F461989

General Info

Members Datasets Scaffolds Average Seq Length
546 245 546 71

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11184651|Ga0111539_111846512
Length 83
Sequence MAKSNIDLHELDLAGLVEELRDTKQEALNLRFRNATGQLDNTSAIRSARRQIARINTLIRQREIAAAEGTAATAPTRAKKVTK

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
136 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
140 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
162 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
163 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
168 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 3.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.62
Nodule 0
Rhizoplane 8.24
Rhizosphere 78.94
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10076985 3300002244 Bacteria 627
2 Ga0070683_101648691 3300005329 Bacteria 617
3 Ga0070690_100072143 3300005330 Bacteria 2245
4 Ga0070670_100215041 3300005331 Bacteria 1672
5 Ga0070670_102245682 3300005331 Bacteria 503
6 Ga0068869_100975589 3300005334 Bacteria 737
7 Ga0070682_101851603 3300005337 Bacteria 527
8 Ga0068868_100824278 3300005338 Bacteria 839
9 Ga0068868_100912788 3300005338 Bacteria 799
10 Ga0068868_101196293 3300005338 Bacteria 703
11 Ga0068868_102081159 3300005338 Bacteria 540
12 Ga0070689_100163123 3300005340 Bacteria 1802
13 Ga0070689_102113740 3300005340 Bacteria 516
14 Ga0070687_100784365 3300005343 Bacteria 674
15 Ga0070661_101764086 3300005344 Bacteria 525
16 Ga0070668_100821913 3300005347 Bacteria 827
17 Ga0070668_101192012 3300005347 Bacteria 690
18 Ga0070669_100527220 3300005353 Bacteria 983
19 Ga0070669_101522195 3300005353 Bacteria 582
20 Ga0070675_102252589 3300005354 Bacteria 502
21 Ga0070671_100363938 3300005355 Bacteria 1235
22 Ga0070671_100528911 3300005355 Bacteria 1016
23 Ga0070671_100669749 3300005355 Bacteria 899
24 Ga0070671_100711082 3300005355 Bacteria 872
25 Ga0070671_101788884 3300005355 Bacteria 546
26 Ga0070674_100026846 3300005356 Bacteria 3767
27 Ga0070674_100108075 3300005356 Bacteria 2038
28 Ga0070674_101315716 3300005356 Bacteria 645
29 Ga0070673_100587382 3300005364 Bacteria 1015
30 Ga0070673_101039472 3300005364 Bacteria 764
31 Ga0070673_102225643 3300005364 Bacteria 521
32 Ga0070688_100097515 3300005365 Bacteria 1933
33 Ga0070688_100100365 3300005365 Bacteria 1907
34 Ga0070659_102030106 3300005366 Unclassified 516
35 Ga0070667_100547001 3300005367 Bacteria 1064
36 Ga0070701_10199589 3300005438 Bacteria 1182
37 Ga0070701_10208264 3300005438 Bacteria 1160
38 Ga0070700_100970286 3300005441 Bacteria 697
39 Ga0070663_100468949 3300005455 Bacteria 1041
40 Ga0070663_100942736 3300005455 Bacteria 748
41 Ga0070678_100403684 3300005456 Bacteria 1188
42 Ga0070678_100604159 3300005456 Bacteria 980
43 Ga0070678_100858072 3300005456 Bacteria 828
44 Ga0070678_101280559 3300005456 Bacteria 682
45 Ga0070662_100636821 3300005457 Bacteria 899
46 Ga0068867_100000479 3300005459 Bacteria 26567
47 Ga0068867_100764276 3300005459 Bacteria 859
48 Ga0068867_101063568 3300005459 Bacteria 737
49 Ga0070685_10545693 3300005466 Bacteria 827
50 Ga0070684_102372869 3300005535 Bacteria 500
51 Ga0070672_100026863 3300005543 Bacteria 4290
52 Ga0070672_100649084 3300005543 Bacteria 922
53 Ga0070686_100078780 3300005544 Bacteria 2177
54 Ga0070665_101035735 3300005548 Bacteria 833
55 Ga0070664_100249304 3300005564 Bacteria 1596
56 Ga0070664_100491952 3300005564 Bacteria 1130
57 Ga0068857_102469174 3300005577 Bacteria 510
58 Ga0068854_100472322 3300005578 Bacteria 1052
59 Ga0068854_100643362 3300005578 Bacteria 910
60 Ga0068854_100859270 3300005578 Bacteria 795
61 Ga0068854_101031734 3300005578 Bacteria 730
62 Ga0070702_100021044 3300005615 Bacteria 3426
63 Ga0070702_100034701 3300005615 Bacteria 2781
64 Ga0070702_100247431 3300005615 Bacteria 1206
65 Ga0068852_100680747 3300005616 Bacteria 1038
66 Ga0068852_100966859 3300005616 Bacteria 870
67 Ga0068859_101423982 3300005617 Bacteria 764
68 Ga0068859_102979314 3300005617 Bacteria 518
69 Ga0068864_100391072 3300005618 Bacteria 1320
70 Ga0068864_101179958 3300005618 Bacteria 764
71 Ga0068864_102643493 3300005618 Bacteria 508
72 Ga0068866_10006391 3300005718 Bacteria 4908
73 Ga0068861_100280999 3300005719 Bacteria 1433
74 Ga0068861_100326687 3300005719 Bacteria 1337
75 Ga0068861_100567546 3300005719 Bacteria 1037
76 Ga0068861_102636591 3300005719 Bacteria 507
77 Ga0068851_10210454 3300005834 Bacteria 1089
78 Ga0068870_10775427 3300005840 Bacteria 668
79 Ga0068870_11237235 3300005840 Bacteria 542
80 Ga0068863_102114637 3300005841 Bacteria 573
81 Ga0068858_100013304 3300005842 Bacteria 7759
82 Ga0068858_100522584 3300005842 Bacteria 1148
83 Ga0068858_101109366 3300005842 Bacteria 777
84 Ga0068860_100106859 3300005843 Bacteria 2674
85 Ga0068860_101513499 3300005843 Bacteria 693
