F462128

General Info

Members Datasets Scaffolds Average Seq Length
547 308 1094 191

Family's Representative Sequence

Representative Sequence 3300035091|Ga0373951_0000001|Ga0373951_0000001_111394_112032
Length 212
Sequence VEQDRRIAHAGSSDYTEGRILMIRIGIILGSTRPNRNGEQVARWVLDIAVQRTDAEFELVDLRDYPMPHLDEPIPPSMGQYQNDHTKDWAAKIAAFDGFVFVTPEYNHSTSGVLKNAIDYLYAEWNNKAVGLVSYGSVGGARAAEHLRLVVAELQMADVRQQVTLALATEFENYTVFTPSDSQQPQLTTMLDQVVAWSAALAPLRSPVTASA

Samples

Sample ID Description Type Environment
1 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
108 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
109 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
110 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
111 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
112 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
278 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
279 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
280 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
283 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
286 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
293 2687453737 Frankia sp. BMG5.36 Isolate Nodule
294 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
295 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
296 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
297 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
298 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
299 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
300 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
301 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
302 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
303 2920879853 Kocuria salina CV6 Isolate Unclassified
304 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
305 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
306 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
307 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
308 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 1.83
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.11
Nodule 0.18
Rhizoplane 9.69
Rhizosphere 81.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373951_0000001 3300035091 Bacteria 119231
2 CNBas_1006793 3300000531 Bacteria 665
3 JGI24743J22301_10075130 3300001991 Bacteria 708
4 JGI24745J21846_1021429 3300002073 Bacteria 760
5 JGI24738J21930_10055373 3300002075 Bacteria 810
6 JGI24738J21930_10056022 3300002075 Bacteria 806
7 JGI24744J21845_10034590 3300002077 Bacteria 958
8 JGI24742J22300_10050770 3300002244 Bacteria 751
9 JGI25406J46586_10014783 3300003203 Bacteria 3311
10 rootH1_10085067 3300003316 Bacteria 4062
11 rootH2_10263501 3300003320 Bacteria 1269
12 rootL2_10167222 3300003322 Bacteria 1817
13 JGI25407J50210_10015270 3300003373 Bacteria 1982
14 JGI25407J50210_10044987 3300003373 Bacteria 1126
15 Ga0070658_10021400 3300005327 Bacteria 5183
16 Ga0070658_10046538 3300005327 Bacteria 3510
17 Ga0070683_100013260 3300005329 Bacteria 7184
18 Ga0070683_101152526 3300005329 Bacteria 745
19 Ga0070690_100285582 3300005330 Bacteria 1178
20 Ga0068869_100108975 3300005334 Bacteria 2104
21 Ga0070666_10209236 3300005335 Bacteria 1373
22 Ga0070680_100143871 3300005336 Bacteria 2000
23 Ga0070680_100182601 3300005336 Bacteria 1767
24 Ga0070682_100037989 3300005337 Bacteria 2951
25 Ga0070682_100178963 3300005337 Bacteria 1479
26 Ga0070682_100209140 3300005337 Bacteria 1381
27 Ga0070682_100834184 3300005337 Bacteria 752
28 Ga0070660_100094328 3300005339 Bacteria 2364
29 Ga0070660_100113375 3300005339 Bacteria 2159
30 Ga0070660_100317376 3300005339 Bacteria 1279
31 Ga0070660_100388726 3300005339 Bacteria 1152
32 Ga0070689_100015455 3300005340 Bacteria 5567
33 Ga0070689_100148384 3300005340 Bacteria 1890
34 Ga0070691_10040323 3300005341 Bacteria 2206
35 Ga0070687_100160345 3300005343 Bacteria 1329
36 Ga0070687_100390635 3300005343 Bacteria 909
37 Ga0070692_10073856 3300005345 Bacteria 1823
38 Ga0070692_10181608 3300005345 Bacteria 1220
39 Ga0070668_100012764 3300005347 Bacteria 6252
40 Ga0070668_100101018 3300005347 Bacteria 2285
41 Ga0070668_100665300 3300005347 Bacteria 916
42 Ga0070669_100065824 3300005353 Bacteria 2670
43 Ga0070669_100527016 3300005353 Bacteria 983
44 Ga0070675_100103824 3300005354 Bacteria 2397
45 Ga0070675_101082675 3300005354 Bacteria 737
46 Ga0070671_100077787 3300005355 Bacteria 2773
47 Ga0070671_100594745 3300005355 Bacteria 956
48 Ga0070674_100251916 3300005356 Bacteria 1387
49 Ga0070673_100138395 3300005364 Bacteria 2052
50 Ga0070673_100532353 3300005364 Bacteria 1066
51 Ga0070673_101100759 3300005364 Bacteria 742
52 Ga0070688_100082077 3300005365 Bacteria 2089
53 Ga0070688_100117431 3300005365 Bacteria 1777
54 Ga0070659_100064482 3300005366 Bacteria 2899
55 Ga0070659_100146368 3300005366 Bacteria 1925
56 Ga0070667_100354353 3300005367 Bacteria 1329
57 Ga0070667_100923579 3300005367 Bacteria 813
58 Ga0070703_10032264 3300005406 Bacteria 1590
59 Ga0070709_10060123 3300005434 Bacteria 2414
60 Ga0070709_10561317 3300005434 Bacteria 875
61 Ga0070714_100080154 3300005435 Bacteria 2840
62 Ga0070714_100121460 3300005435 Bacteria 2324
63 Ga0070714_100207843 3300005435 Bacteria 1793
64 Ga0070714_100456288 3300005435 Bacteria 1214
65 Ga0070713_100051852 3300005436 Bacteria 3395
