F462130

General Info

Members Datasets Scaffolds Average Seq Length
547 200 547 89

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0214138|Ga0395900_0214138_331_615
Length 94
Sequence LERNEAVTGYDFLSGAVAFGFFVCALFFLRFWRRTRDPLLLSFAVAFALLGVGQSLASLANIPTEERAPIYLFRLVAFAVIIFAIARKNRVSRS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
165 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
168 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
169 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
177 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
182 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
183 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
190 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
193 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.56
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10162873 3300001979 Unclassified 553
2 JGI24739J22299_10006988 3300001989 Bacteria 4251
3 JGI24743J22301_10007929 3300001991 Bacteria 1853
4 JGI24738J21930_10131838 3300002075 Bacteria 548
5 rootH2_10095655 3300003320 Bacteria 1832
6 rootL2_10070917 3300003322 Bacteria 1237
7 Ga0065712_10019127 3300005290 Bacteria 1440
8 Ga0065715_10042422 3300005293 Bacteria 1190
9 Ga0070658_10000862 3300005327 Bacteria 25898
10 Ga0070658_10040006 3300005327 Unclassified 3782
11 Ga0070658_10296866 3300005327 Unclassified 1377
12 Ga0070658_10307506 3300005327 Bacteria 1352
13 Ga0070658_10313163 3300005327 Bacteria 1339
14 Ga0070658_10320353 3300005327 Unclassified 1324
15 Ga0070658_10394351 3300005327 Bacteria 1188
16 Ga0070658_10954974 3300005327 Unclassified 745
17 Ga0070658_11053300 3300005327 Unclassified 707
18 Ga0070658_11652273 3300005327 Unclassified 555
19 Ga0070658_11774750 3300005327 Bacteria 534
20 Ga0070676_10684358 3300005328 Bacteria 747
21 Ga0070683_100092485 3300005329 Bacteria 2841
22 Ga0070683_100321605 3300005329 Bacteria 1472
23 Ga0070683_100562435 3300005329 Bacteria 1090
24 Ga0070683_101821951 3300005329 Bacteria 585
25 Ga0070670_100158275 3300005331 Bacteria 1962
26 Ga0070670_100229962 3300005331 Bacteria 1614
27 Ga0070677_10009276 3300005333 Bacteria 3332
28 Ga0070666_10104009 3300005335 Bacteria 1959
29 Ga0070666_10445983 3300005335 Bacteria 934
30 Ga0070666_10763386 3300005335 Bacteria 711
31 Ga0070680_100028527 3300005336 Bacteria 4478
32 Ga0070680_100317940 3300005336 Bacteria 1321
33 Ga0070680_100948711 3300005336 Bacteria 742
34 Ga0070680_101487251 3300005336 Bacteria 587
35 Ga0070680_101518376 3300005336 Bacteria 580
36 Ga0070680_101760227 3300005336 Unclassified 537
37 Ga0070682_100074245 3300005337 Bacteria 2184
38 Ga0070682_100196997 3300005337 Bacteria 1418
39 Ga0070682_100199921 3300005337 Bacteria 1409
40 Ga0070682_100295734 3300005337 Bacteria 1186
41 Ga0068868_101362035 3300005338 Bacteria 661
42 Ga0068868_101538001 3300005338 Bacteria 624
43 Ga0070660_100000043 3300005339 Bacteria 72315
44 Ga0070660_100023147 3300005339 Bacteria 4601
45 Ga0070660_100026498 3300005339 Bacteria 4316
46 Ga0070660_100067006 3300005339 Bacteria 2796
47 Ga0070660_100090322 3300005339 Bacteria 2415
48 Ga0070660_100206983 3300005339 Bacteria 1592
49 Ga0070660_100269533 3300005339 Unclassified 1391
50 Ga0070660_100327635 3300005339 Bacteria 1259
51 Ga0070660_101188439 3300005339 Bacteria 646
52 Ga0070660_101236943 3300005339 Unclassified 633
53 Ga0070660_101389364 3300005339 Unclassified 596
54 Ga0070660_101493230 3300005339 Unclassified 575
55 Ga0070660_101890032 3300005339 Unclassified 509
56 Ga0070689_100427172 3300005340 Bacteria 1124
57 Ga0070661_100028675 3300005344 Bacteria 4016
58 Ga0070661_100067576 3300005344 Bacteria 2627
59 Ga0070661_100071178 3300005344 Bacteria 2559
60 Ga0070661_100660041 3300005344 Bacteria 849
61 Ga0070661_101161891 3300005344 Bacteria 645
62 Ga0070661_101476505 3300005344 Bacteria 573
63 Ga0070692_10023696 3300005345 Bacteria 3010
64 Ga0070692_10139403 3300005345 Bacteria 1371
65 Ga0070692_10376660 3300005345 Unclassified 889
66 Ga0070669_100555551 3300005353 Bacteria 957
67 Ga0070669_101731190 3300005353 Bacteria 545
68 Ga0070675_100109951 3300005354 Bacteria 2330
69 Ga0070675_100390755 3300005354 Bacteria 1239
70 Ga0070671_100726234 3300005355 Bacteria 862
71 Ga0070674_100249590 3300005356 Bacteria 1393
72 Ga0070673_100023615 3300005364 Bacteria 4494
73 Ga0070673_100324579 3300005364 Bacteria 1360
74 Ga0070673_102076261 3300005364 Bacteria 540
75 Ga0070659_100011471 3300005366 Bacteria 6556
76 Ga0070659_100042839 3300005366 Bacteria 3539
77 Ga0070659_100044366 3300005366 Bacteria 3480
78 Ga0070659_100164859 3300005366 Bacteria 1813
79 Ga0070659_100303086 3300005366 Unclassified 1333
80 Ga0070659_100702297 3300005366 Unclassified 875
81 Ga0070659_100787211 3300005366 Bacteria 826
82 Ga0070659_101625421 3300005366 Unclassified 577
83 Ga0070667_100000842 3300005367 Bacteria 28434
84 Ga0070714_100881733 3300005435 Bacteria 868
85 Ga0070663_100003726 3300005455 Bacteria 8837
86 Ga0070663_100015611 3300005455 Bacteria 4909
87 Ga0070663_100030813 3300005455 Bacteria 3680
88 Ga0070663_100041985 3300005455 Bacteria 3212
89 Ga0070663_100049675 3300005455 Bacteria 2980
90 Ga0070663_100150922 3300005455 Bacteria 1782
91 Ga0070663_100533654 3300005455 Bacteria 979
92 Ga0070662_100006841 3300005457 Bacteria 7374
93 Ga0070662_100068657 3300005457 Bacteria 2606
94 Ga0070662_100127922 3300005457 Bacteria 1955
95 Ga0070681_10192911 3300005458 Bacteria 1956
96 Ga0070681_10454917 3300005458 Bacteria 1192
97 Ga0070681_11251030 3300005458 Unclassified 664
98 Ga0070681_11566051 3300005458 Unclassified 584
99 Ga0070679_100098292 3300005530 Unclassified 2914
100 Ga0070679_100532960 3300005530 Bacteria 1118
101 Ga0070679_101431719 3300005530 Bacteria 637
102 Ga0070684_101647831 3300005535 Bacteria 605
103 Ga0068853_100102276 3300005539 Bacteria 2535
104 Ga0068853_100227657 3300005539 Bacteria 1705
105 Ga0070672_101886194 3300005543 Bacteria 538
106 Ga0070696_100804547 3300005546 Unclassified 774
107 Ga0070693_100158693 3300005547 Bacteria 1439
108 Ga0070665_100009746 3300005548 Bacteria 9712
109 Ga0070665_100346158 3300005548 Bacteria 1491
110 Ga0070665_100624853 3300005548 Bacteria 1090
111 Ga0070665_101422434 3300005548 Bacteria 702
112 Ga0068855_100000292 3300005563 Bacteria 62086
113 Ga0068855_100469011 3300005563 Unclassified 1372
114 Ga0068855_100503908 3300005563 Unclassified 1315
115 Ga0068855_100717679 3300005563 Bacteria 1068
116 Ga0068855_100930176 3300005563 Bacteria 917
117 Ga0068855_101378433 3300005563 Bacteria 727
118 Ga0068855_102418449 3300005563 Bacteria 524
119 Ga0070664_100005116 3300005564 Bacteria 10525
120 Ga0070664_100021951 3300005564 Bacteria 5264
121 Ga0070664_100030392 3300005564 Bacteria 4507
122 Ga0070664_100033988 3300005564 Bacteria 4275
123 Ga0070664_100138010 3300005564 Bacteria 2145
124 Ga0070664_100355472 3300005564 Bacteria 1333
125 Ga0070664_100991746 3300005564 Unclassified 789
126 Ga0068857_100039193 3300005577 Bacteria 4196
127 Ga0068857_100041588 3300005577 Bacteria 4076
128 Ga0068857_100191465 3300005577 Bacteria 1863
129 Ga0068857_100256690 3300005577 Bacteria 1603
130 Ga0068857_101077646 3300005577 Unclassified 775
131 Ga0068857_102040662 3300005577 Bacteria 562
132 Ga0068854_100100037 3300005578 Bacteria 2172
133 Ga0068854_100118372 3300005578 Bacteria 2007
134 Ga0068854_100163583 3300005578 Bacteria 1726
135 Ga0068854_100451458 3300005578 Bacteria 1074
136 Ga0068854_100470361 3300005578 Bacteria 1053