86 Ga0068860_102445478 3300005843 Bacteria 542
87 Ga0068862_100059528 3300005844 Bacteria 3280
88 Ga0068862_102154703 3300005844 Bacteria 569
89 Ga0081455_10084197 3300005937 Bacteria 2596
90 Ga0081455_10337442 3300005937 Bacteria 1068
91 Ga0075365_10329962 3300006038 Bacteria 1075
92 Ga0075365_10688298 3300006038 Bacteria 722
93 Ga0075365_10755798 3300006038 Bacteria 686
94 Ga0075365_11044035 3300006038 Bacteria 576
95 Ga0075368_10099631 3300006042 Bacteria 1192
96 Ga0075368_10104781 3300006042 Bacteria 1163
97 Ga0075363_100133769 3300006048 Bacteria 1392
98 Ga0075363_100301784 3300006048 Bacteria 929
99 Ga0075363_100324509 3300006048 Bacteria 896
100 Ga0075364_10139703 3300006051 Bacteria 1629
101 Ga0075364_10142522 3300006051 Bacteria 1613
102 Ga0075364_10332959 3300006051 Bacteria 1034
103 Ga0075364_10583703 3300006051 Bacteria 764
104 Ga0075364_10639676 3300006051 Bacteria 726
105 Ga0075432_10492469 3300006058 Bacteria 545
106 Ga0070716_101689986 3300006173 Bacteria 522
107 Ga0075362_10197120 3300006177 Bacteria 979
108 Ga0075362_10513341 3300006177 Bacteria 614
109 Ga0075362_10682617 3300006177 Bacteria 535
110 Ga0075367_10335132 3300006178 Bacteria 954
111 Ga0075367_10579945 3300006178 Bacteria 713
112 Ga0075367_10601802 3300006178 Bacteria 698
113 Ga0075367_10673668 3300006178 Bacteria 658
114 Ga0075367_10731370 3300006178 Bacteria 630
115 Ga0075369_10020854 3300006186 Bacteria 2686
116 Ga0075369_10505835 3300006186 Bacteria 574
117 Ga0075366_10172435 3300006195 Bacteria 1313
118 Ga0075366_10284517 3300006195 Bacteria 1011
119 Ga0097621_100099137 3300006237 Bacteria 2449
120 Ga0097621_101006603 3300006237 Bacteria 780
121 Ga0075370_10074121 3300006353 Bacteria 1950
122 Ga0075370_10744471 3300006353 Bacteria 596
123 Ga0075370_10825800 3300006353 Bacteria 565
124 Ga0075431_100831050 3300006847 Bacteria 896
125 Ga0068865_100017896 3300006881 Bacteria 4564
126 Ga0068865_100335903 3300006881 Bacteria 1220
127 Ga0068865_100372334 3300006881 Bacteria 1163
128 Ga0097620_101423936 3300006931 Bacteria 764
129 Ga0097620_102979254 3300006931 Bacteria 518
130 Ga0105250_10128504 3300009092 Bacteria 1045
131 Ga0105240_11359949 3300009093 Bacteria 747
132 Ga0111539_10714664 3300009094 Bacteria 1166
133 Ga0111539_11184651 3300009094 Bacteria 887
134 Ga0111539_11956398 3300009094 Bacteria 680
135 Ga0111539_12223003 3300009094 Bacteria 636
136 Ga0105245_10254224 3300009098 Bacteria 1708
137 Ga0105245_10612018 3300009098 Bacteria 1117
138 Ga0105245_10980320 3300009098 Bacteria 889
139 Ga0105245_11477823 3300009098 Bacteria 730
140 Ga0105245_11875775 3300009098 Bacteria 652
141 Ga0105247_10415383 3300009101 Bacteria 962
142 Ga0105243_10006064 3300009148 Bacteria 9346
143 Ga0105243_10079575 3300009148 Bacteria 2672
144 Ga0105243_10613087 3300009148 Bacteria 1049
145 Ga0105243_11079927 3300009148 Bacteria 810
146 Ga0105242_10033023 3300009176 Bacteria 4142
147 Ga0105242_11175123 3300009176 Bacteria 785
148 Ga0105248_10250500 3300009177 Bacteria 1993
149 Ga0105248_10447415 3300009177 Bacteria 1456
150 Ga0105248_10909488 3300009177 Bacteria 994
151 Ga0105237_10678058 3300009545 Bacteria 1037
152 Ga0105238_11461293 3300009551 Bacteria 712
153 Ga0105238_12426426 3300009551 Bacteria 560
154 Ga0105238_12833869 3300009551 Bacteria 521
155 Ga0105249_10031383 3300009553 Bacteria 4805
156 Ga0105249_10135272 3300009553 Bacteria 2358
157 Ga0105249_11696717 3300009553 Bacteria 704
158 Ga0105249_13039454 3300009553 Bacteria 539
159 Ga0105239_12682526 3300010375 Bacteria 581
160 Ga0105246_10278311 3300011119 Bacteria 1341
161 Ga0105246_10471147 3300011119 Bacteria 1060
162 Ga0105246_10777948 3300011119 Bacteria 847
163 Ga0105246_10893555 3300011119 Bacteria 796
164 Ga0105246_11868869 3300011119 Bacteria 576
165 Ga0157374_11550209 3300013296 Bacteria 686
166 Ga0157374_11854751 3300013296 Bacteria 628
167 Ga0157374_12022356 3300013296 Bacteria 602
168 Ga0157374_12188076 3300013296 Bacteria 580
169 Ga0157374_12593600 3300013296 Bacteria 534
170 Ga0157378_10001660 3300013297 Bacteria 20115
171 Ga0157378_10275505 3300013297 Bacteria 1620
172 Ga0157378_10664393 3300013297 Bacteria 1059
173 Ga0157378_13061305 3300013297 Unclassified 519
174 Ga0163162_11882018 3300013306 Bacteria 685
175 Ga0163162_13414542 3300013306 Bacteria 507
176 Ga0157375_10008438 3300013308 Bacteria 9023
177 Ga0157375_10013305 3300013308 Bacteria 7318
178 Ga0157375_10925454 3300013308 Bacteria 1015
179 Ga0157375_12846604 3300013308 Bacteria 578
180 Ga0163163_10468780 3300014325 Bacteria 1320
181 Ga0163163_10535871 3300014325 Bacteria 1233
182 Ga0157380_10178459 3300014326 Bacteria 1864
183 Ga0157380_10673682 3300014326 Bacteria 1035
184 Ga0157380_11281986 3300014326 Bacteria 779
185 Ga0157380_12139574 3300014326 Bacteria 623
186 Ga0157380_12224140 3300014326 Bacteria 612