66 Ga0070713_100239644 3300005436 Bacteria 1651
67 Ga0070713_101124034 3300005436 Bacteria 760
68 Ga0070710_10010055 3300005437 Bacteria 4639
69 Ga0070701_10019429 3300005438 Bacteria 3209
70 Ga0070701_10034021 3300005438 Bacteria 2551
71 Ga0070711_100082806 3300005439 Bacteria 2291
72 Ga0070711_100544837 3300005439 Bacteria 962
73 Ga0070711_101380811 3300005439 Bacteria 613
74 Ga0070700_100075999 3300005441 Bacteria 2156
75 Ga0070700_100723895 3300005441 Bacteria 793
76 Ga0070694_100030428 3300005444 Bacteria 3532
77 Ga0070663_100135297 3300005455 Bacteria 1876
78 Ga0070678_100019117 3300005456 Bacteria 4457
79 Ga0070662_100046296 3300005457 Bacteria 3126
80 Ga0070662_100648753 3300005457 Bacteria 890
81 Ga0070681_10225549 3300005458 Bacteria 1788
82 Ga0068867_100602720 3300005459 Bacteria 958
83 Ga0068867_100634107 3300005459 Bacteria 936
84 Ga0070685_10034413 3300005466 Bacteria 2853
85 Ga0070685_10243712 3300005466 Bacteria 1187
86 Ga0070707_100000609 3300005468 Bacteria 35923
87 Ga0070698_100000690 3300005471 Bacteria 36042
88 Ga0070698_100640132 3300005471 Bacteria 1004
89 Ga0070679_100241687 3300005530 Bacteria 1763
90 Ga0070684_100002397 3300005535 Bacteria 13817
91 Ga0070684_100344637 3300005535 Bacteria 1370
92 Ga0070684_100549322 3300005535 Bacteria 1072
93 Ga0070697_100167283 3300005536 Bacteria 1860
94 Ga0068853_100069402 3300005539 Bacteria 3066
95 Ga0068853_100166224 3300005539 Bacteria 1994
96 Ga0070686_100008011 3300005544 Bacteria 5905
97 Ga0070695_100039936 3300005545 Bacteria 2968
98 Ga0070696_100010156 3300005546 Bacteria 6303
99 Ga0070693_100048347 3300005547 Bacteria 2422
100 Ga0070665_100116129 3300005548 Bacteria 2679
101 Ga0070665_100260441 3300005548 Bacteria 1736
102 Ga0070704_100199940 3300005549 Bacteria 1612
103 Ga0070704_101158146 3300005549 Bacteria 704
104 Ga0070664_100692377 3300005564 Bacteria 949
105 Ga0068857_100031659 3300005577 Bacteria 4674
106 Ga0068857_100048263 3300005577 Bacteria 3780
107 Ga0068857_100049308 3300005577 Bacteria 3736
108 Ga0068854_100047268 3300005578 Bacteria 3067
109 Ga0068854_100274147 3300005578 Bacteria 1356
110 Ga0068856_100037038 3300005614 Bacteria 4785
111 Ga0068856_100048033 3300005614 Bacteria 4205
112 Ga0068856_100065568 3300005614 Bacteria 3589
113 Ga0070702_100003686 3300005615 Bacteria 6899
114 Ga0070702_100020026 3300005615 Bacteria 3499
115 Ga0070702_100022085 3300005615 Bacteria 3359
116 Ga0068852_100038550 3300005616 Bacteria 4017
117 Ga0068859_100511711 3300005617 Bacteria 1295
118 Ga0068859_100526719 3300005617 Bacteria 1277
119 Ga0068864_100070019 3300005618 Bacteria 3051
120 Ga0068864_100090456 3300005618 Bacteria 2698
121 Ga0068864_100123934 3300005618 Bacteria 2313
122 Ga0068866_10028471 3300005718 Bacteria 2663
123 Ga0068861_100017465 3300005719 Bacteria 5095
124 Ga0068861_100173808 3300005719 Bacteria 1787
125 Ga0068851_10134916 3300005834 Bacteria 1338
126 Ga0068863_100103387 3300005841 Bacteria 2709
127 Ga0068858_100127485 3300005842 Bacteria 2384
128 Ga0068858_100146176 3300005842 Bacteria 2220
129 Ga0068858_100243530 3300005842 Bacteria 1707
130 Ga0068860_100050109 3300005843 Bacteria 3976
131 Ga0068860_100130782 3300005843 Bacteria 2408
132 Ga0068860_100185525 3300005843 Bacteria 2011
133 Ga0068860_101007959 3300005843 Bacteria 851
134 Ga0068862_100292504 3300005844 Bacteria 1496
135 Ga0068862_100460372 3300005844 Bacteria 1200
136 Ga0081455_10191657 3300005937 Bacteria 1539
137 Ga0081538_10006251 3300005981 Bacteria 10535
138 Ga0081538_10006682 3300005981 Bacteria 10103
139 Ga0081538_10017968 3300005981 Bacteria 5338
140 Ga0081538_10162824 3300005981 Bacteria 988
141 Ga0081540_1000432 3300005983 Bacteria 41258
142 Ga0081540_1006300 3300005983 Bacteria 8682
143 Ga0081539_10000236 3300005985 Bacteria 129646
144 Ga0070717_10033181 3300006028 Bacteria 4164
145 Ga0075432_10070690 3300006058 Bacteria 1254
146 Ga0070715_10000737 3300006163 Bacteria 8827
147 Ga0070716_100009129 3300006173 Bacteria 4935
148 Ga0070716_100481297 3300006173 Bacteria 911
149 Ga0070712_100055432 3300006175 Bacteria 2776
150 Ga0070712_100076435 3300006175 Bacteria 2411
151 Ga0070712_100116054 3300006175 Bacteria 2007
152 Ga0097621_100104423 3300006237 Bacteria 2388
153 Ga0097621_100146826 3300006237 Bacteria 2020
154 Ga0097621_100238069 3300006237 Bacteria 1590
155 Ga0068871_100034101 3300006358 Bacteria 4036
156 Ga0075430_100278281 3300006846 Bacteria 1385
157 Ga0075433_10032939 3300006852 Bacteria 4440
158 Ga0075434_100562870 3300006871 Bacteria 1159
159 Ga0075434_101220877 3300006871 Bacteria 764
160 Ga0068865_100123137 3300006881 Bacteria 1931
161 Ga0068865_100199705 3300006881 Bacteria 1552
162 Ga0075436_100115577 3300006914 Bacteria 1874
163 Ga0097620_100511728 3300006931 Bacteria 1295
164 Ga0097620_100526687 3300006931 Bacteria 1277
165 Ga0111539_10369683 3300009094 Bacteria 1669
166 Ga0111539_10708604 3300009094 Bacteria 1172
167 Ga0111539_11109589 3300009094 Bacteria 919
168 Ga0111539_11253909 3300009094 Bacteria 861
169 Ga0105245_10002375 3300009098 Bacteria 17026
170 Ga0105245_10173301 3300009098 Bacteria 2056
171 Ga0105245_10270161 3300009098 Bacteria 1658
172 Ga0105245_10346742 3300009098 Bacteria 1470
173 Ga0105245_10752399 3300009098 Bacteria 1010
174 Ga0105247_10079089 3300009101 Bacteria 2069
