F462123

General Info

Members Datasets Scaffolds Average Seq Length
547 259 1094 259

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10045147|Ga0316576_100451472
Length 276
Sequence MPSVSEGTNSAATEPAVHASSHGSDAAELIVVRDLTMAFGAKVVQRDLNFAVRRGEVFVIMGGSGCGKSTLMRHMIGLIRPAAGAILYDGEDFWAAPAARQEAITRRFGVLYQSGALWSSMTLAENVGLPLGEYTRLKPPQIRDVAAYKLALVGLAGFEDYYPASISGGMQKRAGLARAMALDPDILFFDEPSAGLDPITSKLLDDLILELRHSLGTTIIMVTHELPQIFATADSCVFLDPETKTQIASGDPKQLVHSANPKLHAFLTRGGTAGHG

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
163 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
164 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
179 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
197 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
198 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
199 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
200 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
201 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 3.47
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10045147 3300031727 Bacteria 3186
2 JGI24752J21851_1005305 3300001976 Bacteria 1683
3 JGI24743J22301_10009804 3300001991 Bacteria 1702
4 Ga0065704_10104885 3300005289 Unclassified 2127
5 Ga0065715_10137931 3300005293 Bacteria 1899
6 Ga0070658_10009027 3300005327 Bacteria 8020
7 Ga0070658_10033739 3300005327 Bacteria 4118
8 Ga0070658_10200476 3300005327 Bacteria 1684
9 Ga0070658_10259138 3300005327 Bacteria 1477
10 Ga0070676_10027307 3300005328 Bacteria 3236
11 Ga0070676_10182739 3300005328 Bacteria 1364
12 Ga0070683_100099582 3300005329 Bacteria 2736
13 Ga0070690_100005472 3300005330 Bacteria 7135
14 Ga0070690_100304372 3300005330 Bacteria 1144
15 Ga0070670_100014497 3300005331 Bacteria 6767
16 Ga0070670_100045511 3300005331 Bacteria 3773
17 Ga0070670_100295753 3300005331 Bacteria 1415
18 Ga0070677_10003778 3300005333 Bacteria 4899
19 Ga0070677_10008241 3300005333 Bacteria 3500
20 Ga0068869_100330644 3300005334 Bacteria 1238
21 Ga0070666_10146035 3300005335 Bacteria 1648
22 Ga0070680_100513327 3300005336 Bacteria 1026
23 Ga0068868_100002877 3300005338 Bacteria 11942
24 Ga0070660_100002907 3300005339 Bacteria 11791
25 Ga0070660_100015931 3300005339 Bacteria 5444
26 Ga0070660_100042871 3300005339 Bacteria 3455
27 Ga0070660_100397214 3300005339 Bacteria 1140
28 Ga0070661_100002685 3300005344 Bacteria 12177
29 Ga0070661_100002695 3300005344 Bacteria 12165
30 Ga0070661_100061225 3300005344 Bacteria 2762
31 Ga0070661_100107484 3300005344 Bacteria 2081
32 Ga0070661_100148711 3300005344 Bacteria 1770
33 Ga0070661_100291751 3300005344 Bacteria 1268
34 Ga0070661_100610293 3300005344 Bacteria 883
35 Ga0070668_100001549 3300005347 Bacteria 16585
36 Ga0070668_100003405 3300005347 Bacteria 11741
37 Ga0070669_100052570 3300005353 Bacteria 2981
38 Ga0070669_100053545 3300005353 Bacteria 2954
39 Ga0070675_100002507 3300005354 Bacteria 13742
40 Ga0070675_100190916 3300005354 Bacteria 1775
41 Ga0070671_100002791 3300005355 Bacteria 13566
42 Ga0070671_100031612 3300005355 Bacteria 4374
43 Ga0070671_100040973 3300005355 Bacteria 3848
44 Ga0070671_100045241 3300005355 Bacteria 3659
45 Ga0070671_100089200 3300005355 Bacteria 2581
46 Ga0070671_100301434 3300005355 Bacteria 1364
47 Ga0070671_100302870 3300005355 Bacteria 1361
48 Ga0070674_100000532 3300005356 Bacteria 19195
49 Ga0070674_100004810 3300005356 Bacteria 7737
50 Ga0070674_100390576 3300005356 Bacteria 1134
51 Ga0070673_100089933 3300005364 Bacteria 2507
52 Ga0070673_100131080 3300005364 Bacteria 2103
53 Ga0070659_100018897 3300005366 Bacteria 5206
54 Ga0070659_100024871 3300005366 Bacteria 4594
55 Ga0070659_100027140 3300005366 Bacteria 4409
56 Ga0070659_100042458 3300005366 Bacteria 3555
57 Ga0070659_100056372 3300005366 Bacteria 3099
58 Ga0070667_100041675 3300005367 Bacteria 3852
59 Ga0070709_10019964 3300005434 Bacteria 3883
60 Ga0070709_10060265 3300005434 Bacteria 2412
61 Ga0070709_10106252 3300005434 Bacteria 1879
62 Ga0070714_100010729 3300005435 Bacteria 7247
63 Ga0070714_100126301 3300005435 Bacteria 2281
64 Ga0070710_10120524 3300005437 Bacteria 1588
65 Ga0070701_10092363 3300005438 Bacteria 1661
66 Ga0070700_100088899 3300005441 Bacteria 2011
67 Ga0070708_100138285 3300005445 Bacteria 2257
68 Ga0070708_100147715 3300005445 Bacteria 2185
69 Ga0070708_100561043 3300005445 Bacteria 1077
70 Ga0070708_100705413 3300005445 Bacteria 950
71 Ga0070663_100007228 3300005455 Bacteria 6747
72 Ga0070663_100051446 3300005455 Bacteria 2935
73 Ga0070663_100116292 3300005455 Bacteria 2015
74 Ga0070678_100000608 3300005456 Bacteria 17633
75 Ga0070678_100002571 3300005456 Bacteria 9967
76 Ga0070662_100002412 3300005457 Bacteria 11489
77 Ga0070662_100295004 3300005457 Bacteria 1315
78 Ga0070681_10001734 3300005458 Bacteria 19538
79 Ga0068867_100027441 3300005459 Bacteria 4092
80 Ga0068867_100216100 3300005459 Bacteria 1542
81 Ga0068867_100245902 3300005459 Bacteria 1453
82 Ga0068867_100410835 3300005459 Bacteria 1144
83 Ga0070685_10008202 3300005466 Bacteria 5356
84 Ga0070706_100043941 3300005467 Bacteria 4128
85 Ga0070707_100044115 3300005468 Bacteria 4268
86 Ga0070707_100187949 3300005468 Bacteria 2014