137 Ga0068854_102162666 3300005578 Bacteria 514
138 Ga0068856_100082771 3300005614 Bacteria 3185
139 Ga0068856_100083199 3300005614 Bacteria 3177
140 Ga0068856_100333771 3300005614 Unclassified 1534
141 Ga0068856_100487685 3300005614 Bacteria 1253
142 Ga0068856_102497370 3300005614 Bacteria 523
143 Ga0068852_100055625 3300005616 Bacteria 3416
144 Ga0068852_100056875 3300005616 Bacteria 3382
145 Ga0068852_100205787 3300005616 Bacteria 1864
146 Ga0068852_100257478 3300005616 Bacteria 1674
147 Ga0068852_100303323 3300005616 Unclassified 1546
148 Ga0068852_100787805 3300005616 Bacteria 964
149 Ga0068859_100050558 3300005617 Bacteria 4175
150 Ga0068859_100336509 3300005617 Bacteria 1604
151 Ga0068859_100647551 3300005617 Bacteria 1149
152 Ga0068864_101604630 3300005618 Bacteria 655
153 Ga0068861_100428606 3300005719 Bacteria 1180
154 Ga0068851_10001858 3300005834 Bacteria 9268
155 Ga0068851_10133914 3300005834 Bacteria 1342
156 Ga0068851_10144655 3300005834 Bacteria 1295
157 Ga0068863_102021238 3300005841 Bacteria 586
158 Ga0068858_100745351 3300005842 Bacteria 954
159 Ga0068860_101211622 3300005843 Bacteria 775
160 Ga0097621_100468680 3300006237 Unclassified 1137
161 Ga0068871_100573619 3300006358 Bacteria 1024
162 Ga0068871_102109670 3300006358 Unclassified 537
163 Ga0068865_100979784 3300006881 Unclassified 739
164 Ga0097620_100050558 3300006931 Bacteria 4175
165 Ga0097620_100336486 3300006931 Bacteria 1604
166 Ga0097620_100647601 3300006931 Bacteria 1149
167 Ga0105240_10383102 3300009093 Bacteria 1588
168 Ga0105247_10033525 3300009101 Unclassified 3124
169 Ga0105241_10127427 3300009174 Bacteria 2057
170 Ga0105241_10129214 3300009174 Bacteria 2043
171 Ga0105241_10640445 3300009174 Bacteria 964
172 Ga0105248_10036845 3300009177 Bacteria 5471
173 Ga0105248_10086568 3300009177 Bacteria 3525
174 Ga0105248_11491481 3300009177 Unclassified 765
175 Ga0157373_10021899 3300013100 Bacteria 4637
176 Ga0157373_10041978 3300013100 Bacteria 3271
177 Ga0157373_10099426 3300013100 Bacteria 2047
178 Ga0157373_10252878 3300013100 Bacteria 1246
179 Ga0157373_10263662 3300013100 Bacteria 1219
180 Ga0157373_11318624 3300013100 Bacteria 547
181 Ga0157371_10002967 3300013102 Bacteria 15772
182 Ga0157371_10105798 3300013102 Bacteria 1997
183 Ga0157371_10215167 3300013102 Bacteria 1379
184 Ga0157371_10364603 3300013102 Bacteria 1053
185 Ga0157371_10427984 3300013102 Unclassified 971
186 Ga0157371_10533076 3300013102 Bacteria 869
187 Ga0157370_10003954 3300013104 Bacteria 17255
188 Ga0157370_10038140 3300013104 Bacteria 4649
189 Ga0157370_10071777 3300013104 Bacteria 3267
190 Ga0157370_10241258 3300013104 Bacteria 1672
191 Ga0157370_10330420 3300013104 Bacteria 1406
192 Ga0157370_10473729 3300013104 Unclassified 1151
193 Ga0157370_11270934 3300013104 Unclassified 663
194 Ga0157369_10047795 3300013105 Bacteria 4644
195 Ga0157369_10068332 3300013105 Bacteria 3817
196 Ga0157369_11625049 3300013105 Bacteria 657
197 Ga0157369_12703929 3300013105 Unclassified 500
198 Ga0157374_10047143 3300013296 Bacteria 3995
199 Ga0157374_10714681 3300013296 Bacteria 1015
200 Ga0157374_12049822 3300013296 Bacteria 599
201 Ga0157372_10478352 3300013307 Bacteria 1452
202 Ga0157372_10614767 3300013307 Bacteria 1266
203 Ga0157372_10712592 3300013307 Bacteria 1167
204 Ga0157372_11230225 3300013307 Unclassified 865
205 Ga0157372_11555876 3300013307 Unclassified 761
206 Ga0157372_12701417 3300013307 Bacteria 570
207 Ga0182008_10269127 3300014497 Bacteria 883
208 Ga0182008_10567276 3300014497 Unclassified 633
209 Ga0182008_10643347 3300014497 Bacteria 600
210 Ga0157379_10097054 3300014968 Unclassified 2645
211 Ga0207656_10062520 3300025321 Bacteria 1637
212 Ga0207656_10095685 3300025321 Bacteria 1354
213 Ga0207710_10254869 3300025900 Bacteria 878
214 Ga0207680_11063160 3300025903 Bacteria 579
215 Ga0207647_10034699 3300025904 Bacteria 3218
216 Ga0207647_10057301 3300025904 Bacteria 2389
217 Ga0207647_10113491 3300025904 Bacteria 1601
218 Ga0207705_10000238 3300025909 Bacteria 54681
219 Ga0207705_10026504 3300025909 Bacteria 4133
220 Ga0207705_10029001 3300025909 Bacteria 3946
221 Ga0207705_10083286 3300025909 Bacteria 2333
222 Ga0207705_10085270 3300025909 Bacteria 2307
223 Ga0207705_10124868 3300025909 Bacteria 1912
224 Ga0207705_10174579 3300025909 Bacteria 1619
225 Ga0207705_10474948 3300025909 Bacteria 970
226 Ga0207705_11459962 3300025909 Bacteria 519
227 Ga0207654_10455212 3300025911 Bacteria 898
228 Ga0207654_10783039 3300025911 Bacteria 688
229 Ga0207707_10092415 3300025912 Unclassified 2644
230 Ga0207707_10463097 3300025912 Bacteria 1084
231 Ga0207660_10058884 3300025917 Bacteria 2756
232 Ga0207660_10068549 3300025917 Unclassified 2573
233 Ga0207660_10832520 3300025917 Bacteria 753
234 Ga0207660_11083286 3300025917 Unclassified 653
235 Ga0207657_10000374 3300025919 Bacteria 47368
236 Ga0207657_10033397 3300025919 Bacteria 4639
237 Ga0207657_10038269 3300025919 Bacteria 4272
238 Ga0207657_10040335 3300025919 Bacteria 4137
239 Ga0207657_10044364 3300025919 Bacteria 3909
240 Ga0207657_10106702 3300025919 Bacteria 2317
241 Ga0207657_10130785 3300025919 Bacteria 2057
242 Ga0207657_10259636 3300025919 Bacteria 1383
243 Ga0207657_10317571 3300025919 Unclassified 1232
244 Ga0207657_10326758 3300025919 Bacteria 1212
245 Ga0207649_10373544 3300025920 Unclassified 1061
246 Ga0207649_10407817 3300025920 Bacteria 1018
247 Ga0207649_11324015 3300025920 Bacteria 570
248 Ga0207652_10070735 3300025921 Unclassified 3030
249 Ga0207652_10163816 3300025921 Bacteria 1993
250 Ga0207652_10468183 3300025921 Bacteria 1135
251 Ga0207681_10151640 3300025923 Bacteria 1738
252 Ga0207650_10263363 3300025925 Bacteria 1399
253 Ga0207650_10695729 3300025925 Bacteria 858
254 Ga0207650_11809917 3300025925 Bacteria 516
255 Ga0207659_11099075 3300025926 Bacteria 684
256 Ga0207644_10157695 3300025931 Unclassified 1761
257 Ga0207690_10097358 3300025932 Bacteria 2093
258 Ga0207690_10111200 3300025932 Bacteria 1974
259 Ga0207690_10186602 3300025932 Bacteria 1565
260 Ga0207690_10464277 3300025932 Bacteria 1019
261 Ga0207690_10501688 3300025932 Unclassified 982
262 Ga0207690_10796629 3300025932 Bacteria 781
263 Ga0207690_11065895 3300025932 Bacteria 673
264 Ga0207706_10001098 3300025933 Bacteria 27522
265 Ga0207706_10032835 3300025933 Bacteria 4619
266 Ga0207706_10065467 3300025933 Bacteria 3200
267 Ga0207706_10169165 3300025933 Bacteria 1921
268 Ga0207706_10281830 3300025933 Bacteria 1449
269 Ga0207706_10903334 3300025933 Bacteria 746
270 Ga0207706_11415801 3300025933 Bacteria 570
271 Ga0207670_10146789 3300025936 Unclassified 1745
272 Ga0207669_11071802 3300025937 Bacteria 679
273 Ga0207669_11653462 3300025937 Bacteria 547
274 Ga0207704_11931326 3300025938 Unclassified 508
275 Ga0207711_10077025 3300025941 Bacteria 2906
276 Ga0207711_10094377 3300025941 Bacteria 2636
277 Ga0207661_10008399 3300025944 Bacteria 7379
278 Ga0207661_10025197 3300025944 Bacteria 4520
279 Ga0207661_11065571 3300025944 Bacteria 744
280 Ga0207679_10011577 3300025945 Bacteria 5722
281 Ga0207679_10014157 3300025945 Bacteria 5237
282 Ga0207679_10108148 3300025945 Bacteria 2189
283 Ga0207679_10362464 3300025945 Bacteria 1266
284 Ga0207679_10711435 3300025945 Unclassified 912
285 Ga0207679_11579560 3300025945 Unclassified 601
286 Ga0207667_10000576 3300025949 Bacteria 47850
287 Ga0207667_10090761 3300025949 Bacteria 3157
288 Ga0207667_10691086 3300025949 Bacteria 1023
289 Ga0207667_10867459 3300025949 Unclassified 896
290 Ga0207651_10319340 3300025960 Bacteria 1298