175 Ga0105247_10298739 3300009101 Bacteria 1116
176 Ga0105247_10989308 3300009101 Bacteria 656
177 Ga0114129_10535700 3300009147 Bacteria 1525
178 Ga0114129_11089128 3300009147 Bacteria 1001
179 Ga0114129_11604548 3300009147 Bacteria 796
180 Ga0105243_10065966 3300009148 Bacteria 2910
181 Ga0105243_10477935 3300009148 Bacteria 1175
182 Ga0105241_10046363 3300009174 Bacteria 3301
183 Ga0105242_10018396 3300009176 Bacteria 5461
184 Ga0105242_10162591 3300009176 Bacteria 1956
185 Ga0105242_10442158 3300009176 Bacteria 1224
186 Ga0105248_10018778 3300009177 Bacteria 7646
187 Ga0105248_10094863 3300009177 Bacteria 3359
188 Ga0105237_10092210 3300009545 Bacteria 3019
189 Ga0105237_10199253 3300009545 Bacteria 2001
190 Ga0105237_10401642 3300009545 Bacteria 1375
191 Ga0105238_10083896 3300009551 Bacteria 3175
192 Ga0105238_10094428 3300009551 Bacteria 2979
193 Ga0105238_10153568 3300009551 Bacteria 2277
194 Ga0105238_10356600 3300009551 Bacteria 1451
195 Ga0105238_10590085 3300009551 Bacteria 1118
196 Ga0105249_10022435 3300009553 Bacteria 5654
197 Ga0105249_10044780 3300009553 Bacteria 4024
198 Ga0099796_10192344 3300010159 Bacteria 824
199 Ga0105239_10005659 3300010375 Bacteria 14602
200 Ga0105239_10094322 3300010375 Bacteria 3305
201 Ga0105246_10003076 3300011119 Bacteria 10132
202 Ga0105246_10388553 3300011119 Bacteria 1155
203 Ga0105246_10561745 3300011119 Bacteria 980
204 Ga0157317_1015750 3300012475 Bacteria 631
205 Ga0157339_1010465 3300012505 Bacteria 838
206 Ga0157324_1023953 3300012506 Bacteria 644
207 Ga0157342_1009182 3300012507 Bacteria 990
208 Ga0157316_1028850 3300012510 Bacteria 659
209 Ga0157326_1007209 3300012513 Bacteria 1199
210 Ga0157373_10349874 3300013100 Bacteria 1054
211 Ga0157370_10028406 3300013104 Bacteria 5502
212 Ga0157370_10066064 3300013104 Bacteria 3421
213 Ga0157370_10329087 3300013104 Bacteria 1409
214 Ga0157370_10687139 3300013104 Bacteria 934
215 Ga0157370_10802577 3300013104 Bacteria 856
216 Ga0157369_10139659 3300013105 Bacteria 2564
217 Ga0157369_10141260 3300013105 Bacteria 2548
218 Ga0157369_10280884 3300013105 Bacteria 1734
219 Ga0157369_10317277 3300013105 Bacteria 1620
220 Ga0157369_10561271 3300013105 Bacteria 1180
221 Ga0157369_10800821 3300013105 Bacteria 968
222 Ga0157374_10498151 3300013296 Bacteria 1223
223 Ga0157378_10086327 3300013297 Bacteria 2845
224 Ga0157378_10219501 3300013297 Bacteria 1807
225 Ga0157378_10375582 3300013297 Bacteria 1395
226 Ga0163162_10009512 3300013306 Bacteria 9453
227 Ga0163162_10389263 3300013306 Bacteria 1527
228 Ga0163162_11118327 3300013306 Bacteria 893
229 Ga0157372_10013558 3300013307 Bacteria 8711
230 Ga0157372_10096453 3300013307 Bacteria 3370
231 Ga0157372_10268968 3300013307 Bacteria 1980
232 Ga0157375_10022847 3300013308 Bacteria 5762
233 Ga0157375_10114227 3300013308 Bacteria 2802
234 Ga0157375_10356561 3300013308 Bacteria 1629
235 Ga0157375_10791509 3300013308 Bacteria 1097
236 Ga0157375_10847194 3300013308 Bacteria 1061
237 Ga0157375_11221818 3300013308 Bacteria 882
238 Ga0163163_10026846 3300014325 Bacteria 5509
239 Ga0163163_10142797 3300014325 Bacteria 2436
240 Ga0163163_10163161 3300014325 Bacteria 2274
241 Ga0157380_10036327 3300014326 Bacteria 3810
242 Ga0157380_10548433 3300014326 Bacteria 1134
243 Ga0157377_10015144 3300014745 Bacteria 3936
244 Ga0157377_10096519 3300014745 Bacteria 1754
245 Ga0157377_10326343 3300014745 Bacteria 1021
246 Ga0157379_10014219 3300014968 Bacteria 6981
247 Ga0157379_10274847 3300014968 Bacteria 1532
248 Ga0157376_10062497 3300014969 Bacteria 3134
249 Ga0157376_10417544 3300014969 Bacteria 1301
250 Ga0157376_10507803 3300014969 Bacteria 1186
251 Ga0163161_10010849 3300017792 Bacteria 6316
252 Ga0163161_10591772 3300017792 Bacteria 914
253 Ga0206350_10840690 3300020080 Bacteria 664
254 Ga0206353_10361154 3300020082 Bacteria 767
255 Ga0206353_11861850 3300020082 Bacteria 1713
256 Ga0224712_10013293 3300022467 Bacteria 2615
257 Ga0224712_10017969 3300022467 Bacteria 2354
258 Ga0207653_10009271 3300025885 Bacteria 3064
259 Ga0207692_10029942 3300025898 Bacteria 2592
260 Ga0207692_10124587 3300025898 Bacteria 1447
261 Ga0207692_10128253 3300025898 Bacteria 1429
262 Ga0207710_10084070 3300025900 Bacteria 1481
263 Ga0207688_10025895 3300025901 Bacteria 3224
264 Ga0207688_10106070 3300025901 Bacteria 1627
265 Ga0207688_10272732 3300025901 Bacteria 1029
266 Ga0207680_10023307 3300025903 Bacteria 3378
267 Ga0207647_10038288 3300025904 Bacteria 3033
268 Ga0207647_10085004 3300025904 Bacteria 1893
269 Ga0207647_10096945 3300025904 Bacteria 1754
270 Ga0207647_10098792 3300025904 Bacteria 1734
271 Ga0207685_10008451 3300025905 Bacteria 2932
272 Ga0207699_10066167 3300025906 Bacteria 2193
273 Ga0207699_10087929 3300025906 Bacteria 1944
274 Ga0207645_10099516 3300025907 Bacteria 1875
275 Ga0207705_10234577 3300025909 Bacteria 1396
276 Ga0207684_10960406 3300025910 Bacteria 716
277 Ga0207654_10384361 3300025911 Bacteria 973
278 Ga0207654_10511997 3300025911 Bacteria 849
279 Ga0207707_10014459 3300025912 Bacteria 6874
280 Ga0207695_10009283 3300025913 Bacteria 12180
281 Ga0207671_10076845 3300025914 Bacteria 2499
282 Ga0207671_10156012 3300025914 Bacteria 1766
283 Ga0207671_10243543 3300025914 Bacteria 1413
284 Ga0207693_10005463 3300025915 Bacteria 10598
