F462258

General Info

Members Datasets Scaffolds Average Seq Length
548 192 1096 159

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0984124|Ga0451577_0984124_84_569
Length 161
Sequence MLILGIDPGTAVTGYGVVRAGSPPVLVECGVIRTKADAPLPKRLHDISEGVRELLARHKPQAMAVESAFYAKNVRTTLVLGHARGVILLAGEELGIEIHEYSPTEIKKAVVGTGAATKTQVQLMVATLLRLKSAPQPNDAADGVATALTCAMRLGSAWRKR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 2.74
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0984124 3300042876 Bacteria 758
2 LJQas_1001624 3300000549 Bacteria 3308
3 JGI24736J21556_1002101 3300001904 Bacteria 3536
4 JGI24741J21665_1008046 3300001915 Bacteria 2008
5 JGI24747J21853_1028860 3300001978 Bacteria 628
6 JGI24740J21852_10003556 3300001979 Bacteria 6823
7 JGI24740J21852_10013426 3300001979 Bacteria 3054
8 JGI24740J21852_10029105 3300001979 Bacteria 1818
9 JGI24740J21852_10056681 3300001979 Bacteria 1097
10 JGI24739J22299_10092056 3300001989 Bacteria 922
11 JGI24737J22298_10000874 3300001990 Bacteria 10754
12 JGI24737J22298_10017097 3300001990 Bacteria 2338
13 JGI24743J22301_10092139 3300001991 Bacteria 647
14 JGI24735J21928_10002664 3300002067 Bacteria 6174
15 JGI24735J21928_10051869 3300002067 Bacteria 1184
16 JGI24738J21930_10087303 3300002075 Bacteria 657
17 JGI24744J21845_10005992 3300002077 Bacteria 2521
18 JGI25165J46597_1000050 3300003214 Bacteria 242776
19 Ga0070658_10019596 3300005327 Bacteria 5416
20 Ga0070658_10019936 3300005327 Bacteria 5372
21 Ga0070658_10076688 3300005327 Bacteria 2741
22 Ga0070658_10082109 3300005327 Bacteria 2648
23 Ga0070658_10524285 3300005327 Bacteria 1024
24 Ga0070658_11132498 3300005327 Bacteria 680
25 Ga0070658_11445224 3300005327 Bacteria 596
26 Ga0070676_10038579 3300005328 Bacteria 2759
27 Ga0070683_100845414 3300005329 Bacteria 878
28 Ga0070683_100852619 3300005329 Bacteria 874
29 Ga0070670_100008941 3300005331 Bacteria 8555
30 Ga0070670_100043864 3300005331 Bacteria 3845
31 Ga0070670_100464785 3300005331 Bacteria 1122
32 Ga0070677_10027316 3300005333 Bacteria 2148
33 Ga0068869_100342190 3300005334 Bacteria 1217
34 Ga0070666_10281047 3300005335 Bacteria 1183
35 Ga0070680_100017570 3300005336 Bacteria 5642
36 Ga0070680_100020354 3300005336 Bacteria 5267
37 Ga0070680_100081354 3300005336 Bacteria 2672
38 Ga0070680_100483510 3300005336 Bacteria 1058
39 Ga0070680_101028836 3300005336 Bacteria 711
40 Ga0070682_100152153 3300005337 Bacteria 1589
41 Ga0070660_100001009 3300005339 Bacteria 18907
42 Ga0070660_100048127 3300005339 Bacteria 3274
43 Ga0070660_100061180 3300005339 Bacteria 2923
44 Ga0070660_100061860 3300005339 Bacteria 2907
45 Ga0070660_100183399 3300005339 Bacteria 1694
46 Ga0070660_100209547 3300005339 Bacteria 1582
47 Ga0070660_100577554 3300005339 Bacteria 939
48 Ga0070660_100634271 3300005339 Bacteria 894
49 Ga0070660_100858681 3300005339 Bacteria 764
50 Ga0070691_10017569 3300005341 Bacteria 3291
51 Ga0070661_100001787 3300005344 Bacteria 14912
52 Ga0070661_100014521 3300005344 Bacteria 5549
53 Ga0070661_100044731 3300005344 Bacteria 3235
54 Ga0070661_100066555 3300005344 Bacteria 2647
55 Ga0070661_100070842 3300005344 Bacteria 2565
56 Ga0070661_100221969 3300005344 Bacteria 1450
57 Ga0070661_100306674 3300005344 Bacteria 1237
58 Ga0070661_100462968 3300005344 Bacteria 1010
59 Ga0070661_100472708 3300005344 Bacteria 1000
60 Ga0070661_100632959 3300005344 Bacteria 867
61 Ga0070692_10008007 3300005345 Bacteria 4689
62 Ga0070692_10196512 3300005345 Bacteria 1179
63 Ga0070669_100337458 3300005353 Bacteria 1220
64 Ga0070675_100310776 3300005354 Bacteria 1391
65 Ga0070671_100003631 3300005355 Bacteria 12078
66 Ga0070671_100004155 3300005355 Bacteria 11437
67 Ga0070671_100422734 3300005355 Bacteria 1141
68 Ga0070671_100763261 3300005355 Bacteria 841
69 Ga0070674_100048190 3300005356 Bacteria 2923
70 Ga0070674_100096255 3300005356 Bacteria 2148
71 Ga0070673_100025353 3300005364 Bacteria 4363
72 Ga0070673_101288627 3300005364 Bacteria 686
73 Ga0070659_100002156 3300005366 Bacteria 14026
74 Ga0070659_100007699 3300005366 Bacteria 7834
75 Ga0070659_100046830 3300005366 Bacteria 3390
76 Ga0070659_100056925 3300005366 Bacteria 3082
77 Ga0070659_100142202 3300005366 Bacteria 1954
78 Ga0070659_100197872 3300005366 Bacteria 1653
79 Ga0070659_100445531 3300005366 Bacteria 1098
80 Ga0070659_100509501 3300005366 Bacteria 1026
81 Ga0070659_100584114 3300005366 Bacteria 959
82 Ga0070714_100269924 3300005435 Bacteria 1577
83 Ga0070714_100450763 3300005435 Bacteria 1222
84 Ga0070713_100011745 3300005436 Bacteria 6394
85 Ga0070663_100072208 3300005455 Bacteria 2513
86 Ga0070663_100346064 3300005455 Bacteria 1202
87 Ga0070663_100536140 3300005455 Bacteria 976
88 Ga0070663_100799714 3300005455 Bacteria 808
89 Ga0070663_100966366 3300005455 Bacteria 739
90 Ga0070678_100010304 3300005456 Bacteria 5702
91 Ga0070662_100003781 3300005457 Bacteria 9469
92 Ga0070662_100019488 3300005457 Bacteria 4605
93 Ga0070662_100076759 3300005457 Bacteria 2477
94 Ga0070662_100098400 3300005457 Bacteria 2209
95 Ga0070662_100113711 3300005457 Bacteria 2066
96 Ga0070662_100237497 3300005457 Bacteria 1460
97 Ga0070681_10051728 3300005458 Bacteria 4097