87 Ga0070707_100382749 3300005468 Bacteria 1367
88 Ga0070707_100399212 3300005468 Bacteria 1335
89 Ga0070698_100104688 3300005471 Bacteria 2799
90 Ga0070698_100225994 3300005471 Bacteria 1805
91 Ga0070699_100024150 3300005518 Bacteria 5239
92 Ga0070699_100127003 3300005518 Bacteria 2246
93 Ga0070679_100029453 3300005530 Bacteria 5417
94 Ga0070679_100400911 3300005530 Bacteria 1318
95 Ga0070679_100499123 3300005530 Bacteria 1161
96 Ga0070684_100025754 3300005535 Bacteria 4947
97 Ga0070697_100036359 3300005536 Bacteria 3978
98 Ga0070697_100049830 3300005536 Bacteria 3398
99 Ga0068853_100001556 3300005539 Bacteria 16698
100 Ga0068853_100022385 3300005539 Bacteria 5278
101 Ga0068853_100292243 3300005539 Bacteria 1504
102 Ga0070672_100000432 3300005543 Bacteria 24384
103 Ga0070672_100040863 3300005543 Bacteria 3562
104 Ga0070672_100165485 3300005543 Bacteria 1837
105 Ga0070686_100182838 3300005544 Bacteria 1491
106 Ga0070695_100022597 3300005545 Bacteria 3859
107 Ga0070696_100002380 3300005546 Bacteria 12442
108 Ga0070696_100334292 3300005546 Bacteria 1169
109 Ga0070665_100002829 3300005548 Bacteria 18790
110 Ga0070665_100092531 3300005548 Bacteria 3028
111 Ga0070704_100205721 3300005549 Bacteria 1592
112 Ga0068855_100005450 3300005563 Bacteria 15512
113 Ga0068855_100035702 3300005563 Bacteria 5922
114 Ga0068855_100037150 3300005563 Bacteria 5794
115 Ga0068855_100042734 3300005563 Bacteria 5371
116 Ga0068855_100073597 3300005563 Bacteria 3969
117 Ga0068855_100355254 3300005563 Bacteria 1613
118 Ga0070664_100010669 3300005564 Bacteria 7446
119 Ga0070664_100033955 3300005564 Bacteria 4277
120 Ga0070664_100040543 3300005564 Bacteria 3926
121 Ga0070664_100078317 3300005564 Bacteria 2843
122 Ga0070664_100198722 3300005564 Bacteria 1788
123 Ga0068857_100002484 3300005577 Bacteria 15068
124 Ga0068857_100030985 3300005577 Bacteria 4726
125 Ga0068854_100115659 3300005578 Bacteria 2029
126 Ga0068856_100000679 3300005614 Bacteria 36874
127 Ga0068856_100001779 3300005614 Bacteria 22523
128 Ga0068856_100018737 3300005614 Bacteria 6710
129 Ga0068856_100054900 3300005614 Bacteria 3931
130 Ga0068856_100116822 3300005614 Bacteria 2669
131 Ga0068856_100711496 3300005614 Bacteria 1025
132 Ga0070702_100209951 3300005615 Bacteria 1295
133 Ga0068852_100002542 3300005616 Bacteria 12563
134 Ga0068852_100002706 3300005616 Bacteria 12247
135 Ga0068852_100003799 3300005616 Bacteria 10597
136 Ga0068852_100036588 3300005616 Bacteria 4109
137 Ga0068852_100044045 3300005616 Bacteria 3787
138 Ga0068864_100022785 3300005618 Bacteria 5253
139 Ga0068864_100114710 3300005618 Bacteria 2402
140 Ga0068864_100467874 3300005618 Bacteria 1208
141 Ga0068866_10084376 3300005718 Bacteria 1714
142 Ga0068866_10089312 3300005718 Bacteria 1674
143 Ga0068861_100019103 3300005719 Bacteria 4894
144 Ga0068861_100092425 3300005719 Bacteria 2390
145 Ga0068851_10002632 3300005834 Bacteria 7912
146 Ga0068851_10008680 3300005834 Bacteria 4706
147 Ga0068851_10014195 3300005834 Bacteria 3780
148 Ga0068851_10082213 3300005834 Bacteria 1684
149 Ga0068851_10234801 3300005834 Bacteria 1035
150 Ga0068870_10005696 3300005840 Bacteria 5453
151 Ga0068870_10011812 3300005840 Bacteria 4062
152 Ga0068863_100062212 3300005841 Bacteria 3530
153 Ga0068863_100066199 3300005841 Bacteria 3418
154 Ga0068858_100123932 3300005842 Bacteria 2418
155 Ga0068858_100143371 3300005842 Bacteria 2243
156 Ga0068860_100005725 3300005843 Bacteria 12540
157 Ga0068860_100156343 3300005843 Bacteria 2197
158 Ga0068862_100068516 3300005844 Bacteria 3061
159 Ga0081538_10030637 3300005981 Bacteria 3647
160 Ga0081539_10024897 3300005985 Bacteria 3869
161 Ga0081539_10031901 3300005985 Bacteria 3238
162 Ga0081539_10078728 3300005985 Bacteria 1739
163 Ga0081539_10114590 3300005985 Bacteria 1350
164 Ga0097621_100188123 3300006237 Bacteria 1787
165 Ga0097621_100363322 3300006237 Bacteria 1290
166 Ga0068871_100199946 3300006358 Bacteria 1725
167 Ga0075428_100004333 3300006844 Bacteria 15645
168 Ga0075428_100174951 3300006844 Bacteria 2325
169 Ga0075428_100192594 3300006844 Bacteria 2205
170 Ga0075430_100007771 3300006846 Bacteria 9060
171 Ga0075431_100003624 3300006847 Bacteria 14962
172 Ga0075431_100308724 3300006847 Bacteria 1597
173 Ga0075433_10054937 3300006852 Bacteria 3475
174 Ga0075433_10116173 3300006852 Bacteria 2374
175 Ga0075433_10584599 3300006852 Bacteria 981
176 Ga0075434_100182701 3300006871 Bacteria 2118
177 Ga0075429_100271974 3300006880 Bacteria 1484
178 Ga0068865_100111241 3300006881 Bacteria 2021
179 Ga0068865_100213962 3300006881 Bacteria 1503
180 Ga0075435_100010631 3300007076 Bacteria 6736
181 Ga0105240_10003438 3300009093 Bacteria 24585
182 Ga0105240_10072190 3300009093 Bacteria 4267
183 Ga0105240_10078600 3300009093 Bacteria 4062
184 Ga0111539_10015315 3300009094 Bacteria 9549
185 Ga0111539_10015696 3300009094 Bacteria 9415
186 Ga0105245_10040619 3300009098 Bacteria 4145
187 Ga0114129_10007238 3300009147 Bacteria 15799
188 Ga0114129_10095883 3300009147 Bacteria 4108
189 Ga0114129_10472826 3300009147 Bacteria 1641
190 Ga0105243_10022731 3300009148 Bacteria 4768
191 Ga0105243_10370476 3300009148 Bacteria 1321
192 Ga0105241_10007483 3300009174 Bacteria 8037
193 Ga0105248_10003311 3300009177 Bacteria 17881