187 Ga0157379_10347296 3300014968 Bacteria 1358
188 Ga0157379_11549068 3300014968 Bacteria 646
189 Ga0157376_11017233 3300014969 Bacteria 852
190 Ga0157376_11737367 3300014969 Bacteria 659
191 Ga0163161_10016026 3300017792 Bacteria 5231
192 Ga0163161_11132616 3300017792 Bacteria 674
193 Ga0163161_11391315 3300017792 Bacteria 612
194 Ga0207666_1006000 3300025271 Bacteria 1565
195 Ga0207697_10008759 3300025315 Bacteria 4406
196 Ga0207656_10182304 3300025321 Bacteria 1008
197 Ga0207642_10005005 3300025899 Bacteria 4301
198 Ga0207710_10573673 3300025900 Bacteria 589
199 Ga0207688_10032475 3300025901 Bacteria 2885
200 Ga0207647_10609874 3300025904 Bacteria 601
201 Ga0207643_10163958 3300025908 Bacteria 1338
202 Ga0207643_10260791 3300025908 Bacteria 1070
203 Ga0207643_10643691 3300025908 Bacteria 684
204 Ga0207662_10007284 3300025918 Bacteria 6015
205 Ga0207662_10186254 3300025918 Bacteria 1338
206 Ga0207681_10155213 3300025923 Bacteria 1720
207 Ga0207681_10522600 3300025923 Bacteria 974
208 Ga0207650_10825221 3300025925 Bacteria 786
209 Ga0207650_11480596 3300025925 Bacteria 577
210 Ga0207650_11859530 3300025925 Bacteria 509
211 Ga0207659_10698275 3300025926 Bacteria 869
212 Ga0207659_11161317 3300025926 Bacteria 664
213 Ga0207687_10088696 3300025927 Bacteria 2251
214 Ga0207687_10511294 3300025927 Bacteria 1003
215 Ga0207687_11862560 3300025927 Bacteria 514
216 Ga0207644_10072994 3300025931 Bacteria 2515
217 Ga0207644_10654911 3300025931 Bacteria 874
218 Ga0207644_11728203 3300025931 Bacteria 524
219 Ga0207706_10289810 3300025933 Bacteria 1427
220 Ga0207706_10393952 3300025933 Bacteria 1201
221 Ga0207686_10011355 3300025934 Bacteria 4877
222 Ga0207686_11073492 3300025934 Bacteria 656
223 Ga0207686_11173944 3300025934 Bacteria 628
224 Ga0207709_10070302 3300025935 Bacteria 2219
225 Ga0207709_10233819 3300025935 Bacteria 1333
226 Ga0207670_10271484 3300025936 Bacteria 1318
227 Ga0207669_10031386 3300025937 Bacteria 2968
228 Ga0207669_10387134 3300025937 Bacteria 1091
229 Ga0207704_10023335 3300025938 Bacteria 3332
230 Ga0207704_10233263 3300025938 Bacteria 1370
231 Ga0207691_10007702 3300025940 Bacteria 10364
232 Ga0207691_10115737 3300025940 Bacteria 2380
233 Ga0207691_10418152 3300025940 Bacteria 1142
234 Ga0207711_10355069 3300025941 Bacteria 1358
235 Ga0207689_10215133 3300025942 Bacteria 1588
236 Ga0207689_11250704 3300025942 Bacteria 624
237 Ga0207661_11422227 3300025944 Bacteria 636
238 Ga0207679_10420960 3300025945 Bacteria 1179
239 Ga0207679_10584532 3300025945 Bacteria 1005
240 Ga0207679_10625426 3300025945 Bacteria 972
241 Ga0207651_10719202 3300025960 Bacteria 881
242 Ga0207712_10107447 3300025961 Bacteria 2086
243 Ga0207712_10151411 3300025961 Bacteria 1792
244 Ga0207712_10261127 3300025961 Bacteria 1405
245 Ga0207668_10124847 3300025972 Bacteria 1955
246 Ga0207668_10252272 3300025972 Bacteria 1434
247 Ga0207668_10718963 3300025972 Bacteria 879
248 Ga0207668_10734549 3300025972 Bacteria 870
249 Ga0207640_10318613 3300025981 Bacteria 1237
250 Ga0207640_10369792 3300025981 Bacteria 1158
251 Ga0207658_11280177 3300025986 Bacteria 670
252 Ga0207677_10785806 3300026023 Bacteria 851
253 Ga0207677_10920003 3300026023 Bacteria 789
254 Ga0207677_11144565 3300026023 Bacteria 711
255 Ga0207677_11801632 3300026023 Bacteria 568
256 Ga0207677_11970496 3300026023 Bacteria 543
257 Ga0207703_10930362 3300026035 Bacteria 833
258 Ga0207703_12004732 3300026035 Bacteria 555
259 Ga0207639_10413621 3300026041 Bacteria 1218
260 Ga0207639_11931737 3300026041 Bacteria 551
261 Ga0207678_10196682 3300026067 Bacteria 1723
262 Ga0207678_10631753 3300026067 Bacteria 940
263 Ga0207678_11251055 3300026067 Bacteria 657
264 Ga0207708_10181033 3300026075 Bacteria 1673
265 Ga0207708_10204665 3300026075 Bacteria 1576
266 Ga0207641_11793970 3300026088 Bacteria 615
267 Ga0207641_12591216 3300026088 Bacteria 505
268 Ga0207648_10002304 3300026089 Bacteria 20620
269 Ga0207676_10812356 3300026095 Bacteria 913
270 Ga0207676_11820670 3300026095 Bacteria 607
271 Ga0207676_12407353 3300026095 Bacteria 524
272 Ga0207674_12208684 3300026116 Bacteria 513
273 Ga0207675_100018499 3300026118 Bacteria 6498
274 Ga0207675_100065945 3300026118 Bacteria 3383
275 Ga0207675_101040601 3300026118 Bacteria 838
276 Ga0207675_101175132 3300026118 Bacteria 787
277 Ga0207675_102616243 3300026118 Bacteria 514
278 Ga0207683_10464447 3300026121 Bacteria 1167
279 Ga0207683_10476684 3300026121 Bacteria 1151
280 Ga0207683_10557196 3300026121 Bacteria 1060
281 Ga0207698_10155811 3300026142 Bacteria 1990
282 Ga0207698_12452231 3300026142 Bacteria 532
283 Ga0209984_1037445 3300027424 Bacteria 694
284 Ga0209813_10167780 3300027866 Bacteria 796
285 Ga0209974_10076501 3300027876 Bacteria 1147
286 Ga0209974_10441342 3300027876 Bacteria 515
287 Ga0209974_10471753 3300027876 Bacteria 500