98 Ga0070681_10491146 3300005458 Bacteria 1141
99 Ga0070681_10528645 3300005458 Bacteria 1093
100 Ga0070681_10688570 3300005458 Bacteria 938
101 Ga0070681_10877069 3300005458 Bacteria 815
102 Ga0068867_100518779 3300005459 Bacteria 1027
103 Ga0068867_100898747 3300005459 Bacteria 797
104 Ga0070679_100009426 3300005530 Bacteria 9233
105 Ga0070679_100300643 3300005530 Bacteria 1555
106 Ga0070679_100348640 3300005530 Bacteria 1428
107 Ga0070679_100457159 3300005530 Bacteria 1221
108 Ga0070684_100067229 3300005535 Bacteria 3147
109 Ga0070684_100148454 3300005535 Bacteria 2123
110 Ga0070684_100410153 3300005535 Bacteria 1250
111 Ga0068853_100044910 3300005539 Bacteria 3783
112 Ga0068853_100165157 3300005539 Bacteria 2000
113 Ga0068853_100273836 3300005539 Bacteria 1555
114 Ga0068853_100314794 3300005539 Bacteria 1450
115 Ga0068853_100621988 3300005539 Bacteria 1026
116 Ga0068853_101621639 3300005539 Bacteria 627
117 Ga0070672_100048499 3300005543 Bacteria 3300
118 Ga0070672_100403122 3300005543 Bacteria 1172
119 Ga0070672_100991762 3300005543 Bacteria 744
120 Ga0070696_101045915 3300005546 Bacteria 684
121 Ga0070693_100018738 3300005547 Bacteria 3620
122 Ga0070693_100137534 3300005547 Bacteria 1534
123 Ga0070693_100508518 3300005547 Bacteria 856
124 Ga0070693_100955636 3300005547 Bacteria 645
125 Ga0070665_100244827 3300005548 Bacteria 1794
126 Ga0070665_101066159 3300005548 Bacteria 820
127 Ga0068855_100020273 3300005563 Bacteria 7979
128 Ga0068855_100119612 3300005563 Bacteria 3016
129 Ga0068855_100341981 3300005563 Bacteria 1649
130 Ga0068855_100501094 3300005563 Bacteria 1319
131 Ga0068855_100556600 3300005563 Bacteria 1241
132 Ga0070664_100007255 3300005564 Bacteria 8935
133 Ga0070664_100014790 3300005564 Bacteria 6372
134 Ga0070664_100015505 3300005564 Bacteria 6235
135 Ga0070664_100197783 3300005564 Bacteria 1793
136 Ga0070664_100650749 3300005564 Bacteria 979
137 Ga0068857_100033734 3300005577 Bacteria 4527
138 Ga0068857_100195613 3300005577 Bacteria 1842
139 Ga0068857_100327471 3300005577 Bacteria 1415
140 Ga0068857_100480300 3300005577 Bacteria 1164
141 Ga0068854_100013020 3300005578 Bacteria 5451
142 Ga0068854_100033181 3300005578 Bacteria 3598
143 Ga0068854_100494688 3300005578 Bacteria 1029
144 Ga0068854_100753983 3300005578 Bacteria 845
145 Ga0068856_100068142 3300005614 Bacteria 3517
146 Ga0068856_100251862 3300005614 Bacteria 1781
147 Ga0068856_101052331 3300005614 Bacteria 832
148 Ga0068856_101744281 3300005614 Bacteria 635
149 Ga0068852_100003104 3300005616 Bacteria 11562
150 Ga0068852_100096431 3300005616 Bacteria 2658
151 Ga0068852_100529032 3300005616 Bacteria 1177
152 Ga0068864_100001952 3300005618 Bacteria 16953
153 Ga0068864_100594157 3300005618 Bacteria 1074
154 Ga0068864_100664408 3300005618 Bacteria 1016
155 Ga0068851_10096872 3300005834 Bacteria 1560
156 Ga0068863_100009582 3300005841 Bacteria 9447
157 Ga0068863_100202139 3300005841 Bacteria 1911
158 Ga0068863_100324188 3300005841 Bacteria 1497
159 Ga0068860_100035520 3300005843 Bacteria 4780
160 Ga0068862_100410545 3300005844 Bacteria 1268
161 Ga0068862_100616465 3300005844 Bacteria 1043
162 Ga0070717_10005953 3300006028 Bacteria 8929
163 Ga0070716_100155471 3300006173 Bacteria 1476
164 Ga0070712_100250840 3300006175 Bacteria 1414
165 Ga0097621_100426748 3300006237 Bacteria 1191
166 Ga0068871_100575575 3300006358 Bacteria 1022
167 Ga0068871_100685599 3300006358 Bacteria 938
168 Ga0075434_100519717 3300006871 Bacteria 1211
169 Ga0068865_100130720 3300006881 Bacteria 1881
170 Ga0075435_100215364 3300007076 Bacteria 1630
171 Ga0105240_10057927 3300009093 Bacteria 4837
172 Ga0105240_10863170 3300009093 Bacteria 976
173 Ga0105245_10366704 3300009098 Bacteria 1431
174 Ga0105243_10217771 3300009148 Bacteria 1685
175 Ga0105243_10437512 3300009148 Bacteria 1224
176 Ga0105241_10073364 3300009174 Bacteria 2662
177 Ga0105242_10866255 3300009176 Bacteria 900
178 Ga0105248_10002500 3300009177 Bacteria 20447
179 Ga0105248_10281560 3300009177 Bacteria 1872
180 Ga0105248_10332016 3300009177 Bacteria 1712
181 Ga0105248_11833718 3300009177 Bacteria 688
182 Ga0105248_12415788 3300009177 Bacteria 599
183 Ga0105237_10072482 3300009545 Bacteria 3438
184 Ga0105237_10987811 3300009545 Bacteria 849
185 Ga0105238_10023625 3300009551 Bacteria 6264
186 Ga0105238_10040487 3300009551 Bacteria 4721
187 Ga0105238_10595777 3300009551 Bacteria 1113
188 Ga0105249_10006569 3300009553 Bacteria 10120
189 Ga0105239_10914860 3300010375 Bacteria 1007
190 Ga0157373_10007653 3300013100 Bacteria 8027
191 Ga0157373_10014009 3300013100 Bacteria 5879
192 Ga0157373_10051252 3300013100 Bacteria 2940
193 Ga0157373_10103451 3300013100 Bacteria 2003
194 Ga0157373_10844334 3300013100 Bacteria 677
195 Ga0157371_10164502 3300013102 Bacteria 1584
196 Ga0157371_10346108 3300013102 Bacteria 1082
197 Ga0157371_10466951 3300013102 Bacteria 929
198 Ga0157371_10674599 3300013102 Bacteria 773
199 Ga0157371_10968472 3300013102 Bacteria 648
200 Ga0157370_10000497 3300013104 Bacteria 48916
201 Ga0157370_10012142 3300013104 Bacteria 8958
202 Ga0157370_10049374 3300013104 Bacteria 4027
203 Ga0157370_10340171 3300013104 Bacteria 1383