194 Ga0105248_10216637 3300009177 Bacteria 2156
195 Ga0105238_10000656 3300009551 Bacteria 36235
196 Ga0105238_10200938 3300009551 Bacteria 1968
197 Ga0105249_10042315 3300009553 Bacteria 4142
198 Ga0105239_10214760 3300010375 Bacteria 2156
199 Ga0105239_10417840 3300010375 Bacteria 1519
200 Ga0105239_10620952 3300010375 Bacteria 1233
201 Ga0157373_10003033 3300013100 Bacteria 12664
202 Ga0157373_10027535 3300013100 Bacteria 4101
203 Ga0157371_10000273 3300013102 Bacteria 70036
204 Ga0157370_10004474 3300013104 Bacteria 16013
205 Ga0157370_10007899 3300013104 Bacteria 11527
206 Ga0157370_10017014 3300013104 Bacteria 7347
207 Ga0157370_10020330 3300013104 Bacteria 6631
208 Ga0157370_10049179 3300013104 Bacteria 4036
209 Ga0157370_10054524 3300013104 Bacteria 3811
210 Ga0157369_10010867 3300013105 Bacteria 10370
211 Ga0157369_10016675 3300013105 Bacteria 8258
212 Ga0157369_10028052 3300013105 Bacteria 6234
213 Ga0157374_10020920 3300013296 Bacteria 5813
214 Ga0157374_10138804 3300013296 Bacteria 2358
215 Ga0157378_10018656 3300013297 Bacteria 6099
216 Ga0157378_10229213 3300013297 Bacteria 1769
217 Ga0157378_10229440 3300013297 Bacteria 1768
218 Ga0163162_10402353 3300013306 Bacteria 1502
219 Ga0163162_10449456 3300013306 Bacteria 1421
220 Ga0157372_10001706 3300013307 Bacteria 23820
221 Ga0157372_10002588 3300013307 Bacteria 19572
222 Ga0157372_10036492 3300013307 Bacteria 5418
223 Ga0157372_10057019 3300013307 Bacteria 4366
224 Ga0157372_10066792 3300013307 Bacteria 4041
225 Ga0157372_10136628 3300013307 Bacteria 2824
226 Ga0157375_10114654 3300013308 Bacteria 2797
227 Ga0157375_10131566 3300013308 Bacteria 2622
228 Ga0157375_10385141 3300013308 Bacteria 1569
229 Ga0157375_10430275 3300013308 Bacteria 1486
230 Ga0157375_10569951 3300013308 Bacteria 1293
231 Ga0163163_10096738 3300014325 Bacteria 2973
232 Ga0157380_10003539 3300014326 Bacteria 10740
233 Ga0157380_10004034 3300014326 Bacteria 10137
234 Ga0182008_10233914 3300014497 Bacteria 943
235 Ga0157379_10038476 3300014968 Bacteria 4267
236 Ga0157379_10098627 3300014968 Bacteria 2623
237 Ga0157376_10049319 3300014969 Bacteria 3486
238 Ga0157376_10084882 3300014969 Bacteria 2727
239 Ga0213876_10020297 3300021384 Bacteria 3512
240 Ga0209676_1000049 3300025292 Bacteria 403210
241 Ga0207697_10000497 3300025315 Bacteria 22094
242 Ga0207656_10008621 3300025321 Bacteria 3759
243 Ga0207656_10032214 3300025321 Bacteria 2176
244 Ga0207682_10000644 3300025893 Bacteria 16283
245 Ga0207692_10050460 3300025898 Bacteria 2104
246 Ga0207642_10034974 3300025899 Bacteria 2141
247 Ga0207642_10045010 3300025899 Bacteria 1957
248 Ga0207680_10010879 3300025903 Bacteria 4572
249 Ga0207699_10058311 3300025906 Bacteria 2309
250 Ga0207699_10120542 3300025906 Bacteria 1696
251 Ga0207645_10004152 3300025907 Bacteria 10770
252 Ga0207645_10158714 3300025907 Bacteria 1479
253 Ga0207643_10000874 3300025908 Bacteria 18174
254 Ga0207705_10049712 3300025909 Bacteria 3018
255 Ga0207705_10141044 3300025909 Bacteria 1800
256 Ga0207705_10265826 3300025909 Bacteria 1311
257 Ga0207684_10019411 3300025910 Bacteria 5817
258 Ga0207684_10240959 3300025910 Bacteria 1560
259 Ga0207684_10522417 3300025910 Bacteria 1017
260 Ga0207707_10001278 3300025912 Bacteria 23488
261 Ga0207707_10347312 3300025912 Bacteria 1279
262 Ga0207707_10430068 3300025912 Bacteria 1131
263 Ga0207695_10028630 3300025913 Bacteria 6170
264 Ga0207695_10117387 3300025913 Bacteria 2634
265 Ga0207660_10274602 3300025917 Bacteria 1336
266 Ga0207657_10001345 3300025919 Bacteria 26151
267 Ga0207657_10003042 3300025919 Bacteria 17950
268 Ga0207657_10027008 3300025919 Bacteria 5263
269 Ga0207657_10028587 3300025919 Bacteria 5083
270 Ga0207649_10011713 3300025920 Bacteria 4846
271 Ga0207649_10018743 3300025920 Bacteria 3943
272 Ga0207649_10024723 3300025920 Bacteria 3495
273 Ga0207649_10068099 3300025920 Bacteria 2262
274 Ga0207649_10094501 3300025920 Bacteria 1965
275 Ga0207649_10400475 3300025920 Bacteria 1027
276 Ga0207652_10050277 3300025921 Bacteria 3571
277 Ga0207652_10064073 3300025921 Bacteria 3180
278 Ga0207652_10087653 3300025921 Bacteria 2730
279 Ga0207652_10194105 3300025921 Bacteria 1826
280 Ga0207646_10011651 3300025922 Bacteria 8502
281 Ga0207646_10219540 3300025922 Bacteria 1717
282 Ga0207646_10286366 3300025922 Bacteria 1489
283 Ga0207646_10304852 3300025922 Bacteria 1439
284 Ga0207694_10017527 3300025924 Bacteria 5414
285 Ga0207694_10263977 3300025924 Bacteria 1411
286 Ga0207650_10003275 3300025925 Bacteria 11159
287 Ga0207650_10046531 3300025925 Bacteria 3194
288 Ga0207650_10121359 3300025925 Bacteria 2035
289 Ga0207650_10259564 3300025925 Bacteria 1409
290 Ga0207650_10272283 3300025925 Bacteria 1376
291 Ga0207659_10005755 3300025926 Bacteria 7552
292 Ga0207659_10007883 3300025926 Bacteria 6583
293 Ga0207659_10040453 3300025926 Bacteria 3260
294 Ga0207700_10302127 3300025928 Bacteria 1382
295 Ga0207664_10018441 3300025929 Bacteria 5138
296 Ga0207644_10019099 3300025931 Bacteria 4647
297 Ga0207644_10020434 3300025931 Bacteria 4502
298 Ga0207644_10033365 3300025931 Bacteria 3596
299 Ga0207644_10056568 3300025931 Bacteria 2831
300 Ga0207644_10097418 3300025931 Bacteria 2203
