga0501044_0008547_2773_3105 110
301 3300049823 Ga0501044_0122160 Ga0501044_0122160_288_620 110
302 3300050489 nmdc:mga03683_120808_c1 nmdc:mga03683_120808_c1_213_545 110
303 3300050489 nmdc:mga03683_137393_c1 nmdc:mga03683_137393_c1_77_409 110
304 3300050490 nmdc:mga03n38_546801_c1 nmdc:mga03n38_546801_c1_221_553 110
305 3300050491 nmdc:mga00v17_102797_c1 nmdc:mga00v17_102797_c1_1449_1781 110
306 3300050491 nmdc:mga00v17_801163_c1 nmdc:mga00v17_801163_c1_47_379 110
307 3300050492 nmdc:mga0yw44_371475_c1 nmdc:mga0yw44_371475_c1_190_522 110
308 3300050492 nmdc:mga0yw44_67650_c1 nmdc:mga0yw44_67650_c1_897_1229 110
309 3300050493 nmdc:mga0k408_124863_c2 nmdc:mga0k408_124863_c2_76_408 110
310 3300050494 nmdc:mga06z11_129653_c1 nmdc:mga06z11_129653_c1_166_510 110
311 3300050494 nmdc:mga06z11_308077_c1 nmdc:mga06z11_308077_c1_35_367 110
312 3300050495 nmdc:mga04h51_251315_c1 nmdc:mga04h51_251315_c1_305_637 110
313 3300050496 nmdc:mga07m45_21674_c2 nmdc:mga07m45_21674_c2_19_351 110
314 3300050516 nmdc:mga0sz30_7104_c1 nmdc:mga0sz30_7104_c1_268_612 110
315 3300053079 Ga0500610_0067284 Ga0500610_0067284_1287_1619 110
316 3300053083 Ga0495655_0216969 Ga0495655_0216969_31_363 110
317 3300053116 Ga0500592_065272 Ga0500592_065272_171_503 110
318 3300053134 Ga0500658_0060530 Ga0500658_0060530_792_1124 110
319 3300053136 Ga0500559_0000048 Ga0500559_0000048_86141_86506 110
320 3300053136 Ga0500559_0060209 Ga0500559_0060209_635_1012 110
321 3300053151 Ga0500604_0028566 Ga0500604_0028566_161_493 110
322 3300053151 Ga0500604_0043298 Ga0500604_0043298_179_511 110
323 3300053155 Ga0500620_000034 Ga0500620_000034_7083_7415 110
324 3300053158 Ga0500627_0451044 Ga0500627_0451044_38_370 110
325 3300005327 Ga0070658_10938816 Ga0070658_109388162 111
326 3300005614 Ga0068856_100042207 Ga0068856_1000422073 111
327 3300009553 Ga0105249_10068891 Ga0105249_100688913 111
328 3300010375 Ga0105239_10124059 Ga0105239_101240595 111
329 3300013306 Ga0163162_12635100 Ga0163162_126351001 111
330 3300025299 Ga0209256_1057964 Ga0209256_10579642 111
331 3300025909 Ga0207705_11299152 Ga0207705_112991522 111
332 3300025961 Ga0207712_10038029 Ga0207712_100380293 111
333 3300028800 Ga0265338_10043531 Ga0265338_100435313 111
334 3300031901 Ga0307406_11651876 Ga0307406_116518761 111
335 3300032126 Ga0307415_101024803 Ga0307415_1010248032 111
336 3300033180 Ga0307510_10022030 Ga0307510_100220306 111
337 3300037471 Ga0395905_0421425 Ga0395905_0421425_210_605 111
338 3300046460 Ga0495638_0002128 Ga0495638_0002128_935_1282 111
339 3300046492 Ga0495585_0295392 Ga0495585_0295392_385_741 111
340 3300046512 Ga0495610_0000101 Ga0495610_0000101_36423_36770 111
341 3300046513 Ga0495616_0045459 Ga0495616_0045459_324_671 111
342 3300046518 Ga0495631_0202816 Ga0495631_0202816_59_406 111
343 3300046529 Ga0495652_0286827 Ga0495652_0286827_553_924 111
344 3300046660 Ga0495625_0004251 Ga0495625_0004251_5737_6084 111
345 3300046660 Ga0495625_0018102 Ga0495625_0018102_2375_2731 111
346 3300046660 Ga0495625_0038875 Ga0495625_0038875_1576_1923 111
347 3300046689 Ga0495613_0004913 Ga0495613_0004913_1125_1496 111
348 3300047320 Ga0495672_0004230 Ga0495672_0004230_9088_9435 111
349 3300047471 Ga0495684_0960771 Ga0495684_0960771_52_423 111
350 3300049571 Ga0501034_0400557 Ga0501034_0400557_160_516 111
351 3300049576 Ga0501040_0526279 Ga0501040_0526279_44_379 111