291 Ga0207651_10392201 3300025960 Bacteria 1179
292 Ga0207640_10293317 3300025981 Bacteria 1283
293 Ga0207640_10299579 3300025981 Bacteria 1271
294 Ga0207640_10301244 3300025981 Bacteria 1268
295 Ga0207640_11057757 3300025981 Bacteria 716
296 Ga0207640_11275355 3300025981 Bacteria 655
297 Ga0207658_10071250 3300025986 Bacteria 2632
298 Ga0207658_10076645 3300025986 Bacteria 2548
299 Ga0207677_10146930 3300026023 Bacteria 1813
300 Ga0207677_10220964 3300026023 Bacteria 1519
301 Ga0207703_10143148 3300026035 Bacteria 2077
302 Ga0207703_12400441 3300026035 Bacteria 503
303 Ga0207639_10085291 3300026041 Bacteria 2511
304 Ga0207639_10118320 3300026041 Bacteria 2172
305 Ga0207639_10917284 3300026041 Bacteria 819
306 Ga0207678_10000989 3300026067 Bacteria 25886
307 Ga0207678_10001579 3300026067 Bacteria 20944
308 Ga0207678_10022721 3300026067 Bacteria 5493
309 Ga0207678_10153784 3300026067 Unclassified 1964
310 Ga0207678_10182026 3300026067 Bacteria 1794
311 Ga0207678_10223810 3300026067 Bacteria 1611
312 Ga0207702_10064698 3300026078 Bacteria 3130
313 Ga0207702_10163764 3300026078 Bacteria 2033
314 Ga0207702_10168553 3300026078 Bacteria 2006
315 Ga0207702_10442663 3300026078 Bacteria 1260
316 Ga0207702_10448767 3300026078 Bacteria 1251
317 Ga0207674_10035098 3300026116 Bacteria 5235
318 Ga0207674_10035328 3300026116 Bacteria 5217
319 Ga0207674_10078342 3300026116 Bacteria 3310
320 Ga0207674_10096380 3300026116 Bacteria 2943
321 Ga0207674_10753485 3300026116 Bacteria 940
322 Ga0207698_10040595 3300026142 Bacteria 3460
323 Ga0207698_10266161 3300026142 Bacteria 1577
324 Ga0207698_10305848 3300026142 Bacteria 1482
325 Ga0207698_10641337 3300026142 Bacteria 1051
326 Ga0207698_10714343 3300026142 Bacteria 998
327 Ga0207698_11672266 3300026142 Bacteria 652
328 Ga0268266_10183778 3300028379 Bacteria 1905
329 Ga0268264_10279749 3300028381 Bacteria 1562
330 Ga0307408_100009489 3300031548 Bacteria 6418
331 Ga0307408_100021515 3300031548 Bacteria 4365
332 Ga0307405_10084630 3300031731 Bacteria 2082
333 Ga0307405_10233033 3300031731 Bacteria 1358
334 Ga0307405_10559181 3300031731 Bacteria 927
335 Ga0307413_10309873 3300031824 Bacteria 1201
336 Ga0307413_10459462 3300031824 Bacteria 1012
337 Ga0307413_10876323 3300031824 Unclassified 760
338 Ga0307413_11637308 3300031824 Unclassified 573
339 Ga0307410_10005912 3300031852 Bacteria 6539
340 Ga0307410_10157840 3300031852 Bacteria 1696
341 Ga0307410_10200931 3300031852 Unclassified 1521
342 Ga0307406_10049377 3300031901 Bacteria 2662
343 Ga0307406_10168493 3300031901 Bacteria 1582
344 Ga0307406_10199252 3300031901 Bacteria 1472
345 Ga0307406_10432323 3300031901 Bacteria 1051
346 Ga0307407_10012151 3300031903 Bacteria 4130
347 Ga0307407_10084958 3300031903 Bacteria 1924
348 Ga0307407_10419983 3300031903 Bacteria 963
349 Ga0307412_10031102 3300031911 Bacteria 3367
350 Ga0307412_10106783 3300031911 Bacteria 1991
351 Ga0307412_11169063 3300031911 Bacteria 688
352 Ga0307412_11664852 3300031911 Bacteria 584
353 Ga0307412_11732565 3300031911 Bacteria 573
354 Ga0307409_100019126 3300031995 Bacteria 4627
355 Ga0307409_100293210 3300031995 Bacteria 1509
356 Ga0307409_100349777 3300031995 Bacteria 1394
357 Ga0307409_100361583 3300031995 Bacteria 1373
358 Ga0307409_100689976 3300031995 Bacteria 1019
359 Ga0307409_102188109 3300031995 Bacteria 582
360 Ga0307416_100028519 3300032002 Bacteria 4152
361 Ga0307416_100253616 3300032002 Bacteria 1714
362 Ga0307416_100340776 3300032002 Bacteria 1512
363 Ga0307416_100348964 3300032002 Bacteria 1496
364 Ga0307416_100889473 3300032002 Unclassified 990
365 Ga0307416_101934705 3300032002 Bacteria 693
366 Ga0307414_10002526 3300032004 Bacteria 9602
367 Ga0307414_10197937 3300032004 Bacteria 1631
368 Ga0307414_10402190 3300032004 Bacteria 1190
369 Ga0307411_10012101 3300032005 Bacteria 4688
370 Ga0307411_10032212 3300032005 Bacteria 3236
371 Ga0307411_10357163 3300032005 Bacteria 1193
372 Ga0307411_10394421 3300032005 Bacteria 1142
373 Ga0307415_100219838 3300032126 Bacteria 1522
374 Ga0307415_100572265 3300032126 Bacteria 1000
375 Ga0373929_0085750 3300035085 Bacteria 774
376 Ga0395899_0010184 3300037312 Bacteria 7204
377 Ga0395899_0063340 3300037312 Bacteria 2720
378 Ga0395899_0063762 3300037312 Bacteria 2710
379 Ga0395899_0082928 3300037312 Bacteria 2331
380 Ga0395899_0143086 3300037312 Unclassified 1700
381 Ga0395899_0156903 3300037312 Bacteria 1610
382 Ga0395899_0219329 3300037312 Bacteria 1318
383 Ga0395899_0341126 3300037312 Bacteria 1004
384 Ga0395899_0511301 3300037312 Unclassified 778
385 Ga0395899_0935523 3300037312 Bacteria 526
386 Ga0395900_0057719 3300037418 Bacteria 3996
387 Ga0395900_0092960 3300037418 Bacteria 3098
388 Ga0395900_0094089 3300037418 Bacteria 3078
389 Ga0395900_0124035 3300037418 Bacteria 2649
390 Ga0395900_0214138 3300037418 Bacteria 1944
391 Ga0395900_0220856 3300037418 Unclassified 1910
392 Ga0395900_0363322 3300037418 Unclassified 1418
393 Ga0395900_0437241 3300037418 Bacteria 1266
394 Ga0395900_0531269 3300037418 Unclassified 1123
395 Ga0395900_0639264 3300037418 Bacteria 1001
396 Ga0395900_0820300 3300037418 Bacteria 857
397 Ga0395900_0971261 3300037418 Bacteria 770
398 Ga0395900_1003734 3300037418 Bacteria 754
399 Ga0395898_0076467 3300037466 Bacteria 3233
400 Ga0395898_0106743 3300037466 Bacteria 2686
401 Ga0395898_0116659 3300037466 Bacteria 2558
402 Ga0395898_0133848 3300037466 Bacteria 2373
403 Ga0395898_0248462 3300037466 Bacteria 1696
404 Ga0395898_0264782 3300037466 Bacteria 1639
405 Ga0395898_1550768 3300037466 Bacteria 587
406 Ga0395905_0012515 3300037471 Bacteria 8164
407 Ga0395905_0054282 3300037471 Bacteria 3750
408 Ga0395905_0054589 3300037471 Bacteria 3738
409 Ga0395905_0058650 3300037471 Bacteria 3599
410 Ga0395905_0161087 3300037471 Bacteria 2108
411 Ga0395905_0257223 3300037471 Unclassified 1630
412 Ga0395905_0472788 3300037471 Bacteria 1152
413 Ga0395905_0521312 3300037471 Bacteria 1089
414 Ga0395905_0536109 3300037471 Unclassified 1071
415 Ga0395905_1000899 3300037471 Bacteria 739
416 Ga0395905_1600031 3300037471 Unclassified 556
417 Ga0395905_1619287 3300037471 Unclassified 552
418 Ga0395905_1828315 3300037471 Unclassified 513
419 Ga0395901_0079488 3300038443 Bacteria 3424
420 Ga0395901_0158555 3300038443 Bacteria 2376
421 Ga0395901_0180592 3300038443 Bacteria 2213
422 Ga0395901_0211346 3300038443 Bacteria 2030
423 Ga0395901_0282145 3300038443 Bacteria 1725
424 Ga0395901_0368050 3300038443 Bacteria 1481
425 Ga0395901_0427922 3300038443 Unclassified 1356
426 Ga0395901_0622789 3300038443 Unclassified 1086
427 Ga0395901_0893157 3300038443 Bacteria 871
428 Ga0395901_0901023 3300038443 Bacteria 866
429 Ga0395901_1102121 3300038443 Bacteria 764
430 Ga0395901_1353090 3300038443 Bacteria 672
431 Ga0395901_2024834 3300038443 Unclassified 522
432 Ga0439465_0247436 3300041413 Bacteria 659
433 Ga0451853_2279982 3300041512 Bacteria 524
434 Ga0439433_0136142 3300041999 Bacteria 627
435 Ga0439449_0043432 3300042007 Bacteria 1669
436 Ga0439434_0116481 3300042435 Bacteria 869
437 Ga0466969_0099524 3300044656 Bacteria 1370
438 Ga0466972_0011608 3300044658 Bacteria 4424
439 Ga0466972_0060729 3300044658 Bacteria 1813
440 Ga0466972_0169829 3300044658 Unclassified 1024
441 Ga0466965_0655401 3300044683 Bacteria 600
442 Ga0466966_0000003 3300044684 Bacteria 233677
443 Ga0466966_0041887 3300044684 Bacteria 2941
444 Ga0466966_0405896 3300044684 Bacteria 819
445 Ga0466966_0478893 3300044684 Bacteria 748