301 Ga0207690_10001428 3300025932 Bacteria 14946
302 Ga0207690_10051196 3300025932 Bacteria 2761
303 Ga0207690_10066754 3300025932 Bacteria 2465
304 Ga0207690_10283422 3300025932 Bacteria 1291
305 Ga0207706_10001691 3300025933 Bacteria 21750
306 Ga0207706_10007255 3300025933 Bacteria 10248
307 Ga0207706_10012984 3300025933 Bacteria 7582
308 Ga0207709_10020201 3300025935 Bacteria 3754
309 Ga0207669_10027283 3300025937 Bacteria 3123
310 Ga0207669_10031297 3300025937 Bacteria 2971
311 Ga0207669_10040780 3300025937 Bacteria 2696
312 Ga0207704_10008218 3300025938 Bacteria 4975
313 Ga0207691_10000752 3300025940 Bacteria 32065
314 Ga0207691_10130619 3300025940 Bacteria 2219
315 Ga0207711_10009597 3300025941 Bacteria 8067
316 Ga0207711_10285327 3300025941 Bacteria 1521
317 Ga0207689_10006541 3300025942 Bacteria 10284
318 Ga0207689_10510183 3300025942 Bacteria 1008
319 Ga0207661_10037964 3300025944 Bacteria 3772
320 Ga0207661_10082824 3300025944 Bacteria 2653
321 Ga0207679_10003878 3300025945 Bacteria 9273
322 Ga0207679_10005925 3300025945 Bacteria 7687
323 Ga0207679_10029177 3300025945 Bacteria 3838
324 Ga0207679_10044620 3300025945 Bacteria 3199
325 Ga0207679_10070907 3300025945 Bacteria 2627
326 Ga0207679_10079045 3300025945 Bacteria 2507
327 Ga0207667_10003122 3300025949 Bacteria 20502
328 Ga0207667_10005307 3300025949 Bacteria 15700
329 Ga0207667_10019342 3300025949 Bacteria 7605
330 Ga0207667_10022553 3300025949 Bacteria 6951
331 Ga0207667_10035932 3300025949 Bacteria 5314
332 Ga0207712_10083554 3300025961 Bacteria 2331
333 Ga0207668_10002294 3300025972 Bacteria 11167
334 Ga0207668_10002418 3300025972 Bacteria 10921
335 Ga0207658_10001326 3300025986 Bacteria 19389
336 Ga0207658_10023380 3300025986 Bacteria 4314
337 Ga0207658_10470752 3300025986 Bacteria 1115
338 Ga0207658_10683782 3300025986 Bacteria 926
339 Ga0207677_10007809 3300026023 Bacteria 5940
340 Ga0207703_10027074 3300026035 Bacteria 4515
341 Ga0207703_10090331 3300026035 Bacteria 2574
342 Ga0207703_10689495 3300026035 Bacteria 971
343 Ga0207639_10709716 3300026041 Bacteria 933
344 Ga0207678_10002452 3300026067 Bacteria 16844
345 Ga0207678_10006626 3300026067 Bacteria 10264
346 Ga0207678_10025800 3300026067 Bacteria 5128
347 Ga0207678_10071324 3300026067 Bacteria 2978
348 Ga0207678_10122514 3300026067 Bacteria 2219
349 Ga0207708_10004452 3300026075 Bacteria 10325
350 Ga0207702_10021115 3300026078 Bacteria 5388
351 Ga0207702_10039032 3300026078 Bacteria 3978
352 Ga0207702_10081263 3300026078 Bacteria 2814
353 Ga0207702_10141045 3300026078 Bacteria 2181
354 Ga0207641_10095583 3300026088 Bacteria 2608
355 Ga0207641_10210347 3300026088 Bacteria 1798
356 Ga0207648_10002953 3300026089 Bacteria 17987
357 Ga0207648_10005886 3300026089 Bacteria 12269
358 Ga0207648_10073380 3300026089 Bacteria 2982
359 Ga0207648_10161559 3300026089 Bacteria 1978
360 Ga0207676_10046542 3300026095 Bacteria 3357
361 Ga0207674_10001420 3300026116 Bacteria 30917
362 Ga0207674_10511991 3300026116 Bacteria 1159
363 Ga0207674_10661053 3300026116 Bacteria 1009
364 Ga0207675_100002379 3300026118 Bacteria 18636
365 Ga0207675_100138658 3300026118 Bacteria 2309
366 Ga0207675_100295223 3300026118 Bacteria 1577
367 Ga0207683_10000245 3300026121 Bacteria 48268
368 Ga0207683_10002181 3300026121 Bacteria 17203
369 Ga0207683_10019663 3300026121 Bacteria 5770
370 Ga0207683_10126278 3300026121 Bacteria 2299
371 Ga0207683_10194552 3300026121 Bacteria 1842
372 Ga0207698_10002920 3300026142 Bacteria 10213
373 Ga0207698_10004975 3300026142 Bacteria 8148
374 Ga0207698_10013518 3300026142 Bacteria 5389
375 Ga0207698_10351313 3300026142 Bacteria 1393
376 Ga0209970_1004644 3300027614 Bacteria 2273
377 Ga0209971_1001838 3300027682 Bacteria 5196
378 Ga0268266_10005308 3300028379 Bacteria 12079
379 Ga0268266_10009986 3300028379 Bacteria 8334
380 Ga0268265_10038234 3300028380 Bacteria 3529
381 Ga0307408_100017495 3300031548 Bacteria 4797
382 Ga0316575_10000341 3300031665 Bacteria 13129
383 Ga0316579_10020308 3300031691 Bacteria 2945
384 Ga0316579_10054773 3300031691 Unclassified 1870
385 Ga0316576_10000435 3300031727 Bacteria 19417
386 Ga0316576_10070253 3300031727 Bacteria 2583
387 Ga0316576_10164679 3300031727 Bacteria 1673
388 Ga0316576_10210841 3300031727 Bacteria 1462
389 Ga0316578_10045335 3300031728 Unclassified 2559
390 Ga0316578_10047536 3300031728 Bacteria 2504
391 Ga0307405_10004983 3300031731 Bacteria 6346
392 Ga0316577_10000872 3300031733 Bacteria 13222
393 Ga0316577_10004597 3300031733 Bacteria 7151
394 Ga0316577_10073905 3300031733 Bacteria 1904
395 Ga0316577_10207180 3300031733 Bacteria 1108
396 Ga0307413_10012470 3300031824 Bacteria 4233
397 Ga0307410_10015019 3300031852 Bacteria 4579
398 Ga0307410_10028977 3300031852 Bacteria 3519
399 Ga0307406_10012349 3300031901 Bacteria 4871
400 Ga0307407_10003099 3300031903 Bacteria 6718
401 Ga0307412_10016622 3300031911 Bacteria 4389
402 Ga0307412_10060619 3300031911 Bacteria 2540
403 Ga0307409_100009178 3300031995 Bacteria 6060
404 Ga0307409_100132328 3300031995 Bacteria 2134
405 Ga0307416_100007024 3300032002 Bacteria 7104
406 Ga0307416_100027230 3300032002 Bacteria 4229
407 Ga0307414_10214946 3300032004 Bacteria 1574