204 Ga0157370_10435109 3300013104 Bacteria 1206
205 Ga0157370_10462687 3300013104 Bacteria 1166
206 Ga0157369_10018009 3300013105 Bacteria 7925
207 Ga0157369_10021058 3300013105 Bacteria 7289
208 Ga0157369_10160897 3300013105 Bacteria 2370
209 Ga0157369_10267188 3300013105 Bacteria 1783
210 Ga0157369_10294688 3300013105 Bacteria 1688
211 Ga0157369_10430932 3300013105 Bacteria 1367
212 Ga0157369_11506834 3300013105 Bacteria 684
213 Ga0157378_10121689 3300013297 Bacteria 2406
214 Ga0163162_10277810 3300013306 Bacteria 1807
215 Ga0157372_10015905 3300013307 Bacteria 8072
216 Ga0157372_10038421 3300013307 Bacteria 5282
217 Ga0157372_10448093 3300013307 Bacteria 1504
218 Ga0157372_11417804 3300013307 Bacteria 801
219 Ga0157375_11579545 3300013308 Bacteria 775
220 Ga0182008_10206865 3300014497 Bacteria 1000
221 Ga0157379_10307890 3300014968 Bacteria 1445
222 Ga0206356_10214783 3300020070 Bacteria 668
223 Ga0206354_11294995 3300020081 Bacteria 873
224 Ga0206353_10022973 3300020082 Bacteria 1437
225 Ga0206353_11262925 3300020082 Bacteria 2397
226 Ga0207427_102784 3300025231 Bacteria 4287
227 Ga0209233_1000041 3300025261 Bacteria 515463
228 Ga0207656_10046381 3300025321 Bacteria 1864
229 Ga0207682_10005437 3300025893 Bacteria 5182
230 Ga0207680_10266822 3300025903 Bacteria 1186
231 Ga0207647_10002661 3300025904 Bacteria 13485
232 Ga0207647_10008935 3300025904 Bacteria 7144
233 Ga0207647_10019515 3300025904 Bacteria 4558
234 Ga0207647_10036469 3300025904 Bacteria 3124
235 Ga0207647_10085209 3300025904 Bacteria 1890
236 Ga0207647_10211858 3300025904 Bacteria 1119
237 Ga0207645_10502134 3300025907 Bacteria 821
238 Ga0207705_10000123 3300025909 Bacteria 85382
239 Ga0207705_10002265 3300025909 Bacteria 14887
240 Ga0207705_10038945 3300025909 Bacteria 3406
241 Ga0207705_10059412 3300025909 Bacteria 2759
242 Ga0207705_10066188 3300025909 Bacteria 2613
243 Ga0207705_10083906 3300025909 Bacteria 2325
244 Ga0207705_10094727 3300025909 Bacteria 2190
245 Ga0207705_10209273 3300025909 Bacteria 1479
246 Ga0207705_10257540 3300025909 Bacteria 1332
247 Ga0207705_10774124 3300025909 Bacteria 745
248 Ga0207654_10225518 3300025911 Bacteria 1245
249 Ga0207707_10192844 3300025912 Bacteria 1777
250 Ga0207707_10382750 3300025912 Bacteria 1209
251 Ga0207707_10624082 3300025912 Bacteria 910
252 Ga0207695_10017796 3300025913 Bacteria 8245
253 Ga0207671_10616145 3300025914 Bacteria 865
254 Ga0207693_10105192 3300025915 Bacteria 2213
255 Ga0207660_10004525 3300025917 Bacteria 9063
256 Ga0207660_10014836 3300025917 Bacteria 5134
257 Ga0207660_10055421 3300025917 Bacteria 2833
258 Ga0207660_10100362 3300025917 Bacteria 2161
259 Ga0207660_10477253 3300025917 Bacteria 1010
260 Ga0207657_10000650 3300025919 Bacteria 36973
261 Ga0207657_10010310 3300025919 Bacteria 9330
262 Ga0207657_10030402 3300025919 Bacteria 4902
263 Ga0207657_10049395 3300025919 Bacteria 3666
264 Ga0207657_10053001 3300025919 Bacteria 3517
265 Ga0207657_10119531 3300025919 Bacteria 2168
266 Ga0207657_10430294 3300025919 Bacteria 1037
267 Ga0207657_10596357 3300025919 Bacteria 862
268 Ga0207649_10008523 3300025920 Bacteria 5592
269 Ga0207649_10013628 3300025920 Bacteria 4543
270 Ga0207649_10025896 3300025920 Bacteria 3426
271 Ga0207649_10033848 3300025920 Bacteria 3057
272 Ga0207649_10115811 3300025920 Bacteria 1799
273 Ga0207649_10120782 3300025920 Bacteria 1766
274 Ga0207649_10239563 3300025920 Bacteria 1301
275 Ga0207649_10403802 3300025920 Bacteria 1023
276 Ga0207649_10415082 3300025920 Bacteria 1010
277 Ga0207649_10635354 3300025920 Bacteria 824
278 Ga0207649_10718120 3300025920 Bacteria 776
279 Ga0207652_10000034 3300025921 Bacteria 138571
280 Ga0207652_10609922 3300025921 Bacteria 978
281 Ga0207681_10041976 3300025923 Bacteria 3052
282 Ga0207694_10038156 3300025924 Bacteria 3693
283 Ga0207694_10125884 3300025924 Bacteria 2050
284 Ga0207650_10128250 3300025925 Bacteria 1982
285 Ga0207650_10152402 3300025925 Bacteria 1825
286 Ga0207659_10275984 3300025926 Bacteria 1373
287 Ga0207700_10212244 3300025928 Bacteria 1637
288 Ga0207664_10065890 3300025929 Bacteria 2901
289 Ga0207664_10873966 3300025929 Bacteria 808
290 Ga0207644_10000773 3300025931 Bacteria 20259
291 Ga0207644_10000998 3300025931 Bacteria 18072
292 Ga0207644_10050973 3300025931 Bacteria 2968
293 Ga0207644_10639068 3300025931 Bacteria 885
294 Ga0207690_10006767 3300025932 Bacteria 6795
295 Ga0207690_10006964 3300025932 Bacteria 6702
296 Ga0207690_10008817 3300025932 Bacteria 5986
297 Ga0207690_10082598 3300025932 Bacteria 2247
298 Ga0207690_10087037 3300025932 Bacteria 2197
299 Ga0207690_10273614 3300025932 Bacteria 1313
300 Ga0207690_10421921 3300025932 Bacteria 1067
301 Ga0207690_10445248 3300025932 Bacteria 1040
302 Ga0207690_10498554 3300025932 Bacteria 985
303 Ga0207706_10005402 3300025933 Bacteria 11912
304 Ga0207706_10018403 3300025933 Bacteria 6286
305 Ga0207706_10051967 3300025933 Bacteria 3618
306 Ga0207706_10060026 3300025933 Bacteria 3349
307 Ga0207706_10139216 3300025933 Bacteria 2135
308 Ga0207706_10237917 3300025933 Bacteria 1592
309 Ga0207686_10208722 3300025934 Bacteria 1403
310 Ga0207709_10069272 3300025935 Bacteria 2232