446 Ga0466966_0658151 3300044684 Bacteria 631
447 Ga0466961_0157249 3300044693 Bacteria 1418
448 Ga0466961_0177851 3300044693 Bacteria 1322
449 Ga0466961_0526576 3300044693 Bacteria 713
450 Ga0466963_0013039 3300044694 Bacteria 5096
451 Ga0466963_0033198 3300044694 Bacteria 3348
452 Ga0466963_0047183 3300044694 Bacteria 2842
453 Ga0466963_0401227 3300044694 Bacteria 967
454 Ga0466964_0229832 3300044706 Bacteria 905
455 Ga0466964_0742343 3300044706 Bacteria 550
456 Ga0466971_0023572 3300044719 Bacteria 2744
457 Ga0466971_0046333 3300044719 Bacteria 1954
458 Ga0466971_0222631 3300044719 Unclassified 895
459 Ga0466971_0584883 3300044719 Bacteria 556
460 Ga0466968_0201875 3300044735 Bacteria 932
461 Ga0466970_0082103 3300044765 Bacteria 1743
462 Ga0466970_0137718 3300044765 Unclassified 1343
463 Ga0466970_0265387 3300044765 Bacteria 964
464 Ga0466957_0016739 3300044842 Bacteria 4289
465 Ga0466957_0023680 3300044842 Bacteria 3631
466 Ga0466957_0280495 3300044842 Unclassified 1115
467 Ga0466957_1119810 3300044842 Bacteria 568
468 Ga0466957_1437003 3300044842 Unclassified 502
469 Ga0466960_0156275 3300044901 Bacteria 1222
470 Ga0466959_0447866 3300045049 Bacteria 875
471 Ga0466958_0373142 3300045836 Bacteria 919
472 Ga0466958_0515498 3300045836 Bacteria 776
473 Ga0466967_0040698 3300045976 Bacteria 4002
474 Ga0466967_0080303 3300045976 Bacteria 2942
475 Ga0466967_0210372 3300045976 Bacteria 1844
476 Ga0466967_0289552 3300045976 Bacteria 1573
477 Ga0466967_0472157 3300045976 Bacteria 1228
478 Ga0466967_0505046 3300045976 Bacteria 1187
479 Ga0466967_0551769 3300045976 Unclassified 1134
480 Ga0466967_1856142 3300045976 Bacteria 600
481 Ga0495620_0035355 3300046515 Bacteria 2247
482 Ga0495663_0004434 3300046525 Bacteria 3948
483 Ga0495642_0083929 3300046528 Bacteria 1344
484 Ga0495598_0002895 3300046537 Bacteria 3591
485 Ga0495621_0214613 3300046539 Unclassified 777
486 Ga0495669_0038263 3300046684 Bacteria 2124
487 Ga0495669_0100127 3300046684 Unclassified 1345
488 Ga0495670_0020857 3300046691 Bacteria 3231
489 Ga0495677_0002808 3300047445 Bacteria 6793
490 Ga0496100_0347203 3300048903 Unclassified 1120
491 Ga0496101_1452630 3300048904 Unclassified 534
492 Ga0496107_0046892 3300048910 Bacteria 3111
493 Ga0496107_0383736 3300048910 Bacteria 1045
494 Ga0496108_0417395 3300048911 Bacteria 1172
495 Ga0496109_0276949 3300048912 Bacteria 1581
496 Ga0496109_0359344 3300048912 Unclassified 1376
497 Ga0496109_1021303 3300048912 Bacteria 764
498 Ga0496110_0269270 3300048913 Bacteria 1551
499 Ga0496111_0173010 3300048914 Bacteria 1605
500 Ga0496112_0058370 3300048915 Bacteria 3800
501 Ga0496112_0111082 3300048915 Bacteria 2711
502 Ga0496113_0182481 3300048916 Bacteria 1664
503 Ga0496115_0003219 3300048918 Bacteria 11723
504 Ga0501070_0101169 3300049586 Bacteria 2384
505 Ga0501071_0274150 3300049587 Unclassified 1276
506 Ga0501074_0402375 3300049590 Unclassified 971
507 Ga0501199_021581 3300049650 Bacteria 751
508 Ga0501202_027307 3300049652 Bacteria 1173
509 Ga0501209_097225 3300049656 Bacteria 861
510 Ga0501214_105158 3300049659 Unclassified 501
511 Ga0501216_002143 3300049660 Bacteria 2772
512 Ga0501217_026914 3300049661 Bacteria 1392
513 Ga0501223_011633 3300049663 Bacteria 1767
514 Ga0501224_024655 3300049664 Bacteria 899
515 Ga0501230_008273 3300049667 Bacteria 1570
516 Ga0501235_049396 3300049669 Bacteria 973
517 Ga0501236_014611 3300049670 Bacteria 1090
518 Ga0501240_117672 3300049673 Bacteria 523
519 Ga0501243_018507 3300049675 Bacteria 1136
520 Ga0501247_037213 3300049677 Bacteria 684
521 Ga0501249_069215 3300049679 Bacteria 823
522 Ga0501252_009058 3300049682 Bacteria 1155
523 Ga0501257_019765 3300049686 Bacteria 1577
524 Ga0501258_003893 3300049687 Bacteria 1389
525 Ga0501260_021734 3300049689 Bacteria 699
526 Ga0501219_007603 3300049703 Bacteria 785
527 Ga0501221_025172 3300049704 Bacteria 1200
528 Ga0501225_0031513 3300049705 Bacteria 1458
529 Ga0501229_073569 3300049706 Bacteria 538
530 Ga0501079_1417809 3300049741 Bacteria 547
531 Ga0501080_0420935 3300049742 Unclassified 1200
532 Ga0501241_041667 3300049758 Bacteria 891
533 Ga0501267_006424 3300049764 Bacteria 1130
534 Ga0501268_012411 3300049765 Bacteria 1362
535 Ga0501268_161888 3300049765 Unclassified 523
536 Ga0501272_004046 3300049769 Bacteria 1514
537 Ga0501273_051073 3300049770 Bacteria 632
538 Ga0501045_0229290 3300049824 Unclassified 1383
539 Ga0501045_1317848 3300049824 Bacteria 525
540 Ga0501204_028731 3300049850 Unclassified 763
541 Ga0501204_079010 3300049850 Bacteria 556
542 Ga0501212_027228 3300049851 Bacteria 909
543 Ga0501084_1060594 3300054114 Unclassified 681
544 Ga0590071_126721 3300059421 Bacteria 654
545 Ga0501082_1267970 3300060353 Bacteria 644
546 Ga0466962_0167755 3300061719 Bacteria 1068
547 Ga0466962_0701195 3300061719 Bacteria 519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_2279982 Ga0451853_2279982_40_303 81
2 3300005335 Ga0070666_10445983 Ga0070666_104459832 85
3 3300005548 Ga0070665_100624853 Ga0070665_1006248533 85
4 3300025903 Ga0207680_11063160 Ga0207680_110631602 85
5 3300032002 Ga0307416_100889473 Ga0307416_1008894733 85
6 3300044684 Ga0466966_0478893 Ga0466966_0478893_39_296 85
7 3300044693 Ga0466961_0177851 Ga0466961_0177851_229_486 85
8 3300049741 Ga0501079_1417809 Ga0501079_1417809_30_314 85
9 3300049824 Ga0501045_0229290 Ga0501045_0229290_444_728 85
10 3300049824 Ga0501045_1317848 Ga0501045_1317848_180_464 85
11 3300054114 Ga0501084_1060594 Ga0501084_1060594_223_486 85
12 3300060353 Ga0501082_1267970 Ga0501082_1267970_171_455 85
13 3300032002 Ga0307416_101934705 Ga0307416_1019347052 86
14 3300042435 Ga0439434_0116481 Ga0439434_0116481_180_476 86
15 3300046525 Ga0495663_0004434 Ga0495663_0004434_2235_2495 86
16 3300046528 Ga0495642_0083929 Ga0495642_0083929_581_841 86
17 3300046539 Ga0495621_0214613 Ga0495621_0214613_397_657 86
18 3300046684 Ga0495669_0100127 Ga0495669_0100127_909_1169 86
19 3300047445 Ga0495677_0002808 Ga0495677_0002808_2347_2607 86
20 3300005327 Ga0070658_11774750 Ga0070658_117747502 87
21 3300005329 Ga0070683_101821951 Ga0070683_1018219512 87
22 3300005331 Ga0070670_100229962 Ga0070670_1002299623 87
23 3300005337 Ga0070682_100199921 Ga0070682_1001999212 87
24 3300005339 Ga0070660_100026498 Ga0070660_1000264985 87
25 3300005339 Ga0070660_100206983 Ga0070660_1002069833 87
26 3300005340 Ga0070689_100427172 Ga0070689_1004271721 87
27 3300005344 Ga0070661_100028675 Ga0070661_1000286755 87
28 3300005354 Ga0070675_100390755 Ga0070675_1003907552 87
29 3300005364 Ga0070673_100324579 Ga0070673_1003245793 87
30 3300005366 Ga0070659_100042839 Ga0070659_1000428392 87
31 3300005455 Ga0070663_100150922 Ga0070663_1001509222 87
32 3300005457 Ga0070662_100127922 Ga0070662_1001279222 87
33 3300005458 Ga0070681_11566051 Ga0070681_115660511 87
34 3300005547 Ga0070693_100158693 Ga0070693_1001586933 87
35 3300005548 Ga0070665_101422434 Ga0070665_1014224341 87
36 3300005563 Ga0068855_100930176 Ga0068855_1009301762 87
37 3300005564 Ga0070664_100021951 Ga0070664_1000219513 87
38 3300005577 Ga0068857_100191465 Ga0068857_1001914654 87
39 3300005578 Ga0068854_100451458 Ga0068854_1004514582 87
40 3300005616 Ga0068852_100056875 Ga0068852_1000568752 87
41 3300005616 Ga0068852_100787805 Ga0068852_1007878053 87
42 3300005617 Ga0068859_100050558 Ga0068859_1000505584 87
43 3300005834 Ga0068851_10144655 Ga0068851_101446554 87
44 3300005841 Ga0068863_102021238 Ga0068863_1020212381 87
45 3300005843 Ga0068860_101211622 Ga0068860_1012116222 87