408 Ga0307411_10001330 3300032005 Bacteria 9960
409 Ga0307411_10004039 3300032005 Bacteria 6942
410 Ga0307415_100012085 3300032126 Bacteria 4977
411 Ga0307415_100130867 3300032126 Bacteria 1899
412 Ga0316583_10031921 3300032133 Unclassified 1874
413 Ga0316585_10000987 3300032137 Bacteria 7343
414 Ga0316580_10000458 3300032139 Bacteria 9392
415 Ga0373952_0038623 3300035092 Bacteria 1094
416 Ga0373954_0133151 3300035118 Bacteria 1211
417 Ga0373957_0116532 3300035120 Bacteria 1079
418 Ga0373960_0053632 3300035121 Bacteria 1204
419 Ga0316574_0000047 3300035398 Bacteria 30102
420 Ga0316574_0286691 3300035398 Bacteria 1048
421 Ga0373924_0006003 3300035410 Bacteria 4331
422 Ga0373931_0032389 3300035691 Bacteria 2705
423 Ga0373933_0078113 3300035724 Bacteria 2025
424 Ga0373937_0009924 3300036401 Bacteria 8303
425 Ga0373937_0116573 3300036401 Bacteria 2487
426 Ga0316582_0021320 3300036647 Bacteria 3825
427 Ga0316582_0032286 3300036647 Unclassified 3207
428 Ga0316582_0076423 3300036647 Unclassified 2178
429 Ga0316584_0071705 3300036712 Bacteria 2595
430 Ga0316584_0098296 3300036712 Bacteria 2191
431 Ga0316584_0102818 3300036712 Bacteria 2139
432 Ga0316584_0149061 3300036712 Unclassified 1742
433 Ga0395899_0151523 3300037312 Bacteria 1643
434 Ga0395900_0081768 3300037418 Bacteria 3318
435 Ga0395898_0067232 3300037466 Bacteria 3470
436 Ga0316581_0002994 3300037588 Unclassified 4153
437 Ga0395901_0047007 3300038443 Bacteria 4483
438 Ga0400484_10409 3300038725 Bacteria 6559
439 Ga0400490_01702 3300038726 Bacteria 55809
440 Ga0400488_61586 3300038741 Bacteria 7139
441 Ga0400488_62315 3300038741 Bacteria 1676
442 Ga0400483_260281 3300039062 Bacteria 23990
443 Ga0400483_285562 3300039062 Bacteria 2228
444 Ga0400489_75970 3300039093 Bacteria 60900
445 Ga0400487_26603 3300039110 Bacteria 1157
446 Ga0436365_0199637 3300039437 Bacteria 5194
447 Ga0436360_0443424 3300039438 Bacteria 1219
448 Ga0451577_0003014 3300042876 Bacteria 19174
449 Ga0453684_0001719 3300044712 Bacteria 58720
450 Ga0453684_0018040 3300044712 Bacteria 10866
451 Ga0453684_0191798 3300044712 Unclassified 2390
452 Ga0453684_0310944 3300044712 Bacteria 1788
453 Ga0453684_0665407 3300044712 Bacteria 1135
454 Ga0451576_0026309 3300045051 Bacteria 6259
455 Ga0495658_0069252 3300046683 Bacteria 2045
456 Ga0496101_0043351 3300048904 Bacteria 3216
457 Ga0496102_0006365 3300048905 Bacteria 10069
458 Ga0496103_0053101 3300048906 Bacteria 2511
459 Ga0496104_0013581 3300048907 Bacteria 7341
460 Ga0496105_0002896 3300048908 Bacteria 12590
461 Ga0496106_0067457 3300048909 Bacteria 2727
462 Ga0496106_0111107 3300048909 Bacteria 2134
463 Ga0496107_0005868 3300048910 Bacteria 8409
464 Ga0496108_0004469 3300048911 Bacteria 11256
465 Ga0496108_0234214 3300048911 Bacteria 1597
466 Ga0496109_0007369 3300048912 Bacteria 9310
467 Ga0496109_0742549 3300048912 Bacteria 919
468 Ga0496110_0080441 3300048913 Bacteria 2904
469 Ga0496110_0151928 3300048913 Bacteria 2097
470 Ga0496110_0224866 3300048913 Bacteria 1707
471 Ga0496111_0019357 3300048914 Bacteria 4727
472 Ga0496111_0195633 3300048914 Bacteria 1503
473 Ga0496112_0023488 3300048915 Bacteria 5892
474 Ga0496113_0023496 3300048916 Bacteria 4372
475 Ga0501031_0056863 3300049568 Bacteria 2549
476 Ga0501033_0096163 3300049570 Bacteria 2164
477 Ga0501036_0018922 3300049572 Bacteria 5778
478 Ga0501037_0012565 3300049573 Bacteria 6239
479 Ga0501038_0019833 3300049574 Bacteria 6052
480 Ga0501038_0199590 3300049574 Bacteria 1606
481 Ga0501039_0005098 3300049575 Bacteria 9952
482 Ga0501040_0001112 3300049576 Bacteria 17011
483 Ga0501041_0000781 3300049577 Bacteria 17065
484 Ga0501041_0004162 3300049577 Bacteria 8373
485 Ga0501042_0001110 3300049578 Bacteria 15473
486 Ga0501042_0031826 3300049578 Bacteria 3732
487 Ga0501042_0172117 3300049578 Bacteria 1562
488 Ga0501043_0039723 3300049579 Bacteria 3699
489 Ga0501046_0005138 3300049580 Bacteria 11731
490 Ga0501046_0075027 3300049580 Bacteria 2623
491 Ga0501046_0496576 3300049580 Bacteria 874
492 Ga0501048_0023841 3300049582 Bacteria 4469
493 Ga0501048_0039266 3300049582 Bacteria 3397
494 Ga0501068_0043437 3300049584 Bacteria 2704
495 Ga0501071_0341570 3300049587 Bacteria 1138
496 Ga0501072_0009238 3300049588 Bacteria 7493
497 Ga0501072_0016226 3300049588 Bacteria 5713
498 Ga0501072_0033855 3300049588 Bacteria 4003
499 Ga0501073_0068670 3300049589 Bacteria 2470
500 Ga0501073_0295693 3300049589 Bacteria 1117
501 Ga0501074_0072563 3300049590 Bacteria 2473
502 Ga0501074_0367509 3300049590 Bacteria 1021
503 Ga0501075_0011012 3300049591 Bacteria 6381
504 Ga0501075_0014250 3300049591 Bacteria 5696
505 Ga0501075_0026632 3300049591 Bacteria 4258
506 Ga0501075_0689204 3300049591 Bacteria 778
507 Ga0501076_0002670 3300049592 Bacteria 12307
508 Ga0501076_0068899 3300049592 Bacteria 2826
509 Ga0501077_0001273 3300049593 Bacteria 15226
510 Ga0501077_0009470 3300049593 Bacteria 6055
511 Ga0501077_0078415 3300049593 Bacteria 2093
512 Ga0501225_0021645 3300049705 Bacteria 1776
513 Ga0501079_0004747 3300049741 Bacteria 10069
514 Ga0501079_0008046 3300049741 Bacteria 7988
515 Ga0501079_0012425 3300049741 Bacteria 6497
516 Ga0501080_0012754 3300049742 Bacteria 7709