311 Ga0207669_10033361 3300025937 Bacteria 2904
312 Ga0207669_10079150 3300025937 Bacteria 2097
313 Ga0207704_10102920 3300025938 Bacteria 1909
314 Ga0207691_10058855 3300025940 Bacteria 3495
315 Ga0207691_10179335 3300025940 Bacteria 1851
316 Ga0207691_10565549 3300025940 Bacteria 964
317 Ga0207711_10005331 3300025941 Bacteria 10903
318 Ga0207711_10083381 3300025941 Bacteria 2796
319 Ga0207689_10511870 3300025942 Bacteria 1006
320 Ga0207661_10006817 3300025944 Bacteria 8095
321 Ga0207661_10078573 3300025944 Bacteria 2717
322 Ga0207661_10538239 3300025944 Bacteria 1069
323 Ga0207661_10897903 3300025944 Bacteria 816
324 Ga0207679_10002299 3300025945 Bacteria 11779
325 Ga0207679_10038485 3300025945 Bacteria 3407
326 Ga0207679_10041710 3300025945 Bacteria 3293
327 Ga0207679_10171643 3300025945 Bacteria 1786
328 Ga0207679_10531869 3300025945 Bacteria 1053
329 Ga0207679_10935071 3300025945 Bacteria 794
330 Ga0207667_10013832 3300025949 Bacteria 9220
331 Ga0207667_10144475 3300025949 Bacteria 2449
332 Ga0207667_10214857 3300025949 Bacteria 1971
333 Ga0207667_10231645 3300025949 Bacteria 1891
334 Ga0207667_10274259 3300025949 Bacteria 1724
335 Ga0207667_10607427 3300025949 Bacteria 1102
336 Ga0207667_10636331 3300025949 Bacteria 1073
337 Ga0207651_10068421 3300025960 Bacteria 2503
338 Ga0207651_10946801 3300025960 Bacteria 768
339 Ga0207712_10002789 3300025961 Bacteria 11176
340 Ga0207712_11185428 3300025961 Bacteria 681
341 Ga0207668_10975302 3300025972 Bacteria 757
342 Ga0207640_10033130 3300025981 Bacteria 3211
343 Ga0207640_10306852 3300025981 Bacteria 1258
344 Ga0207640_10454519 3300025981 Bacteria 1056
345 Ga0207640_10526050 3300025981 Bacteria 989
346 Ga0207658_10541541 3300025986 Bacteria 1041
347 Ga0207677_10065855 3300026023 Bacteria 2530
348 Ga0207677_10339707 3300026023 Bacteria 1254
349 Ga0207639_10066529 3300026041 Bacteria 2801
350 Ga0207639_10328017 3300026041 Bacteria 1361
351 Ga0207639_10347805 3300026041 Bacteria 1323
352 Ga0207639_10423394 3300026041 Bacteria 1204
353 Ga0207639_10626602 3300026041 Bacteria 993
354 Ga0207639_11444987 3300026041 Bacteria 645
355 Ga0207678_10003759 3300026067 Bacteria 13651
356 Ga0207678_10016793 3300026067 Bacteria 6429
357 Ga0207678_10104051 3300026067 Bacteria 2423
358 Ga0207678_10116960 3300026067 Bacteria 2275
359 Ga0207678_10141621 3300026067 Bacteria 2052
360 Ga0207678_10553152 3300026067 Bacteria 1006
361 Ga0207678_10789319 3300026067 Bacteria 838
362 Ga0207702_10012422 3300026078 Bacteria 7089
363 Ga0207702_10060858 3300026078 Bacteria 3219
364 Ga0207702_10136554 3300026078 Bacteria 2213
365 Ga0207702_10351546 3300026078 Bacteria 1410
366 Ga0207641_10017664 3300026088 Bacteria 5842
367 Ga0207641_10076257 3300026088 Bacteria 2898
368 Ga0207641_10108664 3300026088 Bacteria 2455
369 Ga0207641_10462632 3300026088 Bacteria 1227
370 Ga0207648_10049684 3300026089 Bacteria 3669
371 Ga0207676_10020773 3300026095 Bacteria 4808
372 Ga0207676_10079170 3300026095 Bacteria 2664
373 Ga0207676_10215385 3300026095 Bacteria 1707
374 Ga0207676_11117347 3300026095 Bacteria 779
375 Ga0207674_10003695 3300026116 Bacteria 18679
376 Ga0207674_10009571 3300026116 Bacteria 11056
377 Ga0207674_10048049 3300026116 Bacteria 4371
378 Ga0207674_10062245 3300026116 Bacteria 3769
379 Ga0207674_10160936 3300026116 Bacteria 2199
380 Ga0207674_10687274 3300026116 Bacteria 988
381 Ga0207675_100423712 3300026118 Bacteria 1315
382 Ga0207683_10002289 3300026121 Bacteria 16796
383 Ga0207698_10000463 3300026142 Bacteria 23569
384 Ga0207698_10010001 3300026142 Bacteria 6073
385 Ga0207698_10085376 3300026142 Bacteria 2563
386 Ga0207698_10423265 3300026142 Bacteria 1278
387 Ga0207698_11158771 3300026142 Bacteria 787
388 Ga0268265_10168013 3300028380 Bacteria 1871
389 Ga0268264_10007102 3300028381 Bacteria 9385
390 Ga0307408_101216506 3300031548 Bacteria 703
391 Ga0307405_10312376 3300031731 Bacteria 1197
392 Ga0307413_10234983 3300031824 Bacteria 1349
393 Ga0307410_10042493 3300031852 Bacteria 3005
394 Ga0307410_10063762 3300031852 Bacteria 2529
395 Ga0307407_10269260 3300031903 Bacteria 1175
396 Ga0307409_100006588 3300031995 Bacteria 6847
397 Ga0307416_100479422 3300032002 Bacteria 1304
398 Ga0307414_10889051 3300032004 Bacteria 816
399 Ga0307411_10041689 3300032005 Bacteria 2923
400 Ga0373935_0015144 3300035692 Bacteria 4659
401 Ga0395899_0001745 3300037312 Bacteria 18084
402 Ga0395899_0033023 3300037312 Bacteria 3888
403 Ga0395899_0034703 3300037312 Bacteria 3788
404 Ga0395899_0069146 3300037312 Bacteria 2587
405 Ga0395899_0124996 3300037312 Bacteria 1840
406 Ga0395899_0131492 3300037312 Bacteria 1786
407 Ga0395899_0171225 3300037312 Bacteria 1529
408 Ga0395899_0300570 3300037312 Bacteria 1086
409 Ga0395899_0381842 3300037312 Bacteria 936
410 Ga0395900_0001256 3300037418 Bacteria 31067
411 Ga0395900_0004511 3300037418 Bacteria 14732
412 Ga0395900_0012634 3300037418 Bacteria 8634
413 Ga0395900_0040505 3300037418 Bacteria 4801
414 Ga0395900_0050462 3300037418 Bacteria 4285
415 Ga0395900_0105257 3300037418 Bacteria 2898
416 Ga0395900_0145528 3300037418 Bacteria 2423
417 Ga0395900_0227738 3300037418 Bacteria 1876
418 Ga0395900_0258639 3300037418 Bacteria 1739