46 3300006237 Ga0097621_100468680 Ga0097621_1004686803 87
47 3300006358 Ga0068871_100573619 Ga0068871_1005736192 87
48 3300006931 Ga0097620_100050558 Ga0097620_1000505584 87
49 3300009101 Ga0105247_10033525 Ga0105247_100335254 87
50 3300009174 Ga0105241_10640445 Ga0105241_106404451 87
51 3300009177 Ga0105248_10036845 Ga0105248_100368453 87
52 3300013100 Ga0157373_10263662 Ga0157373_102636623 87
53 3300013102 Ga0157371_10533076 Ga0157371_105330763 87
54 3300013296 Ga0157374_10714681 Ga0157374_107146812 87
55 3300013296 Ga0157374_12049822 Ga0157374_120498221 87
56 3300014497 Ga0182008_10269127 Ga0182008_102691272 87
57 3300014497 Ga0182008_10567276 Ga0182008_105672762 87
58 3300014497 Ga0182008_10643347 Ga0182008_106433472 87
59 3300014968 Ga0157379_10097054 Ga0157379_100970544 87
60 3300025321 Ga0207656_10095685 Ga0207656_100956851 87
61 3300025900 Ga0207710_10254869 Ga0207710_102548693 87
62 3300025909 Ga0207705_11459962 Ga0207705_114599621 87
63 3300025911 Ga0207654_10783039 Ga0207654_107830392 87
64 3300025919 Ga0207657_10038269 Ga0207657_100382692 87
65 3300025925 Ga0207650_10263363 Ga0207650_102633632 87
66 3300025931 Ga0207644_10157695 Ga0207644_101576953 87
67 3300025933 Ga0207706_10065467 Ga0207706_100654672 87
68 3300025936 Ga0207670_10146789 Ga0207670_101467892 87
69 3300025937 Ga0207669_11653462 Ga0207669_116534622 87
70 3300025941 Ga0207711_10077025 Ga0207711_100770254 87
71 3300025945 Ga0207679_10011577 Ga0207679_100115775 87
72 3300025945 Ga0207679_11579560 Ga0207679_115795602 87
73 3300025960 Ga0207651_10392201 Ga0207651_103922011 87
74 3300025981 Ga0207640_11057757 Ga0207640_110577572 87
75 3300026035 Ga0207703_10143148 Ga0207703_101431482 87
76 3300026067 Ga0207678_10223810 Ga0207678_102238104 87
77 3300026116 Ga0207674_10096380 Ga0207674_100963805 87
78 3300026142 Ga0207698_10714343 Ga0207698_107143432 87
79 3300026142 Ga0207698_11672266 Ga0207698_116722662 87
80 3300028381 Ga0268264_10279749 Ga0268264_102797491 87
81 3300031911 Ga0307412_11169063 Ga0307412_111690631 87
82 3300031911 Ga0307412_11664852 Ga0307412_116648522 87
83 3300031995 Ga0307409_100361583 Ga0307409_1003615832 87
84 3300032004 Ga0307414_10402190 Ga0307414_104021903 87
85 3300032005 Ga0307411_10394421 Ga0307411_103944213 87
86 3300035085 Ga0373929_0085750 Ga0373929_0085750_182_445 87
87 3300037312 Ga0395899_0219329 Ga0395899_0219329_257_520 87
88 3300037312 Ga0395899_0341126 Ga0395899_0341126_296_571 87
89 3300037418 Ga0395900_0057719 Ga0395900_0057719_1938_2201 87
90 3300037418 Ga0395900_0363322 Ga0395900_0363322_443_718 87
91 3300037418 Ga0395900_0971261 Ga0395900_0971261_116_379 87
92 3300037466 Ga0395898_0106743 Ga0395898_0106743_977_1240 87
93 3300037466 Ga0395898_0248462 Ga0395898_0248462_361_636 87
94 3300037471 Ga0395905_0054589 Ga0395905_0054589_1030_1305 87
95 3300037471 Ga0395905_0058650 Ga0395905_0058650_1554_1817 87
96 3300037471 Ga0395905_1828315 Ga0395905_1828315_193_468 87
97 3300038443 Ga0395901_0211346 Ga0395901_0211346_701_976 87
98 3300038443 Ga0395901_0368050 Ga0395901_0368050_883_1146 87
99 3300044658 Ga0466972_0011608 Ga0466972_0011608_3592_3867 87
100 3300044658 Ga0466972_0169829 Ga0466972_0169829_596_871 87
101 3300044684 Ga0466966_0658151 Ga0466966_0658151_333_608 87
102 3300044693 Ga0466961_0157249 Ga0466961_0157249_278_553 87
103 3300044693 Ga0466961_0526576 Ga0466961_0526576_106_381 87
104 3300044694 Ga0466963_0013039 Ga0466963_0013039_3942_4217 87
105 3300044694 Ga0466963_0401227 Ga0466963_0401227_235_510 87
106 3300044706 Ga0466964_0229832 Ga0466964_0229832_568_831 87
107 3300044719 Ga0466971_0023572 Ga0466971_0023572_1504_1779 87
108 3300044719 Ga0466971_0584883 Ga0466971_0584883_46_321 87
109 3300044765 Ga0466970_0082103 Ga0466970_0082103_75_350 87
110 3300044765 Ga0466970_0137718 Ga0466970_0137718_701_976 87
111 3300044765 Ga0466970_0265387 Ga0466970_0265387_678_953 87
112 3300044842 Ga0466957_1119810 Ga0466957_1119810_85_360 87
113 3300045836 Ga0466958_0515498 Ga0466958_0515498_118_393 87
114 3300045976 Ga0466967_0080303 Ga0466967_0080303_218_493 87
115 3300045976 Ga0466967_0289552 Ga0466967_0289552_865_1128 87
116 3300045976 Ga0466967_0505046 Ga0466967_0505046_793_1068 87
117 3300045976 Ga0466967_1856142 Ga0466967_1856142_286_561 87
118 3300046537 Ga0495598_0002895 Ga0495598_0002895_3190_3459 87
119 3300046684 Ga0495669_0038263 Ga0495669_0038263_1021_1296 87
120 3300046691 Ga0495670_0020857 Ga0495670_0020857_138_407 87
121 3300048903 Ga0496100_0347203 Ga0496100_0347203_516_791 87
122 3300048904 Ga0496101_1452630 Ga0496101_1452630_183_458 87
123 3300048910 Ga0496107_0383736 Ga0496107_0383736_745_1020 87
124 3300048912 Ga0496109_0359344 Ga0496109_0359344_269_544 87
125 3300048915 Ga0496112_0111082 Ga0496112_0111082_1526_1801 87
126 3300048918 Ga0496115_0003219 Ga0496115_0003219_4951_5226 87
127 3300059421 Ga0590071_126721 Ga0590071_126721_358_621 87
128 3300061719 Ga0466962_0167755 Ga0466962_0167755_136_411 87
129 3300001979 JGI24740J21852_10162873 JGI24740J21852_101628732 88
130 3300001989 JGI24739J22299_10006988 JGI24739J22299_100069884 88
131 3300001991 JGI24743J22301_10007929 JGI24743J22301_100079292 88
132 3300002075 JGI24738J21930_10131838 JGI24738J21930_101318382 88
133 3300003320 rootH2_10095655 rootH2_100956555 88
134 3300003322 rootL2_10070917 rootL2_100709174 88
135 3300005290 Ga0065712_10019127 Ga0065712_100191271 88
136 3300005293 Ga0065715_10042422 Ga0065715_100424223 88
137 3300005327 Ga0070658_10000862 Ga0070658_1000086215 88
138 3300005327 Ga0070658_10040006 Ga0070658_100400063 88
139 3300005327 Ga0070658_10296866 Ga0070658_102968662 88
140 3300005327 Ga0070658_10307506 Ga0070658_103075062 88
141 3300005327 Ga0070658_10313163 Ga0070658_103131632 88
142 3300005327 Ga0070658_10320353 Ga0070658_103203533 88
143 3300005327 Ga0070658_10394351 Ga0070658_103943512 88
144 3300005327 Ga0070658_10954974 Ga0070658_109549742 88
145 3300005327 Ga0070658_11053300 Ga0070658_110533002 88
146 3300005327 Ga0070658_11652273 Ga0070658_116522732 88
147 3300005328 Ga0070676_10684358 Ga0070676_106843582 88
148 3300005329 Ga0070683_100092485 Ga0070683_1000924853 88
149 3300005329 Ga0070683_100321605 Ga0070683_1003216052 88
150 3300005329 Ga0070683_100562435 Ga0070683_1005624354 88
151 3300005331 Ga0070670_100158275 Ga0070670_1001582752 88
152 3300005333 Ga0070677_10009276 Ga0070677_100092764 88
153 3300005335 Ga0070666_10104009 Ga0070666_101040092 88
154 3300005335 Ga0070666_10763386 Ga0070666_107633861 88
155 3300005336 Ga0070680_100028527 Ga0070680_1000285274 88
156 3300005336 Ga0070680_100317940 Ga0070680_1003179402 88
157 3300005336 Ga0070680_100948711 Ga0070680_1009487112 88
158 3300005336 Ga0070680_101487251 Ga0070680_1014872512 88
159 3300005336 Ga0070680_101518376 Ga0070680_1015183762 88
160 3300005336 Ga0070680_101760227 Ga0070680_1017602271 88
161 3300005337 Ga0070682_100074245 Ga0070682_1000742454 88
162 3300005337 Ga0070682_100196997 Ga0070682_1001969973 88
163 3300005337 Ga0070682_100295734 Ga0070682_1002957341 88
164 3300005338 Ga0068868_101362035 Ga0068868_1013620352 88
165 3300005338 Ga0068868_101538001 Ga0068868_1015380012 88
166 3300005339 Ga0070660_100000043 Ga0070660_10000004338 88
167 3300005339 Ga0070660_100023147 Ga0070660_1000231472 88
168 3300005339 Ga0070660_100067006 Ga0070660_1000670064 88
169 3300005339 Ga0070660_100090322 Ga0070660_1000903224 88
170 3300005339 Ga0070660_100269533 Ga0070660_1002695332 88
171 3300005339 Ga0070660_100327635 Ga0070660_1003276353 88
172 3300005339 Ga0070660_101188439 Ga0070660_1011884392 88