352 3300049579 Ga0501043_0605249 Ga0501043_0605249_285_638 111
353 3300049581 Ga0501047_0035248 Ga0501047_0035248_2240_2593 111
354 3300049581 Ga0501047_0236430 Ga0501047_0236430_496_867 111
355 3300053103 Ga0500555_059050 Ga0500555_059050_582_929 111
356 3300053104 Ga0500556_0000838 Ga0500556_0000838_593_952 111
357 3300053134 Ga0500658_0016923 Ga0500658_0016923_2029_2376 111
358 3300002067 JGI24735J21928_10040285 JGI24735J21928_100402853 112
359 3300003215 JGI25153J46596_10062364 JGI25153J46596_100623642 112
360 3300003316 rootH1_10048436 rootH1_100484362 112
361 3300003320 rootH2_10079304 rootH2_100793042 112
362 3300003322 rootL2_10127334 rootL2_101273342 112
363 3300003322 rootL2_10127760 rootL2_101277602 112
364 3300003773 Ga0055537_1002473 Ga0055537_10024737 112
365 3300003775 Ga0055524_1034654 Ga0055524_10346542 112
366 3300003781 Ga0055536_1001415 Ga0055536_10014154 112
367 3300003781 Ga0055536_1003429 Ga0055536_10034295 112
368 3300003790 Ga0055528_1006831 Ga0055528_10068314 112
369 3300003791 Ga0055530_10001863 Ga0055530_100018634 112
370 3300003794 Ga0055531_10001682 Ga0055531_1000168215 112
371 3300005262 Ga0065165_1001354 Ga0065165_100135419 112
372 3300005262 Ga0065165_1078938 Ga0065165_10789382 112
373 3300005331 Ga0070670_100271186 Ga0070670_1002711862 112
374 3300005335 Ga0070666_10686418 Ga0070666_106864181 112
375 3300005347 Ga0070668_100037160 Ga0070668_1000371604 112
376 3300005353 Ga0070669_100889520 Ga0070669_1008895201 112
377 3300005355 Ga0070671_100021976 Ga0070671_1000219766 112
378 3300005459 Ga0068867_100645009 Ga0068867_1006450092 112
379 3300005617 Ga0068859_100001735 Ga0068859_10000173517 112
380 3300005618 Ga0068864_100215933 Ga0068864_1002159332 112
381 3300005618 Ga0068864_102100617 Ga0068864_1021006172 112
382 3300005719 Ga0068861_100001768 Ga0068861_1000017686 112
383 3300005842 Ga0068858_100113514 Ga0068858_1001135144 112
384 3300005842 Ga0068858_100557960 Ga0068858_1005579602 112
385 3300005843 Ga0068860_100010755 Ga0068860_10001075510 112
386 3300005844 Ga0068862_100251660 Ga0068862_1002516602 112
387 3300006048 Ga0075363_100543686 Ga0075363_1005436861 112
388 3300006177 Ga0075362_10148606 Ga0075362_101486061 112
389 3300006177 Ga0075362_10362760 Ga0075362_103627601 112
390 3300006186 Ga0075369_10010635 Ga0075369_100106353 112
391 3300006195 Ga0075366_10066983 Ga0075366_100669833 112
392 3300006353 Ga0075370_10048079 Ga0075370_100480794 112
393 3300006353 Ga0075370_10052527 Ga0075370_100525272 112
394 3300006881 Ga0068865_100185857 Ga0068865_1001858572 112
395 3300006931 Ga0097620_100001735 Ga0097620_10000173517 112
396 3300009101 Ga0105247_10029376 Ga0105247_100293762 112
397 3300009148 Ga0105243_10375460 Ga0105243_103754601 112
398 3300009177 Ga0105248_10010377 Ga0105248_100103775 112
399 3300009177 Ga0105248_10023821 Ga0105248_100238213 112
400 3300009551 Ga0105238_10649436 Ga0105238_106494362 112
401 3300009553 Ga0105249_10989031 Ga0105249_109890312 112
402 3300013307 Ga0157372_11342562 Ga0157372_113425621 112
403 3300014326 Ga0157380_11553459 Ga0157380_115534591 112
404 3300014497 Ga0182008_10210617 Ga0182008_102106172 112
405 3300015261 Ga0182006_1206997 Ga0182006_12069971 112
406 3300017792 Ga0163161_11568019 Ga0163161_115680191 112
407 3300021384 Ga0213876_10000170 Ga0213876_1000017050 112
408 3300025263 Ga0209565_1000065 Ga0209565_1000065127 112