419 Ga0395900_0362543 3300037418 Bacteria 1420
420 Ga0395900_0374242 3300037418 Bacteria 1393
421 Ga0395900_0475641 3300037418 Bacteria 1202
422 Ga0395900_0642106 3300037418 Bacteria 999
423 Ga0395900_0900035 3300037418 Bacteria 808
424 Ga0395900_0918889 3300037418 Bacteria 798
425 Ga0395900_1075582 3300037418 Bacteria 722
426 Ga0395900_1523437 3300037418 Bacteria 580
427 Ga0395898_0026010 3300037466 Bacteria 5893
428 Ga0395898_0040220 3300037466 Bacteria 4625
429 Ga0395898_0041227 3300037466 Bacteria 4561
430 Ga0395898_0090513 3300037466 Bacteria 2944
431 Ga0395898_0091108 3300037466 Bacteria 2933
432 Ga0395898_0147758 3300037466 Bacteria 2249
433 Ga0395898_0424593 3300037466 Bacteria 1267
434 Ga0395898_0489018 3300037466 Bacteria 1171
435 Ga0395898_1047411 3300037466 Bacteria 750
436 Ga0395898_1062407 3300037466 Bacteria 744
437 Ga0395898_1223359 3300037466 Bacteria 682
438 Ga0395905_0000610 3300037471 Bacteria 47892
439 Ga0395905_0001942 3300037471 Bacteria 23697
440 Ga0395905_0002770 3300037471 Bacteria 19205
441 Ga0395905_0004357 3300037471 Bacteria 14736
442 Ga0395905_0005968 3300037471 Bacteria 12337
443 Ga0395905_0022733 3300037471 Bacteria 5929
444 Ga0395905_0026660 3300037471 Bacteria 5449
445 Ga0395905_0029060 3300037471 Bacteria 5209
446 Ga0395905_0032161 3300037471 Bacteria 4935
447 Ga0395905_0042669 3300037471 Bacteria 4255
448 Ga0395905_0046707 3300037471 Bacteria 4060
449 Ga0395905_0070170 3300037471 Bacteria 3283
450 Ga0395905_0098731 3300037471 Bacteria 2742
451 Ga0395905_0142606 3300037471 Bacteria 2253
452 Ga0395905_0143888 3300037471 Bacteria 2243
453 Ga0395905_0204784 3300037471 Bacteria 1849
454 Ga0395905_0242986 3300037471 Bacteria 1682
455 Ga0395905_0327416 3300037471 Bacteria 1422
456 Ga0395905_0356598 3300037471 Bacteria 1355
457 Ga0395905_0363551 3300037471 Bacteria 1340
458 Ga0395905_0422864 3300037471 Bacteria 1229
459 Ga0395905_0555770 3300037471 Bacteria 1049
460 Ga0395905_0722560 3300037471 Bacteria 898
461 Ga0395901_0006859 3300038443 Bacteria 11503
462 Ga0395901_0020377 3300038443 Bacteria 6788
463 Ga0395901_0026624 3300038443 Bacteria 5939
464 Ga0395901_0075285 3300038443 Bacteria 3521
465 Ga0395901_0133263 3300038443 Bacteria 2611
466 Ga0395901_0150959 3300038443 Bacteria 2441
467 Ga0395901_0162468 3300038443 Bacteria 2345
468 Ga0395901_0169083 3300038443 Bacteria 2294
469 Ga0395901_0208651 3300038443 Bacteria 2045
470 Ga0395901_0214671 3300038443 Bacteria 2012
471 Ga0395901_0397779 3300038443 Bacteria 1416
472 Ga0395901_0408547 3300038443 Bacteria 1394
473 Ga0395901_0431098 3300038443 Bacteria 1351
474 Ga0395901_0656559 3300038443 Bacteria 1051
475 Ga0395901_1177546 3300038443 Bacteria 733
476 Ga0395901_1912675 3300038443 Bacteria 541
477 Ga0439448_0153526 3300042005 Bacteria 799
478 Ga0439458_0000012 3300042157 Bacteria 27891
479 Ga0451577_0370867 3300042876 Unclassified 1299
480 Ga0466969_0024800 3300044656 Bacteria 3084
481 Ga0466972_0014762 3300044658 Bacteria 3909
482 Ga0466972_0098261 3300044658 Bacteria 1386
483 Ga0466965_0262739 3300044683 Bacteria 928
484 Ga0466966_0010189 3300044684 Bacteria 6235
485 Ga0466966_0177207 3300044684 Bacteria 1294
486 Ga0466966_0184683 3300044684 Bacteria 1264
487 Ga0466966_0239105 3300044684 Bacteria 1095
488 Ga0466966_0373447 3300044684 Bacteria 857
489 Ga0466961_0074874 3300044693 Bacteria 2147
490 Ga0466961_0119763 3300044693 Bacteria 1653
491 Ga0466963_0014561 3300044694 Bacteria 4853
492 Ga0466963_0020356 3300044694 Bacteria 4171
493 Ga0466963_0066016 3300044694 Bacteria 2426
494 Ga0466963_0178863 3300044694 Bacteria 1480
495 Ga0466963_0257824 3300044694 Bacteria 1224
496 Ga0466964_0029034 3300044706 Bacteria 2181
497 Ga0466964_0069984 3300044706 Bacteria 1481
498 Ga0466971_0048628 3300044719 Bacteria 1907
499 Ga0466971_0186845 3300044719 Bacteria 975
500 Ga0466971_0658780 3300044719 Bacteria 525
501 Ga0466968_0030399 3300044735 Bacteria 2237
502 Ga0466970_0047620 3300044765 Bacteria 2285
503 Ga0466957_0015905 3300044842 Bacteria 4397
504 Ga0466957_0139292 3300044842 Bacteria 1562
505 Ga0466957_0251721 3300044842 Bacteria 1175
506 Ga0466957_0293759 3300044842 Bacteria 1090
507 Ga0466960_0024814 3300044901 Bacteria 2708
508 Ga0466959_0189133 3300045049 Bacteria 1437
509 Ga0466959_0234096 3300045049 Bacteria 1270
510 Ga0466959_0317240 3300045049 Bacteria 1066
511 Ga0466958_0006397 3300045836 Bacteria 6406
512 Ga0466967_0004902 3300045976 Bacteria 9144
513 Ga0466967_0016275 3300045976 Bacteria 5858
514 Ga0466967_0017945 3300045976 Bacteria 5639
515 Ga0466967_0030324 3300045976 Bacteria 4537
516 Ga0466967_0213036 3300045976 Bacteria 1833
517 Ga0466967_0302008 3300045976 Bacteria 1540
518 Ga0466967_0400133 3300045976 Bacteria 1336
519 Ga0495605_0366825 3300046474 Bacteria 602
520 Ga0495584_0298676 3300046491 Bacteria 818
521 Ga0495642_0194859 3300046528 Bacteria 883
522 Ga0495668_0008461 3300046616 Bacteria 6420
523 Ga0495668_0551324 3300046616 Bacteria 636
524 Ga0495669_0000276 3300046684 Bacteria 29327
525 Ga0495669_0271386 3300046684 Bacteria 815
526 Ga0495677_0051099 3300047445 Bacteria 1522
527 Ga0495677_0277968 3300047445 Bacteria 657