173 3300005339 Ga0070660_101236943 Ga0070660_1012369432 88
174 3300005339 Ga0070660_101389364 Ga0070660_1013893642 88
175 3300005339 Ga0070660_101493230 Ga0070660_1014932301 88
176 3300005339 Ga0070660_101890032 Ga0070660_1018900321 88
177 3300005344 Ga0070661_100067576 Ga0070661_1000675763 88
178 3300005344 Ga0070661_100071178 Ga0070661_1000711784 88
179 3300005344 Ga0070661_100660041 Ga0070661_1006600413 88
180 3300005344 Ga0070661_101161891 Ga0070661_1011618912 88
181 3300005344 Ga0070661_101476505 Ga0070661_1014765052 88
182 3300005345 Ga0070692_10023696 Ga0070692_100236964 88
183 3300005345 Ga0070692_10139403 Ga0070692_101394033 88
184 3300005345 Ga0070692_10376660 Ga0070692_103766602 88
185 3300005353 Ga0070669_100555551 Ga0070669_1005555512 88
186 3300005353 Ga0070669_101731190 Ga0070669_1017311902 88
187 3300005354 Ga0070675_100109951 Ga0070675_1001099514 88
188 3300005355 Ga0070671_100726234 Ga0070671_1007262343 88
189 3300005356 Ga0070674_100249590 Ga0070674_1002495902 88
190 3300005364 Ga0070673_100023615 Ga0070673_1000236154 88
191 3300005364 Ga0070673_102076261 Ga0070673_1020762612 88
192 3300005366 Ga0070659_100011471 Ga0070659_1000114714 88
193 3300005366 Ga0070659_100044366 Ga0070659_1000443662 88
194 3300005366 Ga0070659_100164859 Ga0070659_1001648593 88
195 3300005366 Ga0070659_100303086 Ga0070659_1003030862 88
196 3300005366 Ga0070659_100702297 Ga0070659_1007022972 88
197 3300005366 Ga0070659_100787211 Ga0070659_1007872113 88
198 3300005366 Ga0070659_101625421 Ga0070659_1016254211 88
199 3300005367 Ga0070667_100000842 Ga0070667_10000084239 88
200 3300005435 Ga0070714_100881733 Ga0070714_1008817332 88
201 3300005455 Ga0070663_100003726 Ga0070663_1000037263 88
202 3300005455 Ga0070663_100015611 Ga0070663_1000156114 88
203 3300005455 Ga0070663_100030813 Ga0070663_1000308134 88
204 3300005455 Ga0070663_100041985 Ga0070663_1000419854 88
205 3300005455 Ga0070663_100049675 Ga0070663_1000496755 88
206 3300005455 Ga0070663_100533654 Ga0070663_1005336542 88
207 3300005457 Ga0070662_100006841 Ga0070662_1000068415 88
208 3300005457 Ga0070662_100068657 Ga0070662_1000686574 88
209 3300005458 Ga0070681_10192911 Ga0070681_101929112 88
210 3300005458 Ga0070681_10454917 Ga0070681_104549174 88
211 3300005458 Ga0070681_11251030 Ga0070681_112510301 88
212 3300005530 Ga0070679_100098292 Ga0070679_1000982923 88
213 3300005530 Ga0070679_100532960 Ga0070679_1005329602 88
214 3300005530 Ga0070679_101431719 Ga0070679_1014317192 88
215 3300005535 Ga0070684_101647831 Ga0070684_1016478312 88
216 3300005539 Ga0068853_100102276 Ga0068853_1001022764 88
217 3300005539 Ga0068853_100227657 Ga0068853_1002276572 88
218 3300005543 Ga0070672_101886194 Ga0070672_1018861942 88
219 3300005546 Ga0070696_100804547 Ga0070696_1008045472 88
220 3300005548 Ga0070665_100009746 Ga0070665_1000097465 88
221 3300005548 Ga0070665_100346158 Ga0070665_1003461581 88
222 3300005563 Ga0068855_100000292 Ga0068855_10000029216 88
223 3300005563 Ga0068855_100469011 Ga0068855_1004690113 88
224 3300005563 Ga0068855_100503908 Ga0068855_1005039083 88
225 3300005563 Ga0068855_100717679 Ga0068855_1007176791 88
226 3300005563 Ga0068855_101378433 Ga0068855_1013784332 88
227 3300005563 Ga0068855_102418449 Ga0068855_1024184492 88
228 3300005564 Ga0070664_100005116 Ga0070664_10000511613 88
229 3300005564 Ga0070664_100030392 Ga0070664_1000303923 88
230 3300005564 Ga0070664_100033988 Ga0070664_1000339885 88
231 3300005564 Ga0070664_100138010 Ga0070664_1001380104 88
232 3300005564 Ga0070664_100355472 Ga0070664_1003554722 88
233 3300005564 Ga0070664_100991746 Ga0070664_1009917462 88
234 3300005577 Ga0068857_100039193 Ga0068857_1000391932 88
235 3300005577 Ga0068857_100041588 Ga0068857_1000415884 88
236 3300005577 Ga0068857_100256690 Ga0068857_1002566904 88
237 3300005577 Ga0068857_101077646 Ga0068857_1010776462 88
238 3300005577 Ga0068857_102040662 Ga0068857_1020406621 88
239 3300005578 Ga0068854_100100037 Ga0068854_1001000373 88
240 3300005578 Ga0068854_100118372 Ga0068854_1001183724 88
241 3300005578 Ga0068854_100163583 Ga0068854_1001635832 88
242 3300005578 Ga0068854_100470361 Ga0068854_1004703613 88
243 3300005578 Ga0068854_102162666 Ga0068854_1021626662 88
244 3300005614 Ga0068856_100082771 Ga0068856_1000827713 88
245 3300005614 Ga0068856_100083199 Ga0068856_1000831996 88
246 3300005614 Ga0068856_100333771 Ga0068856_1003337714 88
247 3300005614 Ga0068856_100487685 Ga0068856_1004876852 88
248 3300005614 Ga0068856_102497370 Ga0068856_1024973701 88
249 3300005616 Ga0068852_100055625 Ga0068852_1000556254 88
250 3300005616 Ga0068852_100205787 Ga0068852_1002057874 88
251 3300005616 Ga0068852_100257478 Ga0068852_1002574784 88
252 3300005616 Ga0068852_100303323 Ga0068852_1003033233 88
253 3300005617 Ga0068859_100336509 Ga0068859_1003365094 88
254 3300005617 Ga0068859_100647551 Ga0068859_1006475512 88
255 3300005618 Ga0068864_101604630 Ga0068864_1016046302 88
256 3300005719 Ga0068861_100428606 Ga0068861_1004286062 88
257 3300005834 Ga0068851_10001858 Ga0068851_1000185812 88
258 3300005834 Ga0068851_10133914 Ga0068851_101339142 88
259 3300005842 Ga0068858_100745351 Ga0068858_1007453512 88
260 3300006358 Ga0068871_102109670 Ga0068871_1021096702 88
261 3300006881 Ga0068865_100979784 Ga0068865_1009797841 88
262 3300006931 Ga0097620_100336486 Ga0097620_1003364864 88
263 3300006931 Ga0097620_100647601 Ga0097620_1006476012 88
264 3300009093 Ga0105240_10383102 Ga0105240_103831024 88
265 3300009174 Ga0105241_10127427 Ga0105241_101274274 88
266 3300009174 Ga0105241_10129214 Ga0105241_101292143 88
267 3300009177 Ga0105248_10086568 Ga0105248_100865682 88
268 3300009177 Ga0105248_11491481 Ga0105248_114914812 88
269 3300013100 Ga0157373_10021899 Ga0157373_100218997 88
270 3300013100 Ga0157373_10041978 Ga0157373_100419786 88
271 3300013100 Ga0157373_10099426 Ga0157373_100994264 88
272 3300013100 Ga0157373_10252878 Ga0157373_102528783 88
273 3300013100 Ga0157373_11318624 Ga0157373_113186242 88
274 3300013102 Ga0157371_10002967 Ga0157371_100029674 88
275 3300013102 Ga0157371_10105798 Ga0157371_101057983 88
276 3300013102 Ga0157371_10215167 Ga0157371_102151673 88
277 3300013102 Ga0157371_10364603 Ga0157371_103646032 88
278 3300013102 Ga0157371_10427984 Ga0157371_104279842 88
279 3300013104 Ga0157370_10003954 Ga0157370_1000395410 88
280 3300013104 Ga0157370_10038140 Ga0157370_100381404 88
281 3300013104 Ga0157370_10071777 Ga0157370_100717775 88
282 3300013104 Ga0157370_10241258 Ga0157370_102412582 88
283 3300013104 Ga0157370_10330420 Ga0157370_103304203 88
284 3300013104 Ga0157370_10473729 Ga0157370_104737293 88
285 3300013104 Ga0157370_11270934 Ga0157370_112709342 88
286 3300013105 Ga0157369_10047795 Ga0157369_100477954 88
287 3300013105 Ga0157369_10068332 Ga0157369_100683322 88
288 3300013105 Ga0157369_11625049 Ga0157369_116250492 88
289 3300013105 Ga0157369_12703929 Ga0157369_127039291 88
290 3300013296 Ga0157374_10047143 Ga0157374_100471432 88
291 3300013307 Ga0157372_10478352 Ga0157372_104783524 88
292 3300013307 Ga0157372_10614767 Ga0157372_106147673 88
293 3300013307 Ga0157372_10712592 Ga0157372_107125923 88
294 3300013307 Ga0157372_11230225 Ga0157372_112302251 88
295 3300013307 Ga0157372_11555876 Ga0157372_115558761 88
296 3300013307 Ga0157372_12701417 Ga0157372_127014172 88
297 3300025321 Ga0207656_10062520 Ga0207656_100625204 88
298 3300025904 Ga0207647_10034699 Ga0207647_100346994 88
299 3300025904 Ga0207647_10057301 Ga0207647_100573014 88