288 Ga0268266_10817000 3300028379 Bacteria 901
289 Ga0268266_12058553 3300028379 Bacteria 544
290 Ga0268265_10743395 3300028380 Bacteria 951
291 Ga0268265_11581163 3300028380 Bacteria 660
292 Ga0268265_11749901 3300028380 Bacteria 628
293 Ga0268264_10270383 3300028381 Bacteria 1588
294 Ga0268264_10516781 3300028381 Bacteria 1167
295 Ga0268264_11161839 3300028381 Bacteria 781
296 Ga0316575_10151984 3300031665 Bacteria 955
297 Ga0316575_10245943 3300031665 Bacteria 750
298 Ga0316579_10081320 3300031691 Bacteria 1543
299 Ga0316579_10109707 3300031691 Bacteria 1324
300 Ga0316579_10173620 3300031691 Bacteria 1042
301 Ga0316576_10003787 3300031727 Bacteria 8941
302 Ga0316576_10013810 3300031727 Bacteria 5382
303 Ga0316576_10085360 3300031727 Bacteria 2346
304 Ga0316576_10202609 3300031727 Bacteria 1495
305 Ga0316576_10203945 3300031727 Bacteria 1489
306 Ga0316576_10223176 3300031727 Bacteria 1417
307 Ga0316576_10727055 3300031727 Bacteria 718
308 Ga0316578_10000790 3300031728 Bacteria 11689
309 Ga0316578_10004574 3300031728 Bacteria 6556
310 Ga0316578_10007920 3300031728 Bacteria 5368
311 Ga0316578_10787276 3300031728 Bacteria 551
312 Ga0316577_10037598 3300031733 Bacteria 2706
313 Ga0316577_10283835 3300031733 Bacteria 937
314 Ga0307409_101839447 3300031995 Bacteria 635
315 Ga0316583_10173597 3300032133 Bacteria 750
316 Ga0316580_10017153 3300032139 Bacteria 2225
317 Ga0316580_10088803 3300032139 Bacteria 946
318 Ga0316593_10013895 3300032168 Bacteria 2390
319 Ga0316593_10047328 3300032168 Bacteria 1445
320 Ga0316593_10067270 3300032168 Bacteria 1234
321 Ga0316593_10246586 3300032168 Bacteria 668
322 Ga0316592_1003976 3300033524 Bacteria 2715
323 Ga0316588_1061740 3300033528 Bacteria 915
324 Ga0316596_1004885 3300033541 Bacteria 3030
325 Ga0316596_1009381 3300033541 Bacteria 2347
326 Ga0316596_1027677 3300033541 Bacteria 1464
327 Ga0316596_1080616 3300033541 Bacteria 875
328 Ga0316596_1099111 3300033541 Bacteria 788
329 Ga0316596_1190311 3300033541 Bacteria 569
330 Ga0316574_0013411 3300035398 Bacteria 4711
331 Ga0316574_0054072 3300035398 Bacteria 2507
332 Ga0316574_0059302 3300035398 Bacteria 2399
333 Ga0316574_0102448 3300035398 Bacteria 1832
334 Ga0316574_0142716 3300035398 Bacteria 1543
335 Ga0316574_0172679 3300035398 Bacteria 1391
336 Ga0316574_0225499 3300035398 Bacteria 1200
337 Ga0316574_0380039 3300035398 Bacteria 891
338 Ga0316574_0437615 3300035398 Bacteria 820
339 Ga0316574_0545454 3300035398 Bacteria 720
340 Ga0316582_0028577 3300036647 Bacteria 3380
341 Ga0316582_0033668 3300036647 Bacteria 3149
342 Ga0316582_0253147 3300036647 Bacteria 1207
343 Ga0316584_0011115 3300036712 Bacteria 6314
344 Ga0316584_0133239 3300036712 Bacteria 1855
345 Ga0316584_0679625 3300036712 Bacteria 707
346 Ga0316584_1095062 3300036712 Bacteria 529
347 Ga0439453_0033181 3300041408 Bacteria 986
348 Ga0439465_0137967 3300041413 Bacteria 865
349 Ga0439465_0163059 3300041413 Bacteria 800
350 Ga0451789_1167412 3300041443 Bacteria 655
351 Ga0451791_0621744 3300041451 Bacteria 750
352 Ga0451791_1862888 3300041451 Bacteria 655
353 Ga0451797_0897567 3300041453 Bacteria 710
354 Ga0451797_1347861 3300041453 Bacteria 767
355 Ga0451795_0658193 3300041456 Bacteria 664
356 Ga0451798_0437780 3300041458 Bacteria 980
357 Ga0451798_0752664 3300041458 Bacteria 819
358 Ga0451800_0199335 3300041459 Bacteria 527
359 Ga0451802_0513489 3300041460 Bacteria 712
360 Ga0451802_1758674 3300041460 Bacteria 761
361 Ga0451802_1848169 3300041460 Bacteria 601
362 Ga0451807_1771037 3300041486 Bacteria 703
363 Ga0451807_1861075 3300041486 Bacteria 1541
364 Ga0451833_1382332 3300041491 Bacteria 630
365 Ga0451835_1129083 3300041492 Bacteria 986
366 Ga0451837_0628354 3300041494 Bacteria 1006
367 Ga0451839_1064396 3300041496 Bacteria 616
368 Ga0451841_1123218 3300041498 Bacteria 754
369 Ga0451847_0501849 3300041503 Bacteria 857
370 Ga0451847_0892850 3300041503 Bacteria 606
371 Ga0451855_1091895 3300041511 Bacteria 529
372 Ga0451853_0753440 3300041512 Bacteria 3015
373 Ga0451853_1202791 3300041512 Bacteria 594
374 Ga0451853_3101716 3300041512 Bacteria 864
375 Ga0451853_3452401 3300041512 Bacteria 520
376 Ga0439431_0021026 3300041997 Bacteria 1564
377 Ga0439432_254694 3300042006 Bacteria 503
378 Ga0439451_066756 3300042009 Bacteria 720
379 Ga0450923_066887 3300042125 Bacteria 792
380 Ga0439435_0017047 3300042436 Bacteria 1831
381 Ga0439464_0026382 3300042439 Bacteria 1612
382 Ga0439460_0375402 3300042461 Bacteria 503
383 Ga0451577_0007199 3300042876 Bacteria 10963
384 Ga0453684_0017333 3300044712 Bacteria 11163
385 Ga0495603_0712684 3300046455 Bacteria 574
386 Ga0495629_0319732 3300046459 Bacteria 1061
387 Ga0495641_0009979 3300046461 Bacteria 5576
388 Ga0495640_0926951 3300046533 Bacteria 515
389 Ga0495658_0432806 3300046683 Bacteria 840
390 Ga0495613_0246149 3300046689 Bacteria 1249