528 Ga0496103_0106258 3300048906 Bacteria 1780
529 Ga0496103_0164204 3300048906 Bacteria 1425
530 Ga0496103_0584407 3300048906 Bacteria 712
531 Ga0496106_0812194 3300048909 Bacteria 741
532 Ga0496107_0483325 3300048910 Bacteria 919
533 Ga0496109_0339981 3300048912 Bacteria 1417
534 Ga0496110_0049283 3300048913 Bacteria 3694
535 Ga0496110_0076299 3300048913 Bacteria 2980
536 Ga0496110_0334429 3300048913 Bacteria 1380
537 Ga0496111_0032925 3300048914 Bacteria 3696
538 Ga0496111_0318374 3300048914 Bacteria 1152
539 Ga0496112_0006596 3300048915 Bacteria 10213
540 Ga0496112_0029392 3300048915 Bacteria 5315
541 Ga0496113_0128899 3300048916 Bacteria 1983
542 Ga0496113_0230245 3300048916 Bacteria 1478
543 Ga0501067_0030126 3300049583 Bacteria 3009
544 Ga0501069_0312486 3300049585 Bacteria 922
545 nmdc:mga0a205_40805_c1 3300050515 Bacteria 4469
546 Ga0466962_0047488 3300061719 Bacteria 2052
547 Ga0466962_0062447 3300061719 Bacteria 1779
548 Ga0466962_0202447 3300061719 Bacteria 970
549 Ga0451577_0984124
550 LJQas_1001624
551 JGI24736J21556_1002101
552 JGI24741J21665_1008046
553 JGI24747J21853_1028860
554 JGI24740J21852_10003556
555 JGI24740J21852_10013426
556 JGI24740J21852_10029105
557 JGI24740J21852_10056681
558 JGI24739J22299_10092056
559 JGI24737J22298_10000874
560 JGI24737J22298_10017097
561 JGI24743J22301_10092139
562 JGI24735J21928_10002664
563 JGI24735J21928_10051869
564 JGI24738J21930_10087303
565 JGI24744J21845_10005992
566 JGI25165J46597_1000050
567 Ga0070658_10019596
568 Ga0070658_10019936
569 Ga0070658_10076688
570 Ga0070658_10082109
571 Ga0070658_10524285
572 Ga0070658_11132498
573 Ga0070658_11445224
574 Ga0070676_10038579
575 Ga0070683_100845414
576 Ga0070683_100852619
577 Ga0070670_100008941
578 Ga0070670_100043864
579 Ga0070670_100464785
580 Ga0070677_10027316
581 Ga0068869_100342190
582 Ga0070666_10281047
583 Ga0070680_100017570
584 Ga0070680_100020354
585 Ga0070680_100081354
586 Ga0070680_100483510
587 Ga0070680_101028836
588 Ga0070682_100152153
589 Ga0070660_100001009
590 Ga0070660_100048127
591 Ga0070660_100061180
592 Ga0070660_100061860
593 Ga0070660_100183399
594 Ga0070660_100209547
595 Ga0070660_100577554
596 Ga0070660_100634271
597 Ga0070660_100858681
598 Ga0070691_10017569
599 Ga0070661_100001787
600 Ga0070661_100014521
601 Ga0070661_100044731
602 Ga0070661_100066555
603 Ga0070661_100070842
604 Ga0070661_100221969
605 Ga0070661_100306674
606 Ga0070661_100462968
607 Ga0070661_100472708
608 Ga0070661_100632959
609 Ga0070692_10008007
610 Ga0070692_10196512
611 Ga0070669_100337458
612 Ga0070675_100310776
613 Ga0070671_100003631
614 Ga0070671_100004155
615 Ga0070671_100422734
616 Ga0070671_100763261
617 Ga0070674_100048190
618 Ga0070674_100096255
619 Ga0070673_100025353
620 Ga0070673_101288627
621 Ga0070659_100002156
622 Ga0070659_100007699
623 Ga0070659_100046830
624 Ga0070659_100056925
625 Ga0070659_100142202
626 Ga0070659_100197872
627 Ga0070659_100445531
628 Ga0070659_100509501
629 Ga0070659_100584114
630 Ga0070714_100269924
631 Ga0070714_100450763
632 Ga0070713_100011745
633 Ga0070663_100072208
634 Ga0070663_100346064
635 Ga0070663_100536140
636 Ga0070663_100799714
637 Ga0070663_100966366
638 Ga0070678_100010304
639 Ga0070662_100003781
640 Ga0070662_100019488
641 Ga0070662_100076759
642 Ga0070662_100098400
643 Ga0070662_100113711
644 Ga0070662_100237497
645 Ga0070681_10051728
646 Ga0070681_10491146
647 Ga0070681_10528645
648 Ga0070681_10688570
649 Ga0070681_10877069
650 Ga0068867_100518779
651 Ga0068867_100898747
652 Ga0070679_100009426
653 Ga0070679_100300643
654 Ga0070679_100348640
655 Ga0070679_100457159
656 Ga0070684_100067229
657 Ga0070684_100148454
658 Ga0070684_100410153
659 Ga0068853_100044910
660 Ga0068853_100165157
661 Ga0068853_100273836
662 Ga0068853_100314794
663 Ga0068853_100621988
664 Ga0068853_101621639
665 Ga0070672_100048499
666 Ga0070672_100403122
667 Ga0070672_100991762
668 Ga0070696_101045915
669 Ga0070693_100018738
670 Ga0070693_100137534
671 Ga0070693_100508518
672 Ga0070693_100955636
673 Ga0070665_100244827
674 Ga0070665_101066159
675 Ga0068855_100020273
676 Ga0068855_100119612
677 Ga0068855_100341981
678 Ga0068855_100501094
679 Ga0068855_100556600
680 Ga0070664_100007255
681 Ga0070664_100014790
682 Ga0070664_100015505
683 Ga0070664_100197783
684 Ga0070664_100650749
685 Ga0068857_100033734
686 Ga0068857_100195613
687 Ga0068857_100327471
688 Ga0068857_100480300
689 Ga0068854_100013020
690 Ga0068854_100033181
691 Ga0068854_100494688
692 Ga0068854_100753983
693 Ga0068856_100068142
694 Ga0068856_100251862
695 Ga0068856_101052331
696 Ga0068856_101744281
697 Ga0068852_100003104
698 Ga0068852_100096431
699 Ga0068852_100529032
700 Ga0068864_100001952
701 Ga0068864_100594157
702 Ga0068864_100664408
703 Ga0068851_10096872
704 Ga0068863_100009582
705 Ga0068863_100202139
706 Ga0068863_100324188
707 Ga0068860_100035520
708 Ga0068862_100410545
709 Ga0068862_100616465
710 Ga0070717_10005953
711 Ga0070716_100155471
712 Ga0070712_100250840
713 Ga0097621_100426748
714 Ga0068871_100575575
715 Ga0068871_100685599
716 Ga0075434_100519717
717 Ga0068865_100130720
718 Ga0075435_100215364
719 Ga0105240_10057927
720 Ga0105240_10863170