300 3300025904 Ga0207647_10113491 Ga0207647_101134912 88
301 3300025909 Ga0207705_10000238 Ga0207705_1000023815 88
302 3300025909 Ga0207705_10026504 Ga0207705_100265041 88
303 3300025909 Ga0207705_10029001 Ga0207705_100290012 88
304 3300025909 Ga0207705_10083286 Ga0207705_100832865 88
305 3300025909 Ga0207705_10085270 Ga0207705_100852702 88
306 3300025909 Ga0207705_10124868 Ga0207705_101248683 88
307 3300025909 Ga0207705_10174579 Ga0207705_101745793 88
308 3300025909 Ga0207705_10474948 Ga0207705_104749483 88
309 3300025911 Ga0207654_10455212 Ga0207654_104552122 88
310 3300025912 Ga0207707_10092415 Ga0207707_100924153 88
311 3300025912 Ga0207707_10463097 Ga0207707_104630972 88
312 3300025917 Ga0207660_10058884 Ga0207660_100588844 88
313 3300025917 Ga0207660_10068549 Ga0207660_100685492 88
314 3300025917 Ga0207660_10832520 Ga0207660_108325202 88
315 3300025917 Ga0207660_11083286 Ga0207660_110832862 88
316 3300025919 Ga0207657_10000374 Ga0207657_1000037415 88
317 3300025919 Ga0207657_10033397 Ga0207657_100333974 88
318 3300025919 Ga0207657_10040335 Ga0207657_100403354 88
319 3300025919 Ga0207657_10044364 Ga0207657_100443647 88
320 3300025919 Ga0207657_10106702 Ga0207657_101067022 88
321 3300025919 Ga0207657_10130785 Ga0207657_101307852 88
322 3300025919 Ga0207657_10259636 Ga0207657_102596363 88
323 3300025919 Ga0207657_10317571 Ga0207657_103175712 88
324 3300025919 Ga0207657_10326758 Ga0207657_103267583 88
325 3300025920 Ga0207649_10373544 Ga0207649_103735443 88
326 3300025920 Ga0207649_10407817 Ga0207649_104078171 88
327 3300025920 Ga0207649_11324015 Ga0207649_113240152 88
328 3300025921 Ga0207652_10070735 Ga0207652_100707353 88
329 3300025921 Ga0207652_10163816 Ga0207652_101638162 88
330 3300025921 Ga0207652_10468183 Ga0207652_104681832 88
331 3300025923 Ga0207681_10151640 Ga0207681_101516404 88
332 3300025925 Ga0207650_10695729 Ga0207650_106957292 88
333 3300025925 Ga0207650_11809917 Ga0207650_118099172 88
334 3300025926 Ga0207659_11099075 Ga0207659_110990752 88
335 3300025932 Ga0207690_10097358 Ga0207690_100973582 88
336 3300025932 Ga0207690_10111200 Ga0207690_101112004 88
337 3300025932 Ga0207690_10186602 Ga0207690_101866023 88
338 3300025932 Ga0207690_10464277 Ga0207690_104642773 88
339 3300025932 Ga0207690_10501688 Ga0207690_105016882 88
340 3300025932 Ga0207690_10796629 Ga0207690_107966292 88
341 3300025932 Ga0207690_11065895 Ga0207690_110658952 88
342 3300025933 Ga0207706_10001098 Ga0207706_100010982 88
343 3300025933 Ga0207706_10032835 Ga0207706_100328355 88
344 3300025933 Ga0207706_10169165 Ga0207706_101691652 88
345 3300025933 Ga0207706_10281830 Ga0207706_102818302 88
346 3300025933 Ga0207706_10903334 Ga0207706_109033342 88
347 3300025933 Ga0207706_11415801 Ga0207706_114158011 88
348 3300025937 Ga0207669_11071802 Ga0207669_110718022 88
349 3300025938 Ga0207704_11931326 Ga0207704_119313262 88
350 3300025941 Ga0207711_10094377 Ga0207711_100943772 88
351 3300025944 Ga0207661_10008399 Ga0207661_100083991 88
352 3300025944 Ga0207661_10025197 Ga0207661_100251975 88
353 3300025944 Ga0207661_11065571 Ga0207661_110655711 88
354 3300025945 Ga0207679_10014157 Ga0207679_100141577 88
355 3300025945 Ga0207679_10108148 Ga0207679_101081484 88
356 3300025945 Ga0207679_10362464 Ga0207679_103624642 88
357 3300025945 Ga0207679_10711435 Ga0207679_107114353 88
358 3300025949 Ga0207667_10000576 Ga0207667_1000057635 88
359 3300025949 Ga0207667_10090761 Ga0207667_100907612 88
360 3300025949 Ga0207667_10691086 Ga0207667_106910862 88
361 3300025949 Ga0207667_10867459 Ga0207667_108674592 88
362 3300025960 Ga0207651_10319340 Ga0207651_103193404 88
363 3300025981 Ga0207640_10293317 Ga0207640_102933172 88
364 3300025981 Ga0207640_10299579 Ga0207640_102995793 88
365 3300025981 Ga0207640_10301244 Ga0207640_103012441 88
366 3300025981 Ga0207640_11275355 Ga0207640_112753552 88
367 3300025986 Ga0207658_10071250 Ga0207658_100712502 88
368 3300025986 Ga0207658_10076645 Ga0207658_100766454 88
369 3300026023 Ga0207677_10146930 Ga0207677_101469303 88
370 3300026023 Ga0207677_10220964 Ga0207677_102209642 88
371 3300026035 Ga0207703_12400441 Ga0207703_124004412 88
372 3300026041 Ga0207639_10085291 Ga0207639_100852911 88
373 3300026041 Ga0207639_10118320 Ga0207639_101183202 88
374 3300026041 Ga0207639_10917284 Ga0207639_109172841 88
375 3300026067 Ga0207678_10000989 Ga0207678_1000098922 88
376 3300026067 Ga0207678_10001579 Ga0207678_1000157913 88
377 3300026067 Ga0207678_10022721 Ga0207678_100227214 88
378 3300026067 Ga0207678_10153784 Ga0207678_101537842 88
379 3300026067 Ga0207678_10182026 Ga0207678_101820262 88
380 3300026078 Ga0207702_10064698 Ga0207702_100646983 88
381 3300026078 Ga0207702_10163764 Ga0207702_101637642 88
382 3300026078 Ga0207702_10168553 Ga0207702_101685533 88
383 3300026078 Ga0207702_10442663 Ga0207702_104426633 88
384 3300026078 Ga0207702_10448767 Ga0207702_104487673 88
385 3300026116 Ga0207674_10035098 Ga0207674_100350988 88
386 3300026116 Ga0207674_10035328 Ga0207674_100353287 88
387 3300026116 Ga0207674_10078342 Ga0207674_100783422 88
388 3300026116 Ga0207674_10753485 Ga0207674_107534853 88
389 3300026142 Ga0207698_10040595 Ga0207698_100405954 88
390 3300026142 Ga0207698_10266161 Ga0207698_102661613 88
391 3300026142 Ga0207698_10305848 Ga0207698_103058484 88
392 3300026142 Ga0207698_10641337 Ga0207698_106413373 88
393 3300028379 Ga0268266_10183778 Ga0268266_101837784 88
394 3300031548 Ga0307408_100009489 Ga0307408_1000094898 88
395 3300031548 Ga0307408_100021515 Ga0307408_1000215155 88
396 3300031731 Ga0307405_10084630 Ga0307405_100846304 88
397 3300031731 Ga0307405_10233033 Ga0307405_102330332 88
398 3300031731 Ga0307405_10559181 Ga0307405_105591812 88
399 3300031824 Ga0307413_10309873 Ga0307413_103098731 88
400 3300031824 Ga0307413_10459462 Ga0307413_104594622 88
401 3300031824 Ga0307413_10876323 Ga0307413_108763233 88
402 3300031824 Ga0307413_11637308 Ga0307413_116373082 88
403 3300031852 Ga0307410_10005912 Ga0307410_100059123 88
404 3300031852 Ga0307410_10157840 Ga0307410_101578403 88
405 3300031852 Ga0307410_10200931 Ga0307410_102009312 88
406 3300031901 Ga0307406_10049377 Ga0307406_100493772 88
407 3300031901 Ga0307406_10168493 Ga0307406_101684933 88
408 3300031901 Ga0307406_10199252 Ga0307406_101992522 88
409 3300031901 Ga0307406_10432323 Ga0307406_104323232 88
410 3300031903 Ga0307407_10012151 Ga0307407_100121515 88
411 3300031903 Ga0307407_10084958 Ga0307407_100849582 88
412 3300031903 Ga0307407_10419983 Ga0307407_104199832 88
413 3300031911 Ga0307412_10031102 Ga0307412_100311022 88
414 3300031911 Ga0307412_10106783 Ga0307412_101067832 88
415 3300031911 Ga0307412_11732565 Ga0307412_117325652 88
416 3300031995 Ga0307409_100019126 Ga0307409_1000191263 88
417 3300031995 Ga0307409_100293210 Ga0307409_1002932102 88
418 3300031995 Ga0307409_100349777 Ga0307409_1003497773 88
419 3300031995 Ga0307409_100689976 Ga0307409_1006899763 88
420 3300031995 Ga0307409_102188109 Ga0307409_1021881092 88
421 3300032002 Ga0307416_100028519 Ga0307416_1000285196 88
422 3300032002 Ga0307416_100253616 Ga0307416_1002536162 88
423 3300032002 Ga0307416_100340776 Ga0307416_1003407763 88
424 3300032002 Ga0307416_100348964 Ga0307416_1003489643 88
425 3300032004 Ga0307414_10002526 Ga0307414_100025264 88
426 3300032004 Ga0307414_10197937 Ga0307414_101979373 88
427 3300032005 Ga0307411_10012101 Ga0307411_100121016 88
428 3300032005 Ga0307411_10032212 Ga0307411_100322123 88
429 3300032005 Ga0307411_10357163 Ga0307411_103571633 88
430 3300032126 Ga0307415_100219838 Ga0307415_1002198382 88