391 Ga0495624_0203993 3300046690 Bacteria 1201
392 Ga0495670_0043650 3300046691 Bacteria 2238
393 Ga0495676_0151750 3300047321 Bacteria 1648
394 Ga0495676_0239413 3300047321 Bacteria 1243
395 Ga0495676_0843969 3300047321 Bacteria 588
396 Ga0496100_0791873 3300048903 Bacteria 742
397 Ga0496100_1142687 3300048903 Bacteria 614
398 Ga0496101_0137882 3300048904 Bacteria 1857
399 Ga0496101_0513626 3300048904 Bacteria 947
400 Ga0496102_0123784 3300048905 Bacteria 2416
401 Ga0496102_0933000 3300048905 Bacteria 789
402 Ga0496103_0283504 3300048906 Bacteria 1065
403 Ga0496104_0003461 3300048907 Bacteria 13603
404 Ga0496104_0730065 3300048907 Bacteria 898
405 Ga0496104_0741449 3300048907 Bacteria 889
406 Ga0496105_0032478 3300048908 Bacteria 4283
407 Ga0496106_0005388 3300048909 Bacteria 9463
408 Ga0496107_0029229 3300048910 Bacteria 3920
409 Ga0496108_0190206 3300048911 Bacteria 1779
410 Ga0496108_0370500 3300048911 Bacteria 1250
411 Ga0496109_0109404 3300048912 Bacteria 2569
412 Ga0496109_0113003 3300048912 Bacteria 2526
413 Ga0496109_0131380 3300048912 Bacteria 2337
414 Ga0496110_0005006 3300048913 Bacteria 10353
415 Ga0496110_0010815 3300048913 Bacteria 7441
416 Ga0496110_0058384 3300048913 Bacteria 3399
417 Ga0496111_0014227 3300048914 Bacteria 5430
418 Ga0496111_0484757 3300048914 Bacteria 911
419 Ga0496111_1322305 3300048914 Bacteria 507
420 Ga0496112_0874316 3300048915 Bacteria 822
421 Ga0496113_0093415 3300048916 Bacteria 2322
422 Ga0496113_1174846 3300048916 Bacteria 600
423 Ga0496114_0029016 3300048917 Bacteria 4544
424 Ga0496114_0131309 3300048917 Bacteria 2163
425 Ga0496114_0336429 3300048917 Bacteria 1335
426 Ga0496114_0588627 3300048917 Bacteria 981
427 Ga0501307_027076 3300049162 Bacteria 778
428 Ga0501311_054066 3300049527 Bacteria 635
429 Ga0501311_077988 3300049527 Bacteria 559
430 Ga0501312_004778 3300049528 Bacteria 1614
431 Ga0501317_007899 3300049533 Bacteria 1213
432 Ga0501318_042144 3300049534 Bacteria 656
433 Ga0501321_021597 3300049537 Bacteria 804
434 Ga0501323_014066 3300049539 Bacteria 997
435 Ga0501325_019324 3300049541 Bacteria 705
436 Ga0501031_0070587 3300049568 Bacteria 2275
437 Ga0501031_0263171 3300049568 Bacteria 1120
438 Ga0501031_0378301 3300049568 Bacteria 916
439 Ga0501032_0091680 3300049569 Bacteria 2016
440 Ga0501032_0242912 3300049569 Bacteria 1170
441 Ga0501033_0506628 3300049570 Bacteria 835
442 Ga0501034_1174541 3300049571 Bacteria 647
443 Ga0501036_0102561 3300049572 Bacteria 2420
444 Ga0501036_0455000 3300049572 Bacteria 1066
445 Ga0501036_1206896 3300049572 Bacteria 616
446 Ga0501037_0234175 3300049573 Bacteria 1289
447 Ga0501038_0680289 3300049574 Bacteria 772
448 Ga0501039_0723882 3300049575 Bacteria 778
449 Ga0501039_0760553 3300049575 Bacteria 756
450 Ga0501039_1101320 3300049575 Bacteria 616
451 Ga0501040_0073216 3300049576 Bacteria 2367
452 Ga0501040_0089729 3300049576 Bacteria 2136
453 Ga0501040_0137549 3300049576 Bacteria 1720
454 Ga0501041_0055417 3300049577 Bacteria 2420
455 Ga0501041_0233808 3300049577 Bacteria 1154
456 Ga0501041_0552539 3300049577 Bacteria 734
457 Ga0501042_0069220 3300049578 Bacteria 2524
458 Ga0501042_0185887 3300049578 Bacteria 1499
459 Ga0501042_0258991 3300049578 Bacteria 1256
460 Ga0501042_0400366 3300049578 Bacteria 994
461 Ga0501042_0846366 3300049578 Bacteria 666
462 Ga0501042_0886515 3300049578 Bacteria 650
463 Ga0501046_0122306 3300049580 Bacteria 1980
464 Ga0501046_0453724 3300049580 Bacteria 922
465 Ga0501048_0010328 3300049582 Bacteria 6980
466 Ga0501048_0466420 3300049582 Bacteria 905
467 Ga0501048_1078374 3300049582 Bacteria 578
468 Ga0501069_0445646 3300049585 Bacteria 769
469 Ga0501071_0102614 3300049587 Bacteria 2109
470 Ga0501071_0426433 3300049587 Bacteria 1014
471 Ga0501071_0955059 3300049587 Bacteria 662
472 Ga0501071_1136560 3300049587 Bacteria 603
473 Ga0501071_1312041 3300049587 Bacteria 559
474 Ga0501071_1440705 3300049587 Bacteria 532
475 Ga0501072_0408451 3300049588 Bacteria 1077
476 Ga0501072_0678573 3300049588 Bacteria 810
477 Ga0501072_1071415 3300049588 Bacteria 627
478 Ga0501072_1113635 3300049588 Bacteria 614
479 Ga0501072_1576536 3300049588 Bacteria 506
480 Ga0501073_0092961 3300049589 Bacteria 2096
481 Ga0501073_0387359 3300049589 Bacteria 966
482 Ga0501073_0522106 3300049589 Bacteria 821
483 Ga0501073_1269446 3300049589 Bacteria 505
484 Ga0501074_0435300 3300049590 Bacteria 930
485 Ga0501075_0083726 3300049591 Bacteria 2416
486 Ga0501075_0176302 3300049591 Bacteria 1631
487 Ga0501075_0268310 3300049591 Bacteria 1301
488 Ga0501075_0649452 3300049591 Bacteria 804
489 Ga0501075_1363052 3300049591 Bacteria 537
490 Ga0501076_0218748 3300049592 Bacteria 1557
491 Ga0501076_0235661 3300049592 Bacteria 1496
492 Ga0501076_0245709 3300049592 Bacteria 1464
493 Ga0501079_0199477 3300049741 Bacteria 1563