721 Ga0105245_10366704
722 Ga0105243_10217771
723 Ga0105243_10437512
724 Ga0105241_10073364
725 Ga0105242_10866255
726 Ga0105248_10002500
727 Ga0105248_10281560
728 Ga0105248_10332016
729 Ga0105248_11833718
730 Ga0105248_12415788
731 Ga0105237_10072482
732 Ga0105237_10987811
733 Ga0105238_10023625
734 Ga0105238_10040487
735 Ga0105238_10595777
736 Ga0105249_10006569
737 Ga0105239_10914860
738 Ga0157373_10007653
739 Ga0157373_10014009
740 Ga0157373_10051252
741 Ga0157373_10103451
742 Ga0157373_10844334
743 Ga0157371_10164502
744 Ga0157371_10346108
745 Ga0157371_10466951
746 Ga0157371_10674599
747 Ga0157371_10968472
748 Ga0157370_10000497
749 Ga0157370_10012142
750 Ga0157370_10049374
751 Ga0157370_10340171
752 Ga0157370_10435109
753 Ga0157370_10462687
754 Ga0157369_10018009
755 Ga0157369_10021058
756 Ga0157369_10160897
757 Ga0157369_10267188
758 Ga0157369_10294688
759 Ga0157369_10430932
760 Ga0157369_11506834
761 Ga0157378_10121689
762 Ga0163162_10277810
763 Ga0157372_10015905
764 Ga0157372_10038421
765 Ga0157372_10448093
766 Ga0157372_11417804
767 Ga0157375_11579545
768 Ga0182008_10206865
769 Ga0157379_10307890
770 Ga0206356_10214783
771 Ga0206354_11294995
772 Ga0206353_10022973
773 Ga0206353_11262925
774 Ga0207427_102784
775 Ga0209233_1000041
776 Ga0207656_10046381
777 Ga0207682_10005437
778 Ga0207680_10266822
779 Ga0207647_10002661
780 Ga0207647_10008935
781 Ga0207647_10019515
782 Ga0207647_10036469
783 Ga0207647_10085209
784 Ga0207647_10211858
785 Ga0207645_10502134
786 Ga0207705_10000123
787 Ga0207705_10002265
788 Ga0207705_10038945
789 Ga0207705_10059412
790 Ga0207705_10066188
791 Ga0207705_10083906
792 Ga0207705_10094727
793 Ga0207705_10209273
794 Ga0207705_10257540
795 Ga0207705_10774124
796 Ga0207654_10225518
797 Ga0207707_10192844
798 Ga0207707_10382750
799 Ga0207707_10624082
800 Ga0207695_10017796
801 Ga0207671_10616145
802 Ga0207693_10105192
803 Ga0207660_10004525
804 Ga0207660_10014836
805 Ga0207660_10055421
806 Ga0207660_10100362
807 Ga0207660_10477253
808 Ga0207657_10000650
809 Ga0207657_10010310
810 Ga0207657_10030402
811 Ga0207657_10049395
812 Ga0207657_10053001
813 Ga0207657_10119531
814 Ga0207657_10430294
815 Ga0207657_10596357
816 Ga0207649_10008523
817 Ga0207649_10013628
818 Ga0207649_10025896
819 Ga0207649_10033848
820 Ga0207649_10115811
821 Ga0207649_10120782
822 Ga0207649_10239563
823 Ga0207649_10403802
824 Ga0207649_10415082
825 Ga0207649_10635354
826 Ga0207649_10718120
827 Ga0207652_10000034
828 Ga0207652_10609922
829 Ga0207681_10041976
830 Ga0207694_10038156
831 Ga0207694_10125884
832 Ga0207650_10128250
833 Ga0207650_10152402
834 Ga0207659_10275984
835 Ga0207700_10212244
836 Ga0207664_10065890
837 Ga0207664_10873966
838 Ga0207644_10000773
839 Ga0207644_10000998
840 Ga0207644_10050973
841 Ga0207644_10639068
842 Ga0207690_10006767
843 Ga0207690_10006964
844 Ga0207690_10008817
845 Ga0207690_10082598
846 Ga0207690_10087037
847 Ga0207690_10273614
848 Ga0207690_10421921
849 Ga0207690_10445248
850 Ga0207690_10498554
851 Ga0207706_10005402
852 Ga0207706_10018403
853 Ga0207706_10051967
854 Ga0207706_10060026
855 Ga0207706_10139216
856 Ga0207706_10237917
857 Ga0207686_10208722
858 Ga0207709_10069272
859 Ga0207669_10033361
860 Ga0207669_10079150
861 Ga0207704_10102920
862 Ga0207691_10058855
863 Ga0207691_10179335
864 Ga0207691_10565549
865 Ga0207711_10005331
866 Ga0207711_10083381
867 Ga0207689_10511870
868 Ga0207661_10006817
869 Ga0207661_10078573
870 Ga0207661_10538239
871 Ga0207661_10897903
872 Ga0207679_10002299
873 Ga0207679_10038485
874 Ga0207679_10041710
875 Ga0207679_10171643
876 Ga0207679_10531869
877 Ga0207679_10935071
878 Ga0207667_10013832
879 Ga0207667_10144475
880 Ga0207667_10214857
881 Ga0207667_10231645
882 Ga0207667_10274259
883 Ga0207667_10607427
884 Ga0207667_10636331
885 Ga0207651_10068421
886 Ga0207651_10946801
887 Ga0207712_10002789
888 Ga0207712_11185428
889 Ga0207668_10975302
890 Ga0207640_10033130
891 Ga0207640_10306852
892 Ga0207640_10454519
893 Ga0207640_10526050
894 Ga0207658_10541541
895 Ga0207677_10065855
896 Ga0207677_10339707
897 Ga0207639_10066529
898 Ga0207639_10328017
899 Ga0207639_10347805
900 Ga0207639_10423394
901 Ga0207639_10626602
902 Ga0207639_11444987
903 Ga0207678_10003759
904 Ga0207678_10016793
905 Ga0207678_10104051
906 Ga0207678_10116960
907 Ga0207678_10141621
908 Ga0207678_10553152
909 Ga0207678_10789319
910 Ga0207702_10012422
911 Ga0207702_10060858
912 Ga0207702_10136554
913 Ga0207702_10351546
914 Ga0207641_10017664
915 Ga0207641_10076257
916 Ga0207641_10108664
917 Ga0207641_10462632
918 Ga0207648_10049684
919 Ga0207676_10020773
920 Ga0207676_10079170
921 Ga0207676_10215385
922 Ga0207676_11117347
923 Ga0207674_10003695
924 Ga0207674_10009571
925 Ga0207674_10048049
926 Ga0207674_10062245
927 Ga0207674_10160936
928 Ga0207674_10687274
929 Ga0207675_100423712
930 Ga0207683_10002289
931 Ga0207698_10000463
932 Ga0207698_10010001
933 Ga0207698_10085376
934 Ga0207698_10423265
935 Ga0207698_11158771
936 Ga0268265_10168013
937 Ga0268264_10007102
938 Ga0307408_101216506
939 Ga0307405_10312376
940 Ga0307413_10234983
941 Ga0307410_10042493
942 Ga0307410_10063762
943 Ga0307407_10269260
944 Ga0307409_100006588