285 Ga0207693_10037393 3300025915 Bacteria 3826
286 Ga0207693_10143598 3300025915 Bacteria 1877
287 Ga0207693_10291227 3300025915 Bacteria 1280
288 Ga0207693_10326725 3300025915 Bacteria 1201
289 Ga0207663_10065780 3300025916 Bacteria 2318
290 Ga0207663_10259107 3300025916 Bacteria 1283
291 Ga0207663_10536280 3300025916 Bacteria 913
292 Ga0207660_10003993 3300025917 Bacteria 9618
293 Ga0207662_10018962 3300025918 Bacteria 3908
294 Ga0207662_10171979 3300025918 Bacteria 1390
295 Ga0207662_10200147 3300025918 Bacteria 1292
296 Ga0207657_10024704 3300025919 Bacteria 5556
297 Ga0207657_10025134 3300025919 Bacteria 5498
298 Ga0207657_10059591 3300025919 Bacteria 3279
299 Ga0207646_10001007 3300025922 Bacteria 36061
300 Ga0207681_10610038 3300025923 Bacteria 902
301 Ga0207694_10148888 3300025924 Bacteria 1885
302 Ga0207694_10250177 3300025924 Bacteria 1450
303 Ga0207694_10259882 3300025924 Bacteria 1422
304 Ga0207687_10027412 3300025927 Bacteria 3822
305 Ga0207687_10130659 3300025927 Bacteria 1892
306 Ga0207700_10035644 3300025928 Bacteria 3585
307 Ga0207700_10037928 3300025928 Bacteria 3494
308 Ga0207700_10158713 3300025928 Bacteria 1876
309 Ga0207700_10722887 3300025928 Bacteria 889
310 Ga0207664_10076387 3300025929 Bacteria 2711
311 Ga0207664_10184414 3300025929 Bacteria 1793
312 Ga0207664_10346082 3300025929 Bacteria 1315
313 Ga0207664_10975124 3300025929 Bacteria 760
314 Ga0207644_10124895 3300025931 Bacteria 1963
315 Ga0207690_10162807 3300025932 Bacteria 1664
316 Ga0207706_10004883 3300025933 Bacteria 12542
317 Ga0207706_10050218 3300025933 Bacteria 3687
318 Ga0207706_10585579 3300025933 Bacteria 959
319 Ga0207686_10108878 3300025934 Bacteria 1865
320 Ga0207686_10324651 3300025934 Bacteria 1151
321 Ga0207686_11128025 3300025934 Bacteria 640
322 Ga0207709_10007344 3300025935 Bacteria 6142
323 Ga0207709_10652355 3300025935 Bacteria 838
324 Ga0207669_10125794 3300025937 Bacteria 1751
325 Ga0207704_10032962 3300025938 Bacteria 2940
326 Ga0207704_10110867 3300025938 Bacteria 1855
327 Ga0207704_10336086 3300025938 Bacteria 1171
328 Ga0207665_10000808 3300025939 Bacteria 21152
329 Ga0207665_10768326 3300025939 Bacteria 760
330 Ga0207691_10855918 3300025940 Bacteria 762
331 Ga0207711_10062754 3300025941 Bacteria 3206
332 Ga0207711_10099136 3300025941 Bacteria 2575
333 Ga0207689_10010243 3300025942 Bacteria 8076
334 Ga0207689_10273444 3300025942 Bacteria 1399
335 Ga0207661_10107802 3300025944 Bacteria 2350
336 Ga0207679_10356727 3300025945 Bacteria 1276
337 Ga0207667_10048262 3300025949 Bacteria 4503
338 Ga0207651_10060502 3300025960 Bacteria 2630
339 Ga0207651_10263578 3300025960 Bacteria 1416
340 Ga0207651_10646557 3300025960 Bacteria 928
341 Ga0207668_10010957 3300025972 Bacteria 5496
342 Ga0207668_10194641 3300025972 Bacteria 1610
343 Ga0207640_10423474 3300025981 Bacteria 1090
344 Ga0207658_10121415 3300025986 Bacteria 2084
345 Ga0207658_11501947 3300025986 Bacteria 616
346 Ga0207677_10026690 3300026023 Bacteria 3627
347 Ga0207677_10146922 3300026023 Bacteria 1813
348 Ga0207703_10239147 3300026035 Bacteria 1632
349 Ga0207703_11168728 3300026035 Bacteria 740
350 Ga0207639_10143304 3300026041 Bacteria 1993
351 Ga0207678_10007398 3300026067 Bacteria 9723
352 Ga0207678_10165175 3300026067 Bacteria 1890
353 Ga0207708_10006025 3300026075 Bacteria 8985
354 Ga0207708_10183465 3300026075 Bacteria 1662
355 Ga0207702_10199987 3300026078 Bacteria 1851
356 Ga0207702_10367402 3300026078 Bacteria 1380
357 Ga0207702_10465654 3300026078 Bacteria 1228
358 Ga0207702_10574256 3300026078 Bacteria 1105
359 Ga0207648_10201923 3300026089 Bacteria 1763
360 Ga0207648_10605859 3300026089 Bacteria 1010
361 Ga0207648_10886415 3300026089 Bacteria 833
362 Ga0207676_10090605 3300026095 Bacteria 2510
363 Ga0207676_10198080 3300026095 Bacteria 1772
364 Ga0207676_10207344 3300026095 Bacteria 1736
365 Ga0207674_10017070 3300026116 Bacteria 7923
366 Ga0207674_10085051 3300026116 Bacteria 3160
367 Ga0207674_10141347 3300026116 Bacteria 2366
368 Ga0207675_100013955 3300026118 Bacteria 7490
369 Ga0207683_10009831 3300026121 Bacteria 8160
370 Ga0207698_10057204 3300026142 Bacteria 3015
371 Ga0207698_10064464 3300026142 Bacteria 2872
372 Ga0207698_10604821 3300026142 Bacteria 1081
373 Ga0207428_10119456 3300027907 Bacteria 2022
374 Ga0268266_10088109 3300028379 Bacteria 2717
375 Ga0268265_10418828 3300028380 Bacteria 1243
376 Ga0268264_10511637 3300028381 Bacteria 1172
377 Ga0307517_10006361 3300028786 Bacteria 17506
378 Ga0265338_10004741 3300028800 Bacteria 18187
379 Ga0307511_10217713 3300030521 Bacteria 964
380 Ga0307509_10020785 3300031507 Bacteria 7445
381 Ga0307509_10084830 3300031507 Bacteria 3262
382 Ga0307508_10020015 3300031616 Bacteria 6079
383 Ga0307516_10070075 3300031730 Bacteria 3371
384 Ga0307405_10063692 3300031731 Bacteria 2340
385 Ga0307413_10994391 3300031824 Bacteria 719
386 Ga0307414_10999919 3300032004 Bacteria 770
387 Ga0307415_100213067 3300032126 Bacteria 1543
388 Ga0307415_100669652 3300032126 Bacteria 933
389 Ga0307415_100896340 3300032126 Bacteria 817
390 Ga0316214_1001517 3300033545 Bacteria 2726
391 Ga0373929_0068939 3300035085 Bacteria 842
392 Ga0373949_0057475 3300035090 Bacteria 994
393 Ga0373951_0016931 3300035091 Bacteria 1647
394 Ga0373932_0021733 3300035112 Bacteria 1697
395 Ga0373939_0003547 3300035114 Bacteria 3663