494 Ga0501079_0369573 3300049741 Bacteria 1124
495 Ga0501079_1070181 3300049741 Bacteria 635
496 Ga0501080_0813881 3300049742 Bacteria 819
497 Ga0501081_0297923 3300049743 Bacteria 1183
498 Ga0501081_0390319 3300049743 Bacteria 1030
499 Ga0501081_0519570 3300049743 Bacteria 888
500 Ga0501035_0369910 3300049822 Bacteria 1197
501 Ga0501035_0477714 3300049822 Bacteria 1028
502 Ga0501044_1102224 3300049823 Bacteria 663
503 Ga0501045_0019633 3300049824 Bacteria 4822
504 Ga0501045_0099858 3300049824 Bacteria 2148
505 Ga0501045_0262723 3300049824 Bacteria 1285
506 Ga0501045_0932337 3300049824 Bacteria 638
507 nmdc:mga03683_357218_c1 3300050489 Bacteria 692
508 nmdc:mga03683_668642_c1 3300050489 Bacteria 512
509 nmdc:mga03n38_136828_c1 3300050490 Bacteria 1220
510 nmdc:mga03n38_156867_c1 3300050490 Bacteria 1150
511 nmdc:mga03n38_321359_c1 3300050490 Bacteria 836
512 nmdc:mga00v17_192554_c1 3300050491 Bacteria 1317
513 nmdc:mga00v17_373980_c1 3300050491 Bacteria 926
514 nmdc:mga00v17_440041_c1 3300050491 Bacteria 847
515 nmdc:mga00v17_527263_c1 3300050491 Bacteria 765
516 nmdc:mga00v17_664291_c1 3300050491 Bacteria 670
517 nmdc:mga00v17_845201_c1 3300050491 Bacteria 581
518 nmdc:mga00v17_964163_c1 3300050491 Bacteria 538
519 nmdc:mga0yw44_1141883_c1 3300050492 Bacteria 526
520 nmdc:mga0yw44_253688_c1 3300050492 Bacteria 1171
521 nmdc:mga0yw44_273497_c1 3300050492 Bacteria 1128
522 nmdc:mga0yw44_63706_c1 3300050492 Bacteria 2268
523 nmdc:mga0yw44_784597_c1 3300050492 Bacteria 647
524 nmdc:mga0k408_119778_c1 3300050493 Bacteria 1558
525 nmdc:mga0k408_337853_c1 3300050493 Bacteria 898
526 nmdc:mga0k408_570046_c1 3300050493 Bacteria 668
527 nmdc:mga06z11_152093_c1 3300050494 Bacteria 1316
528 nmdc:mga06z11_304814_c1 3300050494 Bacteria 948
529 nmdc:mga06z11_883897_c1 3300050494 Bacteria 544
530 nmdc:mga07m45_446462_c1 3300050496 Bacteria 750
531 nmdc:mga06r32_57663_c1 3300050510 Bacteria 1756
532 nmdc:mga08y16_1504819_c1 3300050511 Bacteria 633
533 nmdc:mga0sz30_19142_c1 3300050516 Bacteria 2748
534 nmdc:mga0sz30_500573_c1 3300050516 Bacteria 547
535 Ga0500628_129784 3300053129 Bacteria 691
536 Ga0500628_141110 3300053129 Bacteria 668
537 Ga0501084_0045466 3300054114 Bacteria 3676
538 Ga0501084_0220507 3300054114 Bacteria 1600
539 Ga0501084_0273949 3300054114 Bacteria 1425
540 Ga0501082_0427530 3300060353 Bacteria 1157
541 Ga0501082_0650919 3300060353 Bacteria 922
542 Ga0501082_0958214 3300060353 Bacteria 748
543 Ga0501082_1332779 3300060353 Bacteria 627
544 Ga0530510_0077866 3300061734 Bacteria 2409
545 Ga0530510_0523633 3300061734 Bacteria 899
546 Ga0530510_1023296 3300061734 Bacteria 632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0369910 Ga0501035_0369910_708_917 67
2 3300005347 Ga0070668_101192012 Ga0070668_1011920122 68
3 3300005356 Ga0070674_101315716 Ga0070674_1013157161 68
4 3300005456 Ga0070678_100604159 Ga0070678_1006041593 68
5 3300005456 Ga0070678_101280559 Ga0070678_1012805592 68
6 3300005578 Ga0068854_100643362 Ga0068854_1006433622 68
7 3300005578 Ga0068854_101031734 Ga0068854_1010317342 68
8 3300005719 Ga0068861_102636591 Ga0068861_1026365911 68
9 3300005840 Ga0068870_11237235 Ga0068870_112372351 68
10 3300005844 Ga0068862_102154703 Ga0068862_1021547031 68
11 3300005937 Ga0081455_10084197 Ga0081455_100841976 68
12 3300005937 Ga0081455_10337442 Ga0081455_103374424 68
13 3300006058 Ga0075432_10492469 Ga0075432_104924691 68
14 3300006847 Ga0075431_100831050 Ga0075431_1008310501 68
15 3300009094 Ga0111539_10714664 Ga0111539_107146643 68
16 3300009094 Ga0111539_11956398 Ga0111539_119563982 68
17 3300009098 Ga0105245_10612018 Ga0105245_106120182 68
18 3300009148 Ga0105243_11079927 Ga0105243_110799272 68
19 3300009545 Ga0105237_10678058 Ga0105237_106780582 68
20 3300009551 Ga0105238_12833869 Ga0105238_128338692 68
21 3300013296 Ga0157374_12022356 Ga0157374_120223562 68
22 3300013306 Ga0163162_11882018 Ga0163162_118820182 68
23 3300013306 Ga0163162_13414542 Ga0163162_134145422 68
24 3300013308 Ga0157375_10925454 Ga0157375_109254543 68
25 3300017792 Ga0163161_11391315 Ga0163161_113913151 68
26 3300025908 Ga0207643_10643691 Ga0207643_106436913 68
27 3300025925 Ga0207650_11859530 Ga0207650_118595302 68
28 3300025926 Ga0207659_11161317 Ga0207659_111613172 68
29 3300025927 Ga0207687_10511294 Ga0207687_105112943 68
30 3300025972 Ga0207668_10252272 Ga0207668_102522722 68
31 3300026023 Ga0207677_11144565 Ga0207677_111445651 68
32 3300026067 Ga0207678_11251055 Ga0207678_112510552 68
33 3300026118 Ga0207675_101040601 Ga0207675_1010406012 68
34 3300026121 Ga0207683_10476684 Ga0207683_104766842 68
35 3300028379 Ga0268266_10817000 Ga0268266_108170002 68
36 3300028380 Ga0268265_11749901 Ga0268265_117499012 68
37 3300041453 Ga0451797_0897567 Ga0451797_0897567_409_618 68
38 3300041459 Ga0451800_0199335 Ga0451800_0199335_81_290 68