517 Ga0501081_0001305 3300049743 Bacteria 15195
518 Ga0501081_0008240 3300049743 Bacteria 6766
519 Ga0501081_0020630 3300049743 Bacteria 4392
520 Ga0501083_0169081 3300049744 Bacteria 1429
521 Ga0501035_0049167 3300049822 Bacteria 3780
522 Ga0501044_0120616 3300049823 Bacteria 2624
523 Ga0501044_0666567 3300049823 Bacteria 928
524 Ga0501045_0000354 3300049824 Bacteria 27282
525 Ga0501045_0007274 3300049824 Bacteria 7689
526 Ga0501045_0267357 3300049824 Bacteria 1273
527 nmdc:mga05p37_116524_c1 3300050507 Bacteria 2993
528 nmdc:mga05p37_187567_c1 3300050507 Bacteria 2513
529 nmdc:mga05p37_34678_c1 3300050507 Bacteria 6182
530 nmdc:mga05p37_51412_c1 3300050507 Bacteria 5068
531 nmdc:mga0qj67_16411_c1 3300050509 Bacteria 5616
532 nmdc:mga06r32_264676_c1 3300050510 Bacteria 1707
533 nmdc:mga06r32_63573_c1 3300050510 Bacteria 3558
534 nmdc:mga08y16_89736_c1 3300050511 Bacteria 3203
535 nmdc:mga0n895_151116_c1 3300050512 Bacteria 2352
536 nmdc:mga0n895_342931_c1 3300050512 Bacteria 1513
537 nmdc:mga0rr50_27371_c1 3300050513 Bacteria 3991
538 nmdc:mga0a205_743702_c1 3300050515 Bacteria 829
539 Ga0501084_0002657 3300054114 Bacteria 14402
540 Ga0501084_0007393 3300054114 Bacteria 9055
541 Ga0501084_0008122 3300054114 Bacteria 8646
542 Ga0501082_0000561 3300060353 Bacteria 32976
543 Ga0501082_0005995 3300060353 Bacteria 10538
544 Ga0501082_0071850 3300060353 Bacteria 2980
545 Ga0530510_0009195 3300061734 Bacteria 6924
546 Ga0530510_0239749 3300061734 Bacteria 1350
547 2524002948 2523533628 Bacteria 4098242
548 Ga0316576_10045147
549 JGI24752J21851_1005305
550 JGI24743J22301_10009804
551 Ga0065704_10104885
552 Ga0065715_10137931
553 Ga0070658_10009027
554 Ga0070658_10033739
555 Ga0070658_10200476
556 Ga0070658_10259138
557 Ga0070676_10027307
558 Ga0070676_10182739
559 Ga0070683_100099582
560 Ga0070690_100005472
561 Ga0070690_100304372
562 Ga0070670_100014497
563 Ga0070670_100045511
564 Ga0070670_100295753
565 Ga0070677_10003778
566 Ga0070677_10008241
567 Ga0068869_100330644
568 Ga0070666_10146035
569 Ga0070680_100513327
570 Ga0068868_100002877
571 Ga0070660_100002907
572 Ga0070660_100015931
573 Ga0070660_100042871
574 Ga0070660_100397214
575 Ga0070661_100002685
576 Ga0070661_100002695
577 Ga0070661_100061225
578 Ga0070661_100107484
579 Ga0070661_100148711
580 Ga0070661_100291751
581 Ga0070661_100610293
582 Ga0070668_100001549
583 Ga0070668_100003405
584 Ga0070669_100052570
585 Ga0070669_100053545
586 Ga0070675_100002507
587 Ga0070675_100190916
588 Ga0070671_100002791
589 Ga0070671_100031612
590 Ga0070671_100040973
591 Ga0070671_100045241
592 Ga0070671_100089200
593 Ga0070671_100301434
594 Ga0070671_100302870
595 Ga0070674_100000532
596 Ga0070674_100004810
597 Ga0070674_100390576
598 Ga0070673_100089933
599 Ga0070673_100131080
600 Ga0070659_100018897
601 Ga0070659_100024871
602 Ga0070659_100027140
603 Ga0070659_100042458
604 Ga0070659_100056372
605 Ga0070667_100041675
606 Ga0070709_10019964
607 Ga0070709_10060265
608 Ga0070709_10106252
609 Ga0070714_100010729
610 Ga0070714_100126301
611 Ga0070710_10120524
612 Ga0070701_10092363
613 Ga0070700_100088899
614 Ga0070708_100138285
615 Ga0070708_100147715
616 Ga0070708_100561043
617 Ga0070708_100705413
618 Ga0070663_100007228
619 Ga0070663_100051446
620 Ga0070663_100116292
621 Ga0070678_100000608
622 Ga0070678_100002571
623 Ga0070662_100002412
624 Ga0070662_100295004
625 Ga0070681_10001734
626 Ga0068867_100027441
627 Ga0068867_100216100
628 Ga0068867_100245902
629 Ga0068867_100410835
630 Ga0070685_10008202
631 Ga0070706_100043941
632 Ga0070707_100044115
633 Ga0070707_100187949
634 Ga0070707_100382749
635 Ga0070707_100399212
636 Ga0070698_100104688
637 Ga0070698_100225994
638 Ga0070699_100024150
639 Ga0070699_100127003
640 Ga0070679_100029453
641 Ga0070679_100400911
642 Ga0070679_100499123
643 Ga0070684_100025754
644 Ga0070697_100036359
645 Ga0070697_100049830
646 Ga0068853_100001556
647 Ga0068853_100022385
648 Ga0068853_100292243
649 Ga0070672_100000432
650 Ga0070672_100040863
651 Ga0070672_100165485
652 Ga0070686_100182838
653 Ga0070695_100022597
654 Ga0070696_100002380
655 Ga0070696_100334292
656 Ga0070665_100002829
657 Ga0070665_100092531
658 Ga0070704_100205721
659 Ga0068855_100005450
660 Ga0068855_100035702
661 Ga0068855_100037150
662 Ga0068855_100042734
663 Ga0068855_100073597
664 Ga0068855_100355254
665 Ga0070664_100010669
666 Ga0070664_100033955
667 Ga0070664_100040543
668 Ga0070664_100078317
669 Ga0070664_100198722
670 Ga0068857_100002484
671 Ga0068857_100030985
672 Ga0068854_100115659
673 Ga0068856_100000679
674 Ga0068856_100001779
675 Ga0068856_100018737
676 Ga0068856_100054900
677 Ga0068856_100116822
678 Ga0068856_100711496
679 Ga0070702_100209951
680 Ga0068852_100002542
681 Ga0068852_100002706
682 Ga0068852_100003799
683 Ga0068852_100036588
684 Ga0068852_100044045
685 Ga0068864_100022785
686 Ga0068864_100114710
687 Ga0068864_100467874
688 Ga0068866_10084376
689 Ga0068866_10089312
690 Ga0068861_100019103
691 Ga0068861_100092425
692 Ga0068851_10002632
693 Ga0068851_10008680
694 Ga0068851_10014195
695 Ga0068851_10082213
696 Ga0068851_10234801
697 Ga0068870_10005696
698 Ga0068870_10011812
699 Ga0068863_100062212
700 Ga0068863_100066199
701 Ga0068858_100123932