396 Ga0373941_0024754 3300035115 Bacteria 1727
397 Ga0373945_0050534 3300035116 Bacteria 1528
398 Ga0373960_0021941 3300035121 Bacteria 1704
399 Ga0373955_0063901 3300035172 Bacteria 2039
400 Ga0373961_0013822 3300035241 Bacteria 2041
401 Ga0373931_0001778 3300035691 Bacteria 9368
402 Ga0373931_0091905 3300035691 Bacteria 1692
403 Ga0373935_0019331 3300035692 Bacteria 4154
404 Ga0373947_0070598 3300035725 Bacteria 2140
405 Ga0372808_005728 3300036459 Bacteria 1650
406 Ga0373925_0289151 3300037068 Bacteria 1321
407 Ga0395901_1316335 3300038443 Bacteria 684
408 Ga0436365_1403728 3300039437 Bacteria 1229
409 Ga0436365_1894323 3300039437 Bacteria 2658
410 Ga0451791_0004333 3300041451 Bacteria 1965
411 Ga0451853_3342104 3300041512 Bacteria 826
412 Ga0466963_0001620 3300044694 Bacteria 12244
413 Ga0466963_0028387 3300044694 Bacteria 3592
414 Ga0466960_0229374 3300044901 Bacteria 1024
415 Ga0466967_0000279 3300045976 Bacteria 22606
416 Ga0466967_0372141 3300045976 Bacteria 1386
417 Ga0495603_0175762 3300046455 Bacteria 1239
418 Ga0495638_0053167 3300046460 Bacteria 2521
419 Ga0495643_0005343 3300046522 Bacteria 8699
420 Ga0495666_0240729 3300046526 Bacteria 826
421 Ga0495646_0102131 3300046680 Bacteria 1643
422 Ga0495624_0021010 3300046690 Bacteria 4334
423 Ga0495660_0089050 3300046810 Bacteria 1607
424 Ga0495604_0000101 3300047317 Bacteria 72250
425 Ga0495683_0056122 3300047323 Bacteria 1960
426 Ga0495687_006762 3300047443 Bacteria 6934
427 Ga0495687_021968 3300047443 Bacteria 3073
428 Ga0495679_011736 3300047446 Bacteria 3367
429 Ga0495685_004735 3300047447 Bacteria 4415
430 Ga0495681_0010734 3300047470 Bacteria 5520
431 Ga0495684_0446107 3300047471 Bacteria 900
432 Ga0495684_0523802 3300047471 Bacteria 811
433 Ga0496100_0039314 3300048903 Bacteria 3004
434 Ga0496100_0176152 3300048903 Bacteria 1544
435 Ga0496101_0033450 3300048904 Bacteria 3626
436 Ga0496101_0056272 3300048904 Bacteria 2843
437 Ga0496101_0145746 3300048904 Bacteria 1808
438 Ga0496102_0005420 3300048905 Bacteria 10830
439 Ga0496102_0014443 3300048905 Bacteria 6862
440 Ga0496102_0022931 3300048905 Bacteria 5537
441 Ga0496102_0327870 3300048905 Bacteria 1442
442 Ga0496103_0046350 3300048906 Bacteria 2684
443 Ga0496103_0046936 3300048906 Bacteria 2667
444 Ga0496103_0691794 3300048906 Bacteria 646
445 Ga0496104_0015926 3300048907 Bacteria 6823
446 Ga0496104_0045978 3300048907 Bacteria 4107
447 Ga0496104_0383475 3300048907 Bacteria 1318
448 Ga0496105_0072489 3300048908 Bacteria 2846
449 Ga0496105_0200148 3300048908 Bacteria 1630
450 Ga0496105_0508082 3300048908 Bacteria 945
451 Ga0496106_0011560 3300048909 Bacteria 6526
452 Ga0496106_0012483 3300048909 Bacteria 6274
453 Ga0496106_0638388 3300048909 Bacteria 851
454 Ga0496107_0018397 3300048910 Bacteria 4919
455 Ga0496107_0065556 3300048910 Bacteria 2633
456 Ga0496107_0127647 3300048910 Bacteria 1876
457 Ga0496107_0397087 3300048910 Bacteria 1026
458 Ga0496107_0570132 3300048910 Bacteria 838
459 Ga0496108_0011148 3300048911 Bacteria 7305
460 Ga0496108_0259109 3300048911 Bacteria 1513
461 Ga0496109_0019174 3300048912 Bacteria 6024
462 Ga0496109_0081503 3300048912 Bacteria 2981
463 Ga0496109_0109284 3300048912 Bacteria 2570
464 Ga0496109_0166231 3300048912 Bacteria 2068
465 Ga0496109_0840895 3300048912 Bacteria 856
466 Ga0496110_0008804 3300048913 Bacteria 8131
467 Ga0496110_0017510 3300048913 Bacteria 5995
468 Ga0496110_0053264 3300048913 Bacteria 3557
469 Ga0496110_0315943 3300048913 Bacteria 1423
470 Ga0496110_0700285 3300048913 Bacteria 914
471 Ga0496111_0020175 3300048914 Bacteria 4637
472 Ga0496111_0025451 3300048914 Bacteria 4175
473 Ga0496111_0060985 3300048914 Bacteria 2734
474 Ga0496112_0003161 3300048915 Bacteria 13529
475 Ga0496112_0020612 3300048915 Bacteria 6251
476 Ga0496113_0049108 3300048916 Bacteria 3141
477 Ga0496113_0109216 3300048916 Bacteria 2151
478 Ga0496113_0119211 3300048916 Bacteria 2062
479 Ga0496113_0984491 3300048916 Bacteria 665
480 Ga0496114_0023675 3300048917 Bacteria 5011
481 Ga0496114_0192700 3300048917 Bacteria 1784
482 Ga0496115_0006408 3300048918 Bacteria 8623
483 Ga0496115_0174164 3300048918 Bacteria 1779
484 Ga0496118_0044642 3300048921 Bacteria 3468
485 Ga0496119_0423642 3300048922 Bacteria 631
486 Ga0496124_0441750 3300048927 Bacteria 890
487 Ga0496126_0134230 3300048929 Bacteria 2136
488 Ga0501306_049927 3300049127 Bacteria 669
489 Ga0501318_039895 3300049534 Bacteria 668
490 Ga0501040_0147437 3300049576 Archaea 1659
491 Ga0501043_0118860 3300049579 Bacteria 2073
492 Ga0501067_0031496 3300049583 Bacteria 2942
493 Ga0501067_0036147 3300049583 Bacteria 2743
494 Ga0501068_0271115 3300049584 Bacteria 1083
495 Ga0501069_0001535 3300049585 Bacteria 11419
496 Ga0501069_0001793 3300049585 Bacteria 10737
497 Ga0501069_0030920 3300049585 Bacteria 2942
498 Ga0501071_0587279 3300049587 Bacteria 856
499 Ga0501076_0220669 3300049592 Archaea 1549
500 Ga0501083_0046372 3300049744 Bacteria 2939
501 Ga0501045_0058934 3300049824 Archaea 2812
502 nmdc:mga08y16_295699_c1 3300050511 Bacteria 1669
503 nmdc:mga08y16_744144_c1 3300050511 Bacteria 977
504 nmdc:mga0n895_1097292_c1 3300050512 Bacteria 773
505 nmdc:mga0n895_23899_c1 3300050512 Bacteria 5752
506 nmdc:mga0n895_319644_c1 3300050512 Bacteria 1573
507 nmdc:mga0rr50_61286_c1 3300050513 Bacteria 2834