39 3300041460 Ga0451802_0513489 Ga0451802_0513489_430_645 68
40 3300041512 Ga0451853_3452401 Ga0451853_3452401_80_295 68
41 3300048914 Ga0496111_0484757 Ga0496111_0484757_253_468 68
42 3300048917 Ga0496114_0336429 Ga0496114_0336429_496_708 68
43 3300049162 Ga0501307_027076 Ga0501307_027076_20_229 68
44 3300049527 Ga0501311_054066 Ga0501311_054066_138_347 68
45 3300049527 Ga0501311_077988 Ga0501311_077988_62_271 68
46 3300049528 Ga0501312_004778 Ga0501312_004778_1339_1548 68
47 3300049533 Ga0501317_007899 Ga0501317_007899_263_472 68
48 3300049534 Ga0501318_042144 Ga0501318_042144_94_303 68
49 3300049537 Ga0501321_021597 Ga0501321_021597_484_693 68
50 3300049539 Ga0501323_014066 Ga0501323_014066_717_926 68
51 3300049541 Ga0501325_019324 Ga0501325_019324_366_575 68
52 3300049568 Ga0501031_0070587 Ga0501031_0070587_1937_2143 68
53 3300049568 Ga0501031_0263171 Ga0501031_0263171_135_347 68
54 3300049568 Ga0501031_0378301 Ga0501031_0378301_286_495 68
55 3300049569 Ga0501032_0091680 Ga0501032_0091680_982_1191 68
56 3300049569 Ga0501032_0242912 Ga0501032_0242912_913_1119 68
57 3300049570 Ga0501033_0506628 Ga0501033_0506628_275_481 68
58 3300049571 Ga0501034_1174541 Ga0501034_1174541_327_533 68
59 3300049572 Ga0501036_0102561 Ga0501036_0102561_1655_1867 68
60 3300049572 Ga0501036_1206896 Ga0501036_1206896_20_229 68
61 3300049573 Ga0501037_0234175 Ga0501037_0234175_648_860 68
62 3300049574 Ga0501038_0680289 Ga0501038_0680289_432_638 68
63 3300049575 Ga0501039_0760553 Ga0501039_0760553_195_404 68
64 3300049575 Ga0501039_1101320 Ga0501039_1101320_205_411 68
65 3300049576 Ga0501040_0073216 Ga0501040_0073216_1237_1449 68
66 3300049576 Ga0501040_0089729 Ga0501040_0089729_1351_1557 68
67 3300049576 Ga0501040_0137549 Ga0501040_0137549_1013_1222 68
68 3300049577 Ga0501041_0055417 Ga0501041_0055417_350_559 68
69 3300049577 Ga0501041_0233808 Ga0501041_0233808_226_432 68
70 3300049577 Ga0501041_0552539 Ga0501041_0552539_44_253 68
71 3300049578 Ga0501042_0069220 Ga0501042_0069220_1214_1426 68
72 3300049578 Ga0501042_0185887 Ga0501042_0185887_989_1195 68
73 3300049578 Ga0501042_0258991 Ga0501042_0258991_332_541 68
74 3300049578 Ga0501042_0846366 Ga0501042_0846366_419_628 68
75 3300049578 Ga0501042_0886515 Ga0501042_0886515_279_488 68
76 3300049580 Ga0501046_0122306 Ga0501046_0122306_738_950 68
77 3300049580 Ga0501046_0453724 Ga0501046_0453724_57_263 68
78 3300049582 Ga0501048_0010328 Ga0501048_0010328_375_581 68
79 3300049582 Ga0501048_0466420 Ga0501048_0466420_358_567 68
80 3300049585 Ga0501069_0445646 Ga0501069_0445646_121_333 68
81 3300049587 Ga0501071_0102614 Ga0501071_0102614_1693_1905 68
82 3300049587 Ga0501071_0955059 Ga0501071_0955059_277_486 68
83 3300049587 Ga0501071_1136560 Ga0501071_1136560_366_575 68
84 3300049587 Ga0501071_1312041 Ga0501071_1312041_150_359 68
85 3300049587 Ga0501071_1440705 Ga0501071_1440705_21_230 68
86 3300049588 Ga0501072_0408451 Ga0501072_0408451_54_260 68
87 3300049588 Ga0501072_0678573 Ga0501072_0678573_275_484 68
88 3300049588 Ga0501072_1071415 Ga0501072_1071415_353_565 68
89 3300049589 Ga0501073_0522106 Ga0501073_0522106_83_289 68
90 3300049589 Ga0501073_1269446 Ga0501073_1269446_206_418 68
91 3300049590 Ga0501074_0435300 Ga0501074_0435300_188_400 68
92 3300049591 Ga0501075_0083726 Ga0501075_0083726_1440_1649 68
93 3300049591 Ga0501075_0176302 Ga0501075_0176302_571_783 68
94 3300049591 Ga0501075_0268310 Ga0501075_0268310_345_551 68
95 3300049592 Ga0501076_0218748 Ga0501076_0218748_114_320 68
96 3300049592 Ga0501076_0235661 Ga0501076_0235661_461_670 68
97 3300049741 Ga0501079_0199477 Ga0501079_0199477_366_575 68
98 3300049741 Ga0501079_0369573 Ga0501079_0369573_478_690 68
99 3300049741 Ga0501079_1070181 Ga0501079_1070181_368_574 68
100 3300049743 Ga0501081_0297923 Ga0501081_0297923_598_804 68
101 3300049743 Ga0501081_0390319 Ga0501081_0390319_515_727 68
102 3300049743 Ga0501081_0519570 Ga0501081_0519570_72_281 68
103 3300049822 Ga0501035_0477714 Ga0501035_0477714_456_665 68
104 3300049823 Ga0501044_1102224 Ga0501044_1102224_379_588 68
105 3300049824 Ga0501045_0019633 Ga0501045_0019633_3584_3796 68
106 3300049824 Ga0501045_0099858 Ga0501045_0099858_1914_2123 68
107 3300049824 Ga0501045_0262723 Ga0501045_0262723_857_1063 68
108 3300050510 nmdc:mga06r32_57663_c1 nmdc:mga06r32_57663_c1_85_294 68
109 3300054114 Ga0501084_0045466 Ga0501084_0045466_3395_3607 68
110 3300054114 Ga0501084_0220507 Ga0501084_0220507_432_641 68
111 3300054114 Ga0501084_0273949 Ga0501084_0273949_110_316 68
112 3300060353 Ga0501082_0650919 Ga0501082_0650919_552_764 68
113 3300060353 Ga0501082_0958214 Ga0501082_0958214_223_429 68
114 3300061734 Ga0530510_0077866 Ga0530510_0077866_1973_2182 68
115 3300061734 Ga0530510_0523633 Ga0530510_0523633_310_516 68
116 3300061734 Ga0530510_1023296 Ga0530510_1023296_52_261 68