702 Ga0068858_100143371
703 Ga0068860_100005725
704 Ga0068860_100156343
705 Ga0068862_100068516
706 Ga0081538_10030637
707 Ga0081539_10024897
708 Ga0081539_10031901
709 Ga0081539_10078728
710 Ga0081539_10114590
711 Ga0097621_100188123
712 Ga0097621_100363322
713 Ga0068871_100199946
714 Ga0075428_100004333
715 Ga0075428_100174951
716 Ga0075428_100192594
717 Ga0075430_100007771
718 Ga0075431_100003624
719 Ga0075431_100308724
720 Ga0075433_10054937
721 Ga0075433_10116173
722 Ga0075433_10584599
723 Ga0075434_100182701
724 Ga0075429_100271974
725 Ga0068865_100111241
726 Ga0068865_100213962
727 Ga0075435_100010631
728 Ga0105240_10003438
729 Ga0105240_10072190
730 Ga0105240_10078600
731 Ga0111539_10015315
732 Ga0111539_10015696
733 Ga0105245_10040619
734 Ga0114129_10007238
735 Ga0114129_10095883
736 Ga0114129_10472826
737 Ga0105243_10022731
738 Ga0105243_10370476
739 Ga0105241_10007483
740 Ga0105248_10003311
741 Ga0105248_10216637
742 Ga0105238_10000656
743 Ga0105238_10200938
744 Ga0105249_10042315
745 Ga0105239_10214760
746 Ga0105239_10417840
747 Ga0105239_10620952
748 Ga0157373_10003033
749 Ga0157373_10027535
750 Ga0157371_10000273
751 Ga0157370_10004474
752 Ga0157370_10007899
753 Ga0157370_10017014
754 Ga0157370_10020330
755 Ga0157370_10049179
756 Ga0157370_10054524
757 Ga0157369_10010867
758 Ga0157369_10016675
759 Ga0157369_10028052
760 Ga0157374_10020920
761 Ga0157374_10138804
762 Ga0157378_10018656
763 Ga0157378_10229213
764 Ga0157378_10229440
765 Ga0163162_10402353
766 Ga0163162_10449456
767 Ga0157372_10001706
768 Ga0157372_10002588
769 Ga0157372_10036492
770 Ga0157372_10057019
771 Ga0157372_10066792
772 Ga0157372_10136628
773 Ga0157375_10114654
774 Ga0157375_10131566
775 Ga0157375_10385141
776 Ga0157375_10430275
777 Ga0157375_10569951
778 Ga0163163_10096738
779 Ga0157380_10003539
780 Ga0157380_10004034
781 Ga0182008_10233914
782 Ga0157379_10038476
783 Ga0157379_10098627
784 Ga0157376_10049319
785 Ga0157376_10084882
786 Ga0213876_10020297
787 Ga0209676_1000049
788 Ga0207697_10000497
789 Ga0207656_10008621
790 Ga0207656_10032214
791 Ga0207682_10000644
792 Ga0207692_10050460
793 Ga0207642_10034974
794 Ga0207642_10045010
795 Ga0207680_10010879
796 Ga0207699_10058311
797 Ga0207699_10120542
798 Ga0207645_10004152
799 Ga0207645_10158714
800 Ga0207643_10000874
801 Ga0207705_10049712
802 Ga0207705_10141044
803 Ga0207705_10265826
804 Ga0207684_10019411
805 Ga0207684_10240959
806 Ga0207684_10522417
807 Ga0207707_10001278
808 Ga0207707_10347312
809 Ga0207707_10430068
810 Ga0207695_10028630
811 Ga0207695_10117387
812 Ga0207660_10274602
813 Ga0207657_10001345
814 Ga0207657_10003042
815 Ga0207657_10027008
816 Ga0207657_10028587
817 Ga0207649_10011713
818 Ga0207649_10018743
819 Ga0207649_10024723
820 Ga0207649_10068099
821 Ga0207649_10094501
822 Ga0207649_10400475
823 Ga0207652_10050277
824 Ga0207652_10064073
825 Ga0207652_10087653
826 Ga0207652_10194105
827 Ga0207646_10011651
828 Ga0207646_10219540
829 Ga0207646_10286366
830 Ga0207646_10304852
831 Ga0207694_10017527
832 Ga0207694_10263977
833 Ga0207650_10003275
834 Ga0207650_10046531
835 Ga0207650_10121359
836 Ga0207650_10259564
837 Ga0207650_10272283
838 Ga0207659_10005755
839 Ga0207659_10007883
840 Ga0207659_10040453
841 Ga0207700_10302127
842 Ga0207664_10018441
843 Ga0207644_10019099
844 Ga0207644_10020434
845 Ga0207644_10033365
846 Ga0207644_10056568
847 Ga0207644_10097418
848 Ga0207690_10001428
849 Ga0207690_10051196
850 Ga0207690_10066754
851 Ga0207690_10283422
852 Ga0207706_10001691
853 Ga0207706_10007255
854 Ga0207706_10012984
855 Ga0207709_10020201
856 Ga0207669_10027283
857 Ga0207669_10031297
858 Ga0207669_10040780
859 Ga0207704_10008218
860 Ga0207691_10000752
861 Ga0207691_10130619
862 Ga0207711_10009597
863 Ga0207711_10285327
864 Ga0207689_10006541
865 Ga0207689_10510183
866 Ga0207661_10037964
867 Ga0207661_10082824
868 Ga0207679_10003878
869 Ga0207679_10005925
870 Ga0207679_10029177
871 Ga0207679_10044620
872 Ga0207679_10070907
873 Ga0207679_10079045
874 Ga0207667_10003122
875 Ga0207667_10005307
876 Ga0207667_10019342
877 Ga0207667_10022553
878 Ga0207667_10035932
879 Ga0207712_10083554
880 Ga0207668_10002294
881 Ga0207668_10002418
882 Ga0207658_10001326
883 Ga0207658_10023380
884 Ga0207658_10470752
885 Ga0207658_10683782
886 Ga0207677_10007809
887 Ga0207703_10027074
888 Ga0207703_10090331
889 Ga0207703_10689495
890 Ga0207639_10709716
891 Ga0207678_10002452
892 Ga0207678_10006626
893 Ga0207678_10025800
894 Ga0207678_10071324
895 Ga0207678_10122514
896 Ga0207708_10004452
897 Ga0207702_10021115
898 Ga0207702_10039032
899 Ga0207702_10081263
900 Ga0207702_10141045
901 Ga0207641_10095583
902 Ga0207641_10210347
903 Ga0207648_10002953
904 Ga0207648_10005886
905 Ga0207648_10073380
906 Ga0207648_10161559
907 Ga0207676_10046542
908 Ga0207674_10001420
909 Ga0207674_10511991
910 Ga0207674_10661053
911 Ga0207675_100002379
912 Ga0207675_100138658
913 Ga0207675_100295223
914 Ga0207683_10000245
915 Ga0207683_10002181
916 Ga0207683_10019663
917 Ga0207683_10126278
918 Ga0207683_10194552
919 Ga0207698_10002920
920 Ga0207698_10004975
921 Ga0207698_10013518
922 Ga0207698_10351313
923 Ga0209970_1004644
924 Ga0209971_1001838
925 Ga0268266_10005308