508 nmdc:mga08x19_70333_c1 3300050514 Bacteria 2280
509 Ga0500610_0168584 3300053079 Bacteria 1083
510 Ga0500643_071172 3300053087 Bacteria 965
511 Ga0500654_019250 3300053099 Bacteria 4406
512 Ga0500569_002551 3300053109 Bacteria 3606
513 Ga0500628_000787 3300053129 Bacteria 5653
514 Ga0500652_002584 3300053131 Bacteria 5469
515 Ga0500655_049708 3300053133 Bacteria 834
516 Ga0500658_0012798 3300053134 Bacteria 3098
517 Ga0500579_015238 3300053143 Bacteria 4950
518 Ga0500600_0035508 3300053149 Bacteria 2904
519 Ga0500616_0000409 3300053153 Bacteria 58445
520 Ga0500616_0012645 3300053153 Bacteria 4935
521 Ga0500627_0173907 3300053158 Bacteria 970
522 Ga0500633_0001616 3300053160 Bacteria 4342
523 Ga0500634_0015305 3300053161 Bacteria 4070
524 Ga0500656_000765 3300053732 Bacteria 2531
525 Ga0500587_001506 3300053739 Bacteria 3298
526 Ga0501084_0278268 3300054114 Bacteria 1413
527 Ga0587086_032566 3300059507 Bacteria 774
528 Ga0587072_052414 3300059643 Bacteria 821
529 Ga0501082_1034216 3300060353 Bacteria 718
530 Ga0530510_0042017 3300061734 Archaea 3302
531 2512637417 2512564013 Bacteria 6286191
532 2689962260 2687453737 Bacteria 11203906
533 2774395813 2773857762 Bacteria 5971770
534 2793978938 2791355406 Bacteria 11364898
535 2809199135 2808606439 Bacteria 5952208
536 2832010012 2832004796 Bacteria 6538017
537 2866067225 2866065130 Bacteria 6518152
538 2867314606 2867312974 Bacteria 7058875
539 2867323432 2867319477 Bacteria 7069771
540 2891968553 2891968417 Bacteria 5821697
541 2919473266 2919468124 Bacteria 9133025
542 2920880291 2920879853 Bacteria 4216831
543 2929189716 2929183550 Bacteria 6377511
544 8047895134 8047893842 Bacteria 11723082
545 8048363916 8048356638 Bacteria 11044339
546 8048372160 8048369669 Bacteria 11666822
547 8048381094 8048379754 Bacteria 11877923
548 Ga0373951_0000001
549 CNBas_1006793
550 JGI24743J22301_10075130
551 JGI24745J21846_1021429
552 JGI24738J21930_10055373
553 JGI24738J21930_10056022
554 JGI24744J21845_10034590
555 JGI24742J22300_10050770
556 JGI25406J46586_10014783
557 rootH1_10085067
558 rootH2_10263501
559 rootL2_10167222
560 JGI25407J50210_10015270
561 JGI25407J50210_10044987
562 Ga0070658_10021400
563 Ga0070658_10046538
564 Ga0070683_100013260
565 Ga0070683_101152526
566 Ga0070690_100285582
567 Ga0068869_100108975
568 Ga0070666_10209236
569 Ga0070680_100143871
570 Ga0070680_100182601
571 Ga0070682_100037989
572 Ga0070682_100178963
573 Ga0070682_100209140
574 Ga0070682_100834184
575 Ga0070660_100094328
576 Ga0070660_100113375
577 Ga0070660_100317376
578 Ga0070660_100388726
579 Ga0070689_100015455
580 Ga0070689_100148384
581 Ga0070691_10040323
582 Ga0070687_100160345
583 Ga0070687_100390635
584 Ga0070692_10073856
585 Ga0070692_10181608
586 Ga0070668_100012764
587 Ga0070668_100101018
588 Ga0070668_100665300
589 Ga0070669_100065824
590 Ga0070669_100527016
591 Ga0070675_100103824
592 Ga0070675_101082675
593 Ga0070671_100077787
594 Ga0070671_100594745
595 Ga0070674_100251916
596 Ga0070673_100138395
597 Ga0070673_100532353
598 Ga0070673_101100759
599 Ga0070688_100082077
600 Ga0070688_100117431
601 Ga0070659_100064482
602 Ga0070659_100146368
603 Ga0070667_100354353
604 Ga0070667_100923579
605 Ga0070703_10032264
606 Ga0070709_10060123
607 Ga0070709_10561317
608 Ga0070714_100080154
609 Ga0070714_100121460
610 Ga0070714_100207843
611 Ga0070714_100456288
612 Ga0070713_100051852
613 Ga0070713_100239644
614 Ga0070713_101124034
615 Ga0070710_10010055
616 Ga0070701_10019429
617 Ga0070701_10034021
618 Ga0070711_100082806
619 Ga0070711_100544837
620 Ga0070711_101380811
621 Ga0070700_100075999
622 Ga0070700_100723895
623 Ga0070694_100030428
624 Ga0070663_100135297
625 Ga0070678_100019117
626 Ga0070662_100046296
627 Ga0070662_100648753
628 Ga0070681_10225549
629 Ga0068867_100602720
630 Ga0068867_100634107
631 Ga0070685_10034413
632 Ga0070685_10243712
633 Ga0070707_100000609
634 Ga0070698_100000690
635 Ga0070698_100640132
636 Ga0070679_100241687
637 Ga0070684_100002397
638 Ga0070684_100344637
639 Ga0070684_100549322
640 Ga0070697_100167283
641 Ga0068853_100069402
642 Ga0068853_100166224
643 Ga0070686_100008011
644 Ga0070695_100039936
645 Ga0070696_100010156
646 Ga0070693_100048347
647 Ga0070665_100116129
648 Ga0070665_100260441
649 Ga0070704_100199940
650 Ga0070704_101158146
651 Ga0070664_100692377
652 Ga0068857_100031659
653 Ga0068857_100048263
654 Ga0068857_100049308
655 Ga0068854_100047268
656 Ga0068854_100274147
657 Ga0068856_100037038
658 Ga0068856_100048033
659 Ga0068856_100065568
660 Ga0070702_100003686
661 Ga0070702_100020026
662 Ga0070702_100022085
663 Ga0068852_100038550
664 Ga0068859_100511711
665 Ga0068859_100526719
666 Ga0068864_100070019
667 Ga0068864_100090456
668 Ga0068864_100123934
669 Ga0068866_10028471
670 Ga0068861_100017465
671 Ga0068861_100173808
672 Ga0068851_10134916
673 Ga0068863_100103387
674 Ga0068858_100127485
675 Ga0068858_100146176
676 Ga0068858_100243530
677 Ga0068860_100050109
678 Ga0068860_100130782
679 Ga0068860_100185525
680 Ga0068860_101007959
681 Ga0068862_100292504
682 Ga0068862_100460372
683 Ga0081455_10191657
684 Ga0081538_10006251
685 Ga0081538_10006682
686 Ga0081538_10017968
687 Ga0081538_10162824
688 Ga0081540_1000432
689 Ga0081540_1006300
690 Ga0081539_10000236
691 Ga0070717_10033181
692 Ga0075432_10070690