409 3300025273 Ga0209673_1000818 Ga0209673_100081836 112
410 3300025273 Ga0209673_1016453 Ga0209673_10164534 112
411 3300025292 Ga0209676_1000184 Ga0209676_100018477 112
412 3300025295 Ga0209564_1002646 Ga0209564_100264619 112
413 3300025295 Ga0209564_1025384 Ga0209564_10253842 112
414 3300025297 Ga0209758_1001185 Ga0209758_100118530 112
415 3300025297 Ga0209758_1001639 Ga0209758_10016399 112
416 3300025298 Ga0209050_1000548 Ga0209050_100054842 112
417 3300025299 Ga0209256_1003381 Ga0209256_10033815 112
418 3300025299 Ga0209256_1028783 Ga0209256_10287832 112
419 3300025299 Ga0209256_1028789 Ga0209256_10287892 112
420 3300025303 Ga0209051_1003506 Ga0209051_10035069 112
421 3300025304 Ga0209257_1000074 Ga0209257_1000074120 112
422 3300025304 Ga0209257_1010377 Ga0209257_10103772 112
423 3300025735 Ga0207713_1002353 Ga0207713_10023536 112
424 3300025923 Ga0207681_10011959 Ga0207681_100119596 112
425 3300025924 Ga0207694_11128459 Ga0207694_111284592 112
426 3300025931 Ga0207644_10003100 Ga0207644_1000310010 112
427 3300025938 Ga0207704_10135174 Ga0207704_101351742 112
428 3300025941 Ga0207711_10001052 Ga0207711_1000105210 112
429 3300025941 Ga0207711_10075058 Ga0207711_100750582 112
430 3300025949 Ga0207667_10212493 Ga0207667_102124934 112
431 3300025961 Ga0207712_10742681 Ga0207712_107426812 112
432 3300025972 Ga0207668_10006364 Ga0207668_100063647 112
433 3300025972 Ga0207668_10031143 Ga0207668_100311432 112
434 3300025986 Ga0207658_10269101 Ga0207658_102691012 112
435 3300025986 Ga0207658_10871997 Ga0207658_108719972 112
436 3300026035 Ga0207703_10142633 Ga0207703_101426333 112
437 3300026088 Ga0207641_10001740 Ga0207641_100017406 112
438 3300026089 Ga0207648_10651444 Ga0207648_106514441 112
439 3300026089 Ga0207648_11149705 Ga0207648_111497051 112
440 3300026095 Ga0207676_10127551 Ga0207676_101275512 112
441 3300026095 Ga0207676_11784032 Ga0207676_117840322 112
442 3300026118 Ga0207675_100000016 Ga0207675_10000001651 112
443 3300028379 Ga0268266_10000229 Ga0268266_1000022976 112
444 3300028380 Ga0268265_10008681 Ga0268265_100086814 112
445 3300028380 Ga0268265_10151002 Ga0268265_101510023 112
446 3300028381 Ga0268264_10021247 Ga0268264_100212473 112
447 3300028794 Ga0307515_10058326 Ga0307515_100583268 112
448 3300028800 Ga0265338_10077668 Ga0265338_100776684 112
449 3300031730 Ga0307516_10000113 Ga0307516_1000011313 112
450 3300035089 Ga0373944_0016569 Ga0373944_0016569_1403_1768 112
451 3300035118 Ga0373954_0700861 Ga0373954_0700861_144_488 112
452 3300035695 Ga0373927_0000831 Ga0373927_0000831_1439_1804 112
453 3300036401 Ga0373937_0265927 Ga0373937_0265927_991_1335 112
454 3300037068 Ga0373925_0001906 Ga0373925_0001906_4170_4535 112
455 3300039437 Ga0436365_0727276 Ga0436365_0727276_12574_12945 112
456 3300039450 Ga0436363_1383154 Ga0436363_1383154_1884_2255 112
457 3300041410 Ga0439461_0185939 Ga0439461_0185939_161_532 112
458 3300041512 Ga0451853_2872987 Ga0451853_2872987_107_475 112
459 3300042156 Ga0439446_0005037 Ga0439446_0005037_2761_3132 112
460 3300042436 Ga0439435_0108157 Ga0439435_0108157_477_848 112
461 3300042438 Ga0439459_0013483 Ga0439459_0013483_934_1302 112
462 3300046453 Ga0495627_000185 Ga0495627_000185_46624_46971 112
463 3300046460 Ga0495638_0002643 Ga0495638_0002643_10617_10964 112
464 3300046460 Ga0495638_0004335 Ga0495638_0004335_5882_6250 112