431 3300032126 Ga0307415_100572265 Ga0307415_1005722652 88
432 3300037312 Ga0395899_0010184 Ga0395899_0010184_3333_3599 88
433 3300037312 Ga0395899_0063340 Ga0395899_0063340_1242_1508 88
434 3300037312 Ga0395899_0063762 Ga0395899_0063762_1531_1797 88
435 3300037312 Ga0395899_0082928 Ga0395899_0082928_690_956 88
436 3300037312 Ga0395899_0143086 Ga0395899_0143086_741_1007 88
437 3300037312 Ga0395899_0156903 Ga0395899_0156903_664_936 88
438 3300037312 Ga0395899_0511301 Ga0395899_0511301_305_571 88
439 3300037312 Ga0395899_0935523 Ga0395899_0935523_45_311 88
440 3300037418 Ga0395900_0092960 Ga0395900_0092960_319_585 88
441 3300037418 Ga0395900_0094089 Ga0395900_0094089_1037_1303 88
442 3300037418 Ga0395900_0124035 Ga0395900_0124035_1288_1554 88
443 3300037418 Ga0395900_0214138 Ga0395900_0214138_331_615 88
444 3300037418 Ga0395900_0220856 Ga0395900_0220856_1347_1625 88
445 3300037418 Ga0395900_0437241 Ga0395900_0437241_704_970 88
446 3300037418 Ga0395900_0531269 Ga0395900_0531269_211_489 88
447 3300037418 Ga0395900_0639264 Ga0395900_0639264_349_615 88
448 3300037418 Ga0395900_0820300 Ga0395900_0820300_402_668 88
449 3300037418 Ga0395900_1003734 Ga0395900_1003734_18_284 88
450 3300037466 Ga0395898_0076467 Ga0395898_0076467_2543_2809 88
451 3300037466 Ga0395898_0116659 Ga0395898_0116659_832_1104 88
452 3300037466 Ga0395898_0133848 Ga0395898_0133848_907_1173 88
453 3300037466 Ga0395898_0264782 Ga0395898_0264782_173_439 88
454 3300037466 Ga0395898_1550768 Ga0395898_1550768_67_333 88
455 3300037471 Ga0395905_0012515 Ga0395905_0012515_1735_2001 88
456 3300037471 Ga0395905_0054282 Ga0395905_0054282_1917_2183 88
457 3300037471 Ga0395905_0161087 Ga0395905_0161087_712_978 88
458 3300037471 Ga0395905_0257223 Ga0395905_0257223_649_915 88
459 3300037471 Ga0395905_0472788 Ga0395905_0472788_737_1003 88
460 3300037471 Ga0395905_0521312 Ga0395905_0521312_639_911 88
461 3300037471 Ga0395905_0536109 Ga0395905_0536109_307_585 88
462 3300037471 Ga0395905_1000899 Ga0395905_1000899_34_312 88
463 3300037471 Ga0395905_1600031 Ga0395905_1600031_120_392 88
464 3300037471 Ga0395905_1619287 Ga0395905_1619287_32_307 88
465 3300038443 Ga0395901_0079488 Ga0395901_0079488_921_1187 88
466 3300038443 Ga0395901_0158555 Ga0395901_0158555_910_1176 88
467 3300038443 Ga0395901_0180592 Ga0395901_0180592_787_1053 88
468 3300038443 Ga0395901_0282145 Ga0395901_0282145_387_653 88
469 3300038443 Ga0395901_0427922 Ga0395901_0427922_732_998 88
470 3300038443 Ga0395901_0622789 Ga0395901_0622789_61_339 88
471 3300038443 Ga0395901_0893157 Ga0395901_0893157_590_859 88
472 3300038443 Ga0395901_0901023 Ga0395901_0901023_236_508 88
473 3300038443 Ga0395901_1102121 Ga0395901_1102121_123_389 88
474 3300038443 Ga0395901_1353090 Ga0395901_1353090_348_626 88
475 3300038443 Ga0395901_2024834 Ga0395901_2024834_56_334 88
476 3300041413 Ga0439465_0247436 Ga0439465_0247436_51_317 88
477 3300041999 Ga0439433_0136142 Ga0439433_0136142_211_477 88
478 3300042007 Ga0439449_0043432 Ga0439449_0043432_649_915 88
479 3300044656 Ga0466969_0099524 Ga0466969_0099524_758_1024 88
480 3300044658 Ga0466972_0060729 Ga0466972_0060729_1017_1283 88
481 3300044683 Ga0466965_0655401 Ga0466965_0655401_233_511 88
482 3300044684 Ga0466966_0000003 Ga0466966_0000003_137261_137527 88
483 3300044684 Ga0466966_0041887 Ga0466966_0041887_201_467 88
484 3300044684 Ga0466966_0405896 Ga0466966_0405896_409_684 88
485 3300044694 Ga0466963_0033198 Ga0466963_0033198_1543_1809 88
486 3300044694 Ga0466963_0047183 Ga0466963_0047183_1433_1714 88
487 3300044706 Ga0466964_0742343 Ga0466964_0742343_122_391 88
488 3300044719 Ga0466971_0046333 Ga0466971_0046333_578_856 88
489 3300044719 Ga0466971_0222631 Ga0466971_0222631_618_884 88
490 3300044735 Ga0466968_0201875 Ga0466968_0201875_591_869 88
491 3300044842 Ga0466957_0016739 Ga0466957_0016739_1356_1634 88
492 3300044842 Ga0466957_0023680 Ga0466957_0023680_1654_1923 88
493 3300044842 Ga0466957_0280495 Ga0466957_0280495_96_377 88
494 3300044842 Ga0466957_1437003 Ga0466957_1437003_140_406 88
495 3300044901 Ga0466960_0156275 Ga0466960_0156275_805_1074 88
496 3300045049 Ga0466959_0447866 Ga0466959_0447866_409_675 88
497 3300045836 Ga0466958_0373142 Ga0466958_0373142_374_640 88
498 3300045976 Ga0466967_0040698 Ga0466967_0040698_677_946 88
499 3300045976 Ga0466967_0210372 Ga0466967_0210372_1224_1502 88
500 3300045976 Ga0466967_0472157 Ga0466967_0472157_664_933 88
501 3300045976 Ga0466967_0551769 Ga0466967_0551769_424_705 88
502 3300046515 Ga0495620_0035355 Ga0495620_0035355_235_501 88
503 3300048910 Ga0496107_0046892 Ga0496107_0046892_1070_1348 88
504 3300048911 Ga0496108_0417395 Ga0496108_0417395_558_827 88
505 3300048912 Ga0496109_0276949 Ga0496109_0276949_191_457 88
506 3300048912 Ga0496109_1021303 Ga0496109_1021303_251_520 88
507 3300048913 Ga0496110_0269270 Ga0496110_0269270_492_761 88
508 3300048914 Ga0496111_0173010 Ga0496111_0173010_102_371 88
509 3300048915 Ga0496112_0058370 Ga0496112_0058370_2936_3214 88
510 3300048916 Ga0496113_0182481 Ga0496113_0182481_839_1117 88
511 3300049586 Ga0501070_0101169 Ga0501070_0101169_207_476 88
512 3300049587 Ga0501071_0274150 Ga0501071_0274150_167_445 88
513 3300049590 Ga0501074_0402375 Ga0501074_0402375_128_397 88
514 3300049650 Ga0501199_021581 Ga0501199_021581_129_395 88
515 3300049652 Ga0501202_027307 Ga0501202_027307_857_1123 88
516 3300049656 Ga0501209_097225 Ga0501209_097225_526_792 88
517 3300049659 Ga0501214_105158 Ga0501214_105158_11_277 88
518 3300049660 Ga0501216_002143 Ga0501216_002143_446_712 88
519 3300049661 Ga0501217_026914 Ga0501217_026914_957_1223 88
520 3300049663 Ga0501223_011633 Ga0501223_011633_1460_1726 88
521 3300049664 Ga0501224_024655 Ga0501224_024655_259_525 88
522 3300049667 Ga0501230_008273 Ga0501230_008273_698_964 88
523 3300049669 Ga0501235_049396 Ga0501235_049396_70_336 88
524 3300049670 Ga0501236_014611 Ga0501236_014611_232_498 88
525 3300049673 Ga0501240_117672 Ga0501240_117672_70_336 88
526 3300049675 Ga0501243_018507 Ga0501243_018507_434_700 88
527 3300049677 Ga0501247_037213 Ga0501247_037213_263_529 88
528 3300049679 Ga0501249_069215 Ga0501249_069215_73_339 88
529 3300049682 Ga0501252_009058 Ga0501252_009058_10_276 88
530 3300049686 Ga0501257_019765 Ga0501257_019765_1055_1321 88
531 3300049687 Ga0501258_003893 Ga0501258_003893_244_510 88
532 3300049689 Ga0501260_021734 Ga0501260_021734_47_313 88
533 3300049703 Ga0501219_007603 Ga0501219_007603_418_684 88
534 3300049704 Ga0501221_025172 Ga0501221_025172_772_1038 88
535 3300049705 Ga0501225_0031513 Ga0501225_0031513_505_771 88
536 3300049706 Ga0501229_073569 Ga0501229_073569_156_422 88
537 3300049742 Ga0501080_0420935 Ga0501080_0420935_713_991 88
538 3300049758 Ga0501241_041667 Ga0501241_041667_604_870 88
539 3300049764 Ga0501267_006424 Ga0501267_006424_821_1087 88
540 3300049765 Ga0501268_012411 Ga0501268_012411_659_925 88
541 3300049765 Ga0501268_161888 Ga0501268_161888_229_495 88
542 3300049769 Ga0501272_004046 Ga0501272_004046_1064_1330 88
543 3300049770 Ga0501273_051073 Ga0501273_051073_160_426 88
544 3300049850 Ga0501204_028731 Ga0501204_028731_476_742 88
545 3300049850 Ga0501204_079010 Ga0501204_079010_145_411 88
546 3300049851 Ga0501212_027228 Ga0501212_027228_526_792 88
547 3300061719 Ga0466962_0701195 Ga0466962_0701195_158_424 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19447

DUF5985

Family of unknown function (DUF5985)

10

90

0.96

Feature Viewer

pLDDT pTM Quality
69.1 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map