693 Ga0070715_10000737
694 Ga0070716_100009129
695 Ga0070716_100481297
696 Ga0070712_100055432
697 Ga0070712_100076435
698 Ga0070712_100116054
699 Ga0097621_100104423
700 Ga0097621_100146826
701 Ga0097621_100238069
702 Ga0068871_100034101
703 Ga0075430_100278281
704 Ga0075433_10032939
705 Ga0075434_100562870
706 Ga0075434_101220877
707 Ga0068865_100123137
708 Ga0068865_100199705
709 Ga0075436_100115577
710 Ga0097620_100511728
711 Ga0097620_100526687
712 Ga0111539_10369683
713 Ga0111539_10708604
714 Ga0111539_11109589
715 Ga0111539_11253909
716 Ga0105245_10002375
717 Ga0105245_10173301
718 Ga0105245_10270161
719 Ga0105245_10346742
720 Ga0105245_10752399
721 Ga0105247_10079089
722 Ga0105247_10298739
723 Ga0105247_10989308
724 Ga0114129_10535700
725 Ga0114129_11089128
726 Ga0114129_11604548
727 Ga0105243_10065966
728 Ga0105243_10477935
729 Ga0105241_10046363
730 Ga0105242_10018396
731 Ga0105242_10162591
732 Ga0105242_10442158
733 Ga0105248_10018778
734 Ga0105248_10094863
735 Ga0105237_10092210
736 Ga0105237_10199253
737 Ga0105237_10401642
738 Ga0105238_10083896
739 Ga0105238_10094428
740 Ga0105238_10153568
741 Ga0105238_10356600
742 Ga0105238_10590085
743 Ga0105249_10022435
744 Ga0105249_10044780
745 Ga0099796_10192344
746 Ga0105239_10005659
747 Ga0105239_10094322
748 Ga0105246_10003076
749 Ga0105246_10388553
750 Ga0105246_10561745
751 Ga0157317_1015750
752 Ga0157339_1010465
753 Ga0157324_1023953
754 Ga0157342_1009182
755 Ga0157316_1028850
756 Ga0157326_1007209
757 Ga0157373_10349874
758 Ga0157370_10028406
759 Ga0157370_10066064
760 Ga0157370_10329087
761 Ga0157370_10687139
762 Ga0157370_10802577
763 Ga0157369_10139659
764 Ga0157369_10141260
765 Ga0157369_10280884
766 Ga0157369_10317277
767 Ga0157369_10561271
768 Ga0157369_10800821
769 Ga0157374_10498151
770 Ga0157378_10086327
771 Ga0157378_10219501
772 Ga0157378_10375582
773 Ga0163162_10009512
774 Ga0163162_10389263
775 Ga0163162_11118327
776 Ga0157372_10013558
777 Ga0157372_10096453
778 Ga0157372_10268968
779 Ga0157375_10022847
780 Ga0157375_10114227
781 Ga0157375_10356561
782 Ga0157375_10791509
783 Ga0157375_10847194
784 Ga0157375_11221818
785 Ga0163163_10026846
786 Ga0163163_10142797
787 Ga0163163_10163161
788 Ga0157380_10036327
789 Ga0157380_10548433
790 Ga0157377_10015144
791 Ga0157377_10096519
792 Ga0157377_10326343
793 Ga0157379_10014219
794 Ga0157379_10274847
795 Ga0157376_10062497
796 Ga0157376_10417544
797 Ga0157376_10507803
798 Ga0163161_10010849
799 Ga0163161_10591772
800 Ga0206350_10840690
801 Ga0206353_10361154
802 Ga0206353_11861850
803 Ga0224712_10013293
804 Ga0224712_10017969
805 Ga0207653_10009271
806 Ga0207692_10029942
807 Ga0207692_10124587
808 Ga0207692_10128253
809 Ga0207710_10084070
810 Ga0207688_10025895
811 Ga0207688_10106070
812 Ga0207688_10272732
813 Ga0207680_10023307
814 Ga0207647_10038288
815 Ga0207647_10085004
816 Ga0207647_10096945
817 Ga0207647_10098792
818 Ga0207685_10008451
819 Ga0207699_10066167
820 Ga0207699_10087929
821 Ga0207645_10099516
822 Ga0207705_10234577
823 Ga0207684_10960406
824 Ga0207654_10384361
825 Ga0207654_10511997
826 Ga0207707_10014459
827 Ga0207695_10009283
828 Ga0207671_10076845
829 Ga0207671_10156012
830 Ga0207671_10243543
831 Ga0207693_10005463
832 Ga0207693_10037393
833 Ga0207693_10143598
834 Ga0207693_10291227
835 Ga0207693_10326725
836 Ga0207663_10065780
837 Ga0207663_10259107
838 Ga0207663_10536280
839 Ga0207660_10003993
840 Ga0207662_10018962
841 Ga0207662_10171979
842 Ga0207662_10200147
843 Ga0207657_10024704
844 Ga0207657_10025134
845 Ga0207657_10059591
846 Ga0207646_10001007
847 Ga0207681_10610038
848 Ga0207694_10148888
849 Ga0207694_10250177
850 Ga0207694_10259882
851 Ga0207687_10027412
852 Ga0207687_10130659
853 Ga0207700_10035644
854 Ga0207700_10037928
855 Ga0207700_10158713
856 Ga0207700_10722887
857 Ga0207664_10076387
858 Ga0207664_10184414
859 Ga0207664_10346082
860 Ga0207664_10975124
861 Ga0207644_10124895
862 Ga0207690_10162807
863 Ga0207706_10004883
864 Ga0207706_10050218
865 Ga0207706_10585579
866 Ga0207686_10108878
867 Ga0207686_10324651
868 Ga0207686_11128025
869 Ga0207709_10007344
870 Ga0207709_10652355
871 Ga0207669_10125794
872 Ga0207704_10032962
873 Ga0207704_10110867
874 Ga0207704_10336086
875 Ga0207665_10000808
876 Ga0207665_10768326
877 Ga0207691_10855918
878 Ga0207711_10062754
879 Ga0207711_10099136
880 Ga0207689_10010243
881 Ga0207689_10273444
882 Ga0207661_10107802
883 Ga0207679_10356727
884 Ga0207667_10048262
885 Ga0207651_10060502
886 Ga0207651_10263578
887 Ga0207651_10646557
888 Ga0207668_10010957
889 Ga0207668_10194641
890 Ga0207640_10423474
891 Ga0207658_10121415
892 Ga0207658_11501947
893 Ga0207677_10026690
894 Ga0207677_10146922
895 Ga0207703_10239147
896 Ga0207703_11168728
897 Ga0207639_10143304
898 Ga0207678_10007398
899 Ga0207678_10165175
900 Ga0207708_10006025
901 Ga0207708_10183465
902 Ga0207702_10199987
903 Ga0207702_10367402
904 Ga0207702_10465654
905 Ga0207702_10574256
906 Ga0207648_10201923
907 Ga0207648_10605859
908 Ga0207648_10886415
909 Ga0207676_10090605
910 Ga0207676_10198080
911 Ga0207676_10207344
912 Ga0207674_10017070
913 Ga0207674_10085051
914 Ga0207674_10141347
915 Ga0207675_100013955
916 Ga0207683_10009831
917 Ga0207698_10057204
918 Ga0207698_10064464
919 Ga0207698_10604821
920 Ga0207428_10119456
921 Ga0268266_10088109