465 3300046460 Ga0495638_0006082 Ga0495638_0006082_5834_6202 112
466 3300046460 Ga0495638_0064070 Ga0495638_0064070_1852_2223 112
467 3300046460 Ga0495638_0236568 Ga0495638_0236568_472_819 112
468 3300046460 Ga0495638_0334780 Ga0495638_0334780_210_557 112
469 3300046471 Ga0495650_0000045 Ga0495650_0000045_114259_114630 112
470 3300046501 Ga0495607_0067923 Ga0495607_0067923_414_782 112
471 3300046506 Ga0495583_0000069 Ga0495583_0000069_1477_1848 112
472 3300046513 Ga0495616_0000270 Ga0495616_0000270_23905_24273 112
473 3300046513 Ga0495616_0068098 Ga0495616_0068098_319_690 112
474 3300046515 Ga0495620_0033849 Ga0495620_0033849_1687_2058 112
475 3300046515 Ga0495620_0045054 Ga0495620_0045054_705_1076 112
476 3300046518 Ga0495631_0275052 Ga0495631_0275052_281_649 112
477 3300046519 Ga0495632_0001639 Ga0495632_0001639_11123_11491 112
478 3300046519 Ga0495632_0019948 Ga0495632_0019948_2856_3224 112
479 3300046520 Ga0495637_0007373 Ga0495637_0007373_4400_4771 112
480 3300046522 Ga0495643_0102959 Ga0495643_0102959_81_449 112
481 3300046530 Ga0495654_0000018 Ga0495654_0000018_110269_110640 112
482 3300046538 Ga0495609_0042281 Ga0495609_0042281_620_988 112
483 3300046542 Ga0495597_0305479 Ga0495597_0305479_133_501 112
484 3300046558 Ga0495633_0182165 Ga0495633_0182165_116_469 112
485 3300046616 Ga0495668_0010475 Ga0495668_0010475_3210_3578 112
486 3300046616 Ga0495668_0117517 Ga0495668_0117517_1072_1440 112
487 3300046616 Ga0495668_0192050 Ga0495668_0192050_111_479 112
488 3300046660 Ga0495625_0000011 Ga0495625_0000011_358703_359116 112
489 3300046660 Ga0495625_0038770 Ga0495625_0038770_996_1367 112
490 3300046660 Ga0495625_0229110 Ga0495625_0229110_334_702 112
491 3300046660 Ga0495625_0334343 Ga0495625_0334343_237_608 112
492 3300046692 Ga0495671_0420412 Ga0495671_0420412_241_609 112
493 3300046794 Ga0495589_0011440 Ga0495589_0011440_909_1256 112
494 3300046810 Ga0495660_0003649 Ga0495660_0003649_1374_1742 112
495 3300046810 Ga0495660_0025938 Ga0495660_0025938_84_452 112
496 3300046810 Ga0495660_0098389 Ga0495660_0098389_1008_1355 112
497 3300046810 Ga0495660_0232594 Ga0495660_0232594_424_795 112
498 3300047323 Ga0495683_0227584 Ga0495683_0227584_134_502 112
499 3300047469 Ga0495673_0000056 Ga0495673_0000056_194470_194841 112
500 3300047470 Ga0495681_0215420 Ga0495681_0215420_103_474 112
501 3300047472 Ga0495686_0002660 Ga0495686_0002660_1656_2012 112
502 3300047472 Ga0495686_0036965 Ga0495686_0036965_1066_1413 112
503 3300048903 Ga0496100_0346498 Ga0496100_0346498_507_863 112
504 3300048904 Ga0496101_0261434 Ga0496101_0261434_318_680 112
505 3300048905 Ga0496102_0434616 Ga0496102_0434616_304_666 112
506 3300048906 Ga0496103_0036131 Ga0496103_0036131_1195_1557 112
507 3300048907 Ga0496104_1390902 Ga0496104_1390902_28_390 112
508 3300048909 Ga0496106_0084941 Ga0496106_0084941_90_446 112
509 3300048910 Ga0496107_0000515 Ga0496107_0000515_11037_11393 112
510 3300048916 Ga0496113_0458599 Ga0496113_0458599_481_837 112
511 3300048919 Ga0496116_0033073 Ga0496116_0033073_778_1140 112
512 3300048920 Ga0496117_0132052 Ga0496117_0132052_819_1181 112
513 3300048921 Ga0496118_0244506 Ga0496118_0244506_12_374 112
514 3300048921 Ga0496118_0395755 Ga0496118_0395755_12_374 112
515 3300048922 Ga0496119_0095054 Ga0496119_0095054_245_607 112
516 3300048924 Ga0496121_0003029 Ga0496121_0003029_1767_2129 112