926 Ga0268266_10009986
927 Ga0268265_10038234
928 Ga0307408_100017495
929 Ga0316575_10000341
930 Ga0316579_10020308
931 Ga0316579_10054773
932 Ga0316576_10000435
933 Ga0316576_10070253
934 Ga0316576_10164679
935 Ga0316576_10210841
936 Ga0316578_10045335
937 Ga0316578_10047536
938 Ga0307405_10004983
939 Ga0316577_10000872
940 Ga0316577_10004597
941 Ga0316577_10073905
942 Ga0316577_10207180
943 Ga0307413_10012470
944 Ga0307410_10015019
945 Ga0307410_10028977
946 Ga0307406_10012349
947 Ga0307407_10003099
948 Ga0307412_10016622
949 Ga0307412_10060619
950 Ga0307409_100009178
951 Ga0307409_100132328
952 Ga0307416_100007024
953 Ga0307416_100027230
954 Ga0307414_10214946
955 Ga0307411_10001330
956 Ga0307411_10004039
957 Ga0307415_100012085
958 Ga0307415_100130867
959 Ga0316583_10031921
960 Ga0316585_10000987
961 Ga0316580_10000458
962 Ga0373952_0038623
963 Ga0373954_0133151
964 Ga0373957_0116532
965 Ga0373960_0053632
966 Ga0316574_0000047
967 Ga0316574_0286691
968 Ga0373924_0006003
969 Ga0373931_0032389
970 Ga0373933_0078113
971 Ga0373937_0009924
972 Ga0373937_0116573
973 Ga0316582_0021320
974 Ga0316582_0032286
975 Ga0316582_0076423
976 Ga0316584_0071705
977 Ga0316584_0098296
978 Ga0316584_0102818
979 Ga0316584_0149061
980 Ga0395899_0151523
981 Ga0395900_0081768
982 Ga0395898_0067232
983 Ga0316581_0002994
984 Ga0395901_0047007
985 Ga0400484_10409
986 Ga0400490_01702
987 Ga0400488_61586
988 Ga0400488_62315
989 Ga0400483_260281
990 Ga0400483_285562
991 Ga0400489_75970
992 Ga0400487_26603
993 Ga0436365_0199637
994 Ga0436360_0443424
995 Ga0451577_0003014
996 Ga0453684_0001719
997 Ga0453684_0018040
998 Ga0453684_0191798
999 Ga0453684_0310944
1000 Ga0453684_0665407
1001 Ga0451576_0026309
1002 Ga0495658_0069252
1003 Ga0496101_0043351
1004 Ga0496102_0006365
1005 Ga0496103_0053101
1006 Ga0496104_0013581
1007 Ga0496105_0002896
1008 Ga0496106_0067457
1009 Ga0496106_0111107
1010 Ga0496107_0005868
1011 Ga0496108_0004469
1012 Ga0496108_0234214
1013 Ga0496109_0007369
1014 Ga0496109_0742549
1015 Ga0496110_0080441
1016 Ga0496110_0151928
1017 Ga0496110_0224866
1018 Ga0496111_0019357
1019 Ga0496111_0195633
1020 Ga0496112_0023488
1021 Ga0496113_0023496
1022 Ga0501031_0056863
1023 Ga0501033_0096163
1024 Ga0501036_0018922
1025 Ga0501037_0012565
1026 Ga0501038_0019833
1027 Ga0501038_0199590
1028 Ga0501039_0005098
1029 Ga0501040_0001112
1030 Ga0501041_0000781
1031 Ga0501041_0004162
1032 Ga0501042_0001110
1033 Ga0501042_0031826
1034 Ga0501042_0172117
1035 Ga0501043_0039723
1036 Ga0501046_0005138
1037 Ga0501046_0075027
1038 Ga0501046_0496576
1039 Ga0501048_0023841
1040 Ga0501048_0039266
1041 Ga0501068_0043437
1042 Ga0501071_0341570
1043 Ga0501072_0009238
1044 Ga0501072_0016226
1045 Ga0501072_0033855
1046 Ga0501073_0068670
1047 Ga0501073_0295693
1048 Ga0501074_0072563
1049 Ga0501074_0367509
1050 Ga0501075_0011012
1051 Ga0501075_0014250
1052 Ga0501075_0026632
1053 Ga0501075_0689204
1054 Ga0501076_0002670
1055 Ga0501076_0068899
1056 Ga0501077_0001273
1057 Ga0501077_0009470
1058 Ga0501077_0078415
1059 Ga0501225_0021645
1060 Ga0501079_0004747
1061 Ga0501079_0008046
1062 Ga0501079_0012425
1063 Ga0501080_0012754
1064 Ga0501081_0001305
1065 Ga0501081_0008240
1066 Ga0501081_0020630
1067 Ga0501083_0169081
1068 Ga0501035_0049167
1069 Ga0501044_0120616
1070 Ga0501044_0666567
1071 Ga0501045_0000354
1072 Ga0501045_0007274
1073 Ga0501045_0267357
1074 nmdc:mga05p37_116524_c1
1075 nmdc:mga05p37_187567_c1
1076 nmdc:mga05p37_34678_c1
1077 nmdc:mga05p37_51412_c1
1078 nmdc:mga0qj67_16411_c1
1079 nmdc:mga06r32_264676_c1
1080 nmdc:mga06r32_63573_c1
1081 nmdc:mga08y16_89736_c1
1082 nmdc:mga0n895_151116_c1
1083 nmdc:mga0n895_342931_c1
1084 nmdc:mga0rr50_27371_c1
1085 nmdc:mga0a205_743702_c1
1086 Ga0501084_0002657
1087 Ga0501084_0007393
1088 Ga0501084_0008122
1089 Ga0501082_0000561
1090 Ga0501082_0005995
1091 Ga0501082_0071850
1092 Ga0530510_0009195
1093 Ga0530510_0239749
1094 2524002948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

194

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9664 9 250
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9647 9 250
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9615 9 250
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9525 12 252
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.946 11 252
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 12 250 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9568 10 231 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9537 8 255 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9534 26 250 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 8 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4V1ZPM8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9682 12 252 GO:0005524
GO:0016887
AF-A0A0Q9IVE0-F1-model_v4 ABC transporter ATP-binding protein 0.9641 12 254 GO:0005524
GO:0016887
AF-A0A0J6SXG5-F1-model_v4 Methionine ABC transporter ATP-binding protein 0.9639 44 253 GO:0005524
GO:0006865
GO:0016887
AF-A0A377GL99-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein HI_1087 0.9618 7 252 GO:0005524
GO:0016887
AF-A0A3C0VK17-F1-model_v4 ABC transporter ATP-binding protein 0.9605 9 253 GO:0005524
GO:0016887

Map