922 Ga0268265_10418828
923 Ga0268264_10511637
924 Ga0307517_10006361
925 Ga0265338_10004741
926 Ga0307511_10217713
927 Ga0307509_10020785
928 Ga0307509_10084830
929 Ga0307508_10020015
930 Ga0307516_10070075
931 Ga0307405_10063692
932 Ga0307413_10994391
933 Ga0307414_10999919
934 Ga0307415_100213067
935 Ga0307415_100669652
936 Ga0307415_100896340
937 Ga0316214_1001517
938 Ga0373929_0068939
939 Ga0373949_0057475
940 Ga0373951_0016931
941 Ga0373932_0021733
942 Ga0373939_0003547
943 Ga0373941_0024754
944 Ga0373945_0050534
945 Ga0373960_0021941
946 Ga0373955_0063901
947 Ga0373961_0013822
948 Ga0373931_0001778
949 Ga0373931_0091905
950 Ga0373935_0019331
951 Ga0373947_0070598
952 Ga0372808_005728
953 Ga0373925_0289151
954 Ga0395901_1316335
955 Ga0436365_1403728
956 Ga0436365_1894323
957 Ga0451791_0004333
958 Ga0451853_3342104
959 Ga0466963_0001620
960 Ga0466963_0028387
961 Ga0466960_0229374
962 Ga0466967_0000279
963 Ga0466967_0372141
964 Ga0495603_0175762
965 Ga0495638_0053167
966 Ga0495643_0005343
967 Ga0495666_0240729
968 Ga0495646_0102131
969 Ga0495624_0021010
970 Ga0495660_0089050
971 Ga0495604_0000101
972 Ga0495683_0056122
973 Ga0495687_006762
974 Ga0495687_021968
975 Ga0495679_011736
976 Ga0495685_004735
977 Ga0495681_0010734
978 Ga0495684_0446107
979 Ga0495684_0523802
980 Ga0496100_0039314
981 Ga0496100_0176152
982 Ga0496101_0033450
983 Ga0496101_0056272
984 Ga0496101_0145746
985 Ga0496102_0005420
986 Ga0496102_0014443
987 Ga0496102_0022931
988 Ga0496102_0327870
989 Ga0496103_0046350
990 Ga0496103_0046936
991 Ga0496103_0691794
992 Ga0496104_0015926
993 Ga0496104_0045978
994 Ga0496104_0383475
995 Ga0496105_0072489
996 Ga0496105_0200148
997 Ga0496105_0508082
998 Ga0496106_0011560
999 Ga0496106_0012483
1000 Ga0496106_0638388
1001 Ga0496107_0018397
1002 Ga0496107_0065556
1003 Ga0496107_0127647
1004 Ga0496107_0397087
1005 Ga0496107_0570132
1006 Ga0496108_0011148
1007 Ga0496108_0259109
1008 Ga0496109_0019174
1009 Ga0496109_0081503
1010 Ga0496109_0109284
1011 Ga0496109_0166231
1012 Ga0496109_0840895
1013 Ga0496110_0008804
1014 Ga0496110_0017510
1015 Ga0496110_0053264
1016 Ga0496110_0315943
1017 Ga0496110_0700285
1018 Ga0496111_0020175
1019 Ga0496111_0025451
1020 Ga0496111_0060985
1021 Ga0496112_0003161
1022 Ga0496112_0020612
1023 Ga0496113_0049108
1024 Ga0496113_0109216
1025 Ga0496113_0119211
1026 Ga0496113_0984491
1027 Ga0496114_0023675
1028 Ga0496114_0192700
1029 Ga0496115_0006408
1030 Ga0496115_0174164
1031 Ga0496118_0044642
1032 Ga0496119_0423642
1033 Ga0496124_0441750
1034 Ga0496126_0134230
1035 Ga0501306_049927
1036 Ga0501318_039895
1037 Ga0501040_0147437
1038 Ga0501043_0118860
1039 Ga0501067_0031496
1040 Ga0501067_0036147
1041 Ga0501068_0271115
1042 Ga0501069_0001535
1043 Ga0501069_0001793
1044 Ga0501069_0030920
1045 Ga0501071_0587279
1046 Ga0501076_0220669
1047 Ga0501083_0046372
1048 Ga0501045_0058934
1049 nmdc:mga08y16_295699_c1
1050 nmdc:mga08y16_744144_c1
1051 nmdc:mga0n895_1097292_c1
1052 nmdc:mga0n895_23899_c1
1053 nmdc:mga0n895_319644_c1
1054 nmdc:mga0rr50_61286_c1
1055 nmdc:mga08x19_70333_c1
1056 Ga0500610_0168584
1057 Ga0500643_071172
1058 Ga0500654_019250
1059 Ga0500569_002551
1060 Ga0500628_000787
1061 Ga0500652_002584
1062 Ga0500655_049708
1063 Ga0500658_0012798
1064 Ga0500579_015238
1065 Ga0500600_0035508
1066 Ga0500616_0000409
1067 Ga0500616_0012645
1068 Ga0500627_0173907
1069 Ga0500633_0001616
1070 Ga0500634_0015305
1071 Ga0500656_000765
1072 Ga0500587_001506
1073 Ga0501084_0278268
1074 Ga0587086_032566
1075 Ga0587072_052414
1076 Ga0501082_1034216
1077 Ga0530510_0042017
1078 2512637417
1079 2689962260
1080 2774395813
1081 2793978938
1082 2809199135
1083 2832010012
1084 2866067225
1085 2867314606
1086 2867323432
1087 2891968553
1088 2919473266
1089 2920880291
1090 2929189716
1091 8047895134
1092 8048363916
1093 8048372160
1094 8048381094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

23

170

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

23

153

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8416 5 179
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8409 5 179
6dgi-assembly1.cif.gz_B the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 0.8362 2 41
3gfr-assembly2.cif.gz_B structure of yhda, d137l variant 0.8318 5 178
6dgi-assembly1.cif.gz_A-2 the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 0.8287 2 41
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9702 4 145 3.40.50.360
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8361 4 177 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8352 4 181 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8342 6 179 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8325 4 145 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A1H3C706-F1-model_v4 NAD(P)H-dependent FMN reductase 1.001 1 183 GO:0005829
GO:0010181
GO:0016491
AF-A0A066U3V4-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 1 1 184 GO:0005829
GO:0010181
GO:0016491
GO:0030638
AF-A0A7X8J3I3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9989 1 183 GO:0005829
GO:0010181
GO:0016491
AF-A0A1M6TS00-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9989 1 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A1I6DGE7-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9985 1 185 GO:0005829
GO:0010181
GO:0016491

Map