517 3300048924 Ga0496121_0028182 Ga0496121_0028182_3464_3820 112
518 3300048927 Ga0496124_0019388 Ga0496124_0019388_2443_2814 112
519 3300048927 Ga0496124_0222414 Ga0496124_0222414_238_600 112
520 3300048928 Ga0496125_0096118 Ga0496125_0096118_541_897 112
521 3300048929 Ga0496126_0018537 Ga0496126_0018537_3943_4299 112
522 3300048929 Ga0496126_0446393 Ga0496126_0446393_295_651 112
523 3300049459 Ga0495678_103353 Ga0495678_103353_589_957 112
524 3300049580 Ga0501046_1203382 Ga0501046_1203382_50_391 112
525 3300049671 Ga0501238_000513 Ga0501238_000513_1199_1570 112
526 3300049766 Ga0501269_059526 Ga0501269_059526_22_375 112
527 3300050489 nmdc:mga03683_235208_c1 nmdc:mga03683_235208_c1_315_656 112
528 3300050489 nmdc:mga03683_256227_c1 nmdc:mga03683_256227_c1_247_588 112
529 3300050490 nmdc:mga03n38_446052_c1 nmdc:mga03n38_446052_c1_272_613 112
530 3300050493 nmdc:mga0k408_496795_c1 nmdc:mga0k408_496795_c1_146_505 112
531 3300050496 nmdc:mga07m45_59911_c1 nmdc:mga07m45_59911_c1_814_1161 112
532 3300050496 nmdc:mga07m45_94145_c1 nmdc:mga07m45_94145_c1_583_936 112
533 3300050516 nmdc:mga0sz30_3064_c1 nmdc:mga0sz30_3064_c1_449_820 112
534 3300053086 Ga0500578_0634153 Ga0500578_0634153_149_517 112
535 3300053108 Ga0500562_000627 Ga0500562_000627_2853_3221 112
536 3300053119 Ga0500595_028428 Ga0500595_028428_404_745 112
537 3300053122 Ga0500608_000135 Ga0500608_000135_19200_19565 112
538 3300053125 Ga0500618_000178 Ga0500618_000178_23396_23767 112
539 3300053136 Ga0500559_0000031 Ga0500559_0000031_48085_48453 112
540 3300053136 Ga0500559_0000984 Ga0500559_0000984_4465_4836 112
541 3300053142 Ga0500577_0025511 Ga0500577_0025511_654_1001 112
542 3300053153 Ga0500616_0241543 Ga0500616_0241543_320_676 112
543 3300053156 Ga0500622_0005037 Ga0500622_0005037_2739_3092 112
544 3300053156 Ga0500622_0005173 Ga0500622_0005173_4584_4937 112
545 3300053161 Ga0500634_0293018 Ga0500634_0293018_187_534 112
546 3300053727 Ga0500611_013262 Ga0500611_013262_490_837 112
547 3300053730 Ga0500645_002542 Ga0500645_002542_568_939 112
548 3300053731 Ga0500609_002050 Ga0500609_002050_275_643 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

27

79

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9371 1 87
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9244 14 75
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9187 1 95
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9163 18 76
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.916 14 75
ID Description Score Start End Superfamily
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9707 17 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9692 15 75 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9673 15 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9607 18 74 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9572 15 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F3YRF7-F1-model_v4 Transcriptional regulator 0.9976 1 87 GO:0003700
AF-A0A2S2DEE9-F1-model_v4 ArsR family transcriptional regulator 0.9892 1 88 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-I9WSF8-F1-model_v4 deleted 0.9891 1 89
AF-A0A530K0I7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.989 1 84 GO:0003700
AF-A0A530MLQ1-F1-model_v4 deleted 0.9876 1 89

Feature Viewer

pLDDT pTM Quality
91.42 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map