945 Ga0307416_100479422
946 Ga0307414_10889051
947 Ga0307411_10041689
948 Ga0373935_0015144
949 Ga0395899_0001745
950 Ga0395899_0033023
951 Ga0395899_0034703
952 Ga0395899_0069146
953 Ga0395899_0124996
954 Ga0395899_0131492
955 Ga0395899_0171225
956 Ga0395899_0300570
957 Ga0395899_0381842
958 Ga0395900_0001256
959 Ga0395900_0004511
960 Ga0395900_0012634
961 Ga0395900_0040505
962 Ga0395900_0050462
963 Ga0395900_0105257
964 Ga0395900_0145528
965 Ga0395900_0227738
966 Ga0395900_0258639
967 Ga0395900_0362543
968 Ga0395900_0374242
969 Ga0395900_0475641
970 Ga0395900_0642106
971 Ga0395900_0900035
972 Ga0395900_0918889
973 Ga0395900_1075582
974 Ga0395900_1523437
975 Ga0395898_0026010
976 Ga0395898_0040220
977 Ga0395898_0041227
978 Ga0395898_0090513
979 Ga0395898_0091108
980 Ga0395898_0147758
981 Ga0395898_0424593
982 Ga0395898_0489018
983 Ga0395898_1047411
984 Ga0395898_1062407
985 Ga0395898_1223359
986 Ga0395905_0000610
987 Ga0395905_0001942
988 Ga0395905_0002770
989 Ga0395905_0004357
990 Ga0395905_0005968
991 Ga0395905_0022733
992 Ga0395905_0026660
993 Ga0395905_0029060
994 Ga0395905_0032161
995 Ga0395905_0042669
996 Ga0395905_0046707
997 Ga0395905_0070170
998 Ga0395905_0098731
999 Ga0395905_0142606
1000 Ga0395905_0143888
1001 Ga0395905_0204784
1002 Ga0395905_0242986
1003 Ga0395905_0327416
1004 Ga0395905_0356598
1005 Ga0395905_0363551
1006 Ga0395905_0422864
1007 Ga0395905_0555770
1008 Ga0395905_0722560
1009 Ga0395901_0006859
1010 Ga0395901_0020377
1011 Ga0395901_0026624
1012 Ga0395901_0075285
1013 Ga0395901_0133263
1014 Ga0395901_0150959
1015 Ga0395901_0162468
1016 Ga0395901_0169083
1017 Ga0395901_0208651
1018 Ga0395901_0214671
1019 Ga0395901_0397779
1020 Ga0395901_0408547
1021 Ga0395901_0431098
1022 Ga0395901_0656559
1023 Ga0395901_1177546
1024 Ga0395901_1912675
1025 Ga0439448_0153526
1026 Ga0439458_0000012
1027 Ga0451577_0370867
1028 Ga0466969_0024800
1029 Ga0466972_0014762
1030 Ga0466972_0098261
1031 Ga0466965_0262739
1032 Ga0466966_0010189
1033 Ga0466966_0177207
1034 Ga0466966_0184683
1035 Ga0466966_0239105
1036 Ga0466966_0373447
1037 Ga0466961_0074874
1038 Ga0466961_0119763
1039 Ga0466963_0014561
1040 Ga0466963_0020356
1041 Ga0466963_0066016
1042 Ga0466963_0178863
1043 Ga0466963_0257824
1044 Ga0466964_0029034
1045 Ga0466964_0069984
1046 Ga0466971_0048628
1047 Ga0466971_0186845
1048 Ga0466971_0658780
1049 Ga0466968_0030399
1050 Ga0466970_0047620
1051 Ga0466957_0015905
1052 Ga0466957_0139292
1053 Ga0466957_0251721
1054 Ga0466957_0293759
1055 Ga0466960_0024814
1056 Ga0466959_0189133
1057 Ga0466959_0234096
1058 Ga0466959_0317240
1059 Ga0466958_0006397
1060 Ga0466967_0004902
1061 Ga0466967_0016275
1062 Ga0466967_0017945
1063 Ga0466967_0030324
1064 Ga0466967_0213036
1065 Ga0466967_0302008
1066 Ga0466967_0400133
1067 Ga0495605_0366825
1068 Ga0495584_0298676
1069 Ga0495642_0194859
1070 Ga0495668_0008461
1071 Ga0495668_0551324
1072 Ga0495669_0000276
1073 Ga0495669_0271386
1074 Ga0495677_0051099
1075 Ga0495677_0277968
1076 Ga0496103_0106258
1077 Ga0496103_0164204
1078 Ga0496103_0584407
1079 Ga0496106_0812194
1080 Ga0496107_0483325
1081 Ga0496109_0339981
1082 Ga0496110_0049283
1083 Ga0496110_0076299
1084 Ga0496110_0334429
1085 Ga0496111_0032925
1086 Ga0496111_0318374
1087 Ga0496112_0006596
1088 Ga0496112_0029392
1089 Ga0496113_0128899
1090 Ga0496113_0230245
1091 Ga0501067_0030126
1092 Ga0501069_0312486
1093 nmdc:mga0a205_40805_c1
1094 Ga0466962_0047488
1095 Ga0466962_0062447
1096 Ga0466962_0202447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

3

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lw3-assembly1.cif.gz_B crystal structure of ruvc from pseudomonas aeruginosa 0.944 2 152
1hjr-assembly2.cif.gz_D atomic structure of the ruvc resolvase: a holliday junction-specific endonuclease from e. coli 0.9432 1 154
7w8d-assembly1.cif.gz_B the structure of deinococcus radiodurans ruvc 0.9353 1 153
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.9351 1 153
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.9236 1 153
ID Description Score Start End Superfamily
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9541 1 159 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9471 1 152 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.901 1 152 3.30.420.10
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.88 1 159 3.30.420.10
af_Q58899_2_184_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.86 39 101 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A1S1P1U1-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) 0.9913 1 151 GO:0003677
GO:0006281
GO:0006310
GO:0008821
GO:0046872
AF-A0A2A4I873-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9902 1 160 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-Q5NR76-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.9901 1 160 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476
AF-A0A109YLE9-F1-model_v4 deleted 0.988 1 153
AF-A0NNE2-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC (EC 3.1.21.10) (Holliday junction nuclease RuvC) (Holliday junction resolvase RuvC) 0.987 1 159 GO:0000287
GO:0003677
GO:0005737
GO:0006281
GO:0006310
GO:0008821
GO:0048476

Map