117 3300005338 Ga0068868_102081159 Ga0068868_1020811592 69
118 3300005355 Ga0070671_101788884 Ga0070671_1017888841 69
119 3300006881 Ga0068865_100372334 Ga0068865_1003723344 69
120 3300014969 Ga0157376_11737367 Ga0157376_117373672 69
121 3300025931 Ga0207644_11728203 Ga0207644_117282032 69
122 3300047321 Ga0495676_0843969 Ga0495676_0843969_257_475 69
123 3300048915 Ga0496112_0874316 Ga0496112_0874316_345_566 69
124 3300014326 Ga0157380_12224140 Ga0157380_122241402 70
125 3300027876 Ga0209974_10076501 Ga0209974_100765014 70
126 3300031665 Ga0316575_10245943 Ga0316575_102459433 70
127 3300031691 Ga0316579_10081320 Ga0316579_100813203 70
128 3300031691 Ga0316579_10109707 Ga0316579_101097072 70
129 3300031691 Ga0316579_10173620 Ga0316579_101736203 70
130 3300031727 Ga0316576_10003787 Ga0316576_100037877 70
131 3300031727 Ga0316576_10013810 Ga0316576_100138103 70
132 3300031727 Ga0316576_10085360 Ga0316576_100853605 70
133 3300031727 Ga0316576_10202609 Ga0316576_102026093 70
134 3300031727 Ga0316576_10203945 Ga0316576_102039453 70
135 3300031727 Ga0316576_10223176 Ga0316576_102231763 70
136 3300031728 Ga0316578_10000790 Ga0316578_100007908 70
137 3300031728 Ga0316578_10004574 Ga0316578_100045743 70
138 3300031728 Ga0316578_10007920 Ga0316578_1000792011 70
139 3300031733 Ga0316577_10037598 Ga0316577_100375986 70
140 3300031733 Ga0316577_10283835 Ga0316577_102838352 70
141 3300032133 Ga0316583_10173597 Ga0316583_101735971 70
142 3300032139 Ga0316580_10017153 Ga0316580_100171534 70
143 3300032139 Ga0316580_10088803 Ga0316580_100888032 70
144 3300032168 Ga0316593_10013895 Ga0316593_100138954 70
145 3300032168 Ga0316593_10047328 Ga0316593_100473283 70
146 3300032168 Ga0316593_10067270 Ga0316593_100672703 70
147 3300032168 Ga0316593_10246586 Ga0316593_102465862 70
148 3300033524 Ga0316592_1003976 Ga0316592_10039762 70
149 3300033528 Ga0316588_1061740 Ga0316588_10617402 70
150 3300033541 Ga0316596_1004885 Ga0316596_10048855 70
151 3300033541 Ga0316596_1009381 Ga0316596_10093813 70
152 3300033541 Ga0316596_1027677 Ga0316596_10276773 70
153 3300033541 Ga0316596_1080616 Ga0316596_10806162 70
154 3300033541 Ga0316596_1099111 Ga0316596_10991112 70
155 3300033541 Ga0316596_1190311 Ga0316596_11903112 70
156 3300035398 Ga0316574_0013411 Ga0316574_0013411_1726_1938 70
157 3300035398 Ga0316574_0054072 Ga0316574_0054072_542_754 70
158 3300035398 Ga0316574_0059302 Ga0316574_0059302_996_1208 70
159 3300035398 Ga0316574_0102448 Ga0316574_0102448_1329_1541 70
160 3300035398 Ga0316574_0225499 Ga0316574_0225499_191_403 70
161 3300035398 Ga0316574_0380039 Ga0316574_0380039_536_748 70
162 3300035398 Ga0316574_0437615 Ga0316574_0437615_514_726 70
163 3300035398 Ga0316574_0545454 Ga0316574_0545454_484_696 70
164 3300036647 Ga0316582_0028577 Ga0316582_0028577_2377_2589 70
165 3300036647 Ga0316582_0033668 Ga0316582_0033668_176_388 70
166 3300036647 Ga0316582_0253147 Ga0316582_0253147_13_225 70
167 3300036712 Ga0316584_0011115 Ga0316584_0011115_703_915 70
168 3300036712 Ga0316584_0133239 Ga0316584_0133239_193_405 70
169 3300036712 Ga0316584_1095062 Ga0316584_1095062_103_315 70
170 3300041413 Ga0439465_0137967 Ga0439465_0137967_321_545 70
171 3300049572 Ga0501036_0455000 Ga0501036_0455000_730_945 70
172 3300049575 Ga0501039_0723882 Ga0501039_0723882_192_407 70
173 3300049578 Ga0501042_0400366 Ga0501042_0400366_604_819 70
174 3300049582 Ga0501048_1078374 Ga0501048_1078374_207_425 70
175 3300049587 Ga0501071_0426433 Ga0501071_0426433_208_426 70
176 3300049588 Ga0501072_1113635 Ga0501072_1113635_183_398 70
177 3300049591 Ga0501075_0649452 Ga0501075_0649452_375_590 70
178 3300049742 Ga0501080_0813881 Ga0501080_0813881_132_350 70
179 3300049824 Ga0501045_0932337 Ga0501045_0932337_51_266 70
180 3300060353 Ga0501082_0427530 Ga0501082_0427530_41_256 70
181 3300002244 JGI24742J22300_10076985 JGI24742J22300_100769852 71
182 3300005329 Ga0070683_101648691 Ga0070683_1016486912 71
183 3300005330 Ga0070690_100072143 Ga0070690_1000721433 71
184 3300005331 Ga0070670_100215041 Ga0070670_1002150413 71
185 3300005331 Ga0070670_102245682 Ga0070670_1022456821 71
186 3300005334 Ga0068869_100975589 Ga0068869_1009755892 71
187 3300005337 Ga0070682_101851603 Ga0070682_1018516031 71
188 3300005338 Ga0068868_100824278 Ga0068868_1008242781 71
189 3300005338 Ga0068868_100912788 Ga0068868_1009127882 71
190 3300005338 Ga0068868_101196293 Ga0068868_1011962932 71
191 3300005340 Ga0070689_100163123 Ga0070689_1001631233 71
192 3300005340 Ga0070689_102113740 Ga0070689_1021137401 71
193 3300005343 Ga0070687_100784365 Ga0070687_1007843652 71
194 3300005344 Ga0070661_101764086 Ga0070661_1017640862 71
195 3300005347 Ga0070668_100821913 Ga0070668_1008219131 71
196 3300005353 Ga0070669_100527220 Ga0070669_1005272203 71
197 3300005353 Ga0070669_101522195 Ga0070669_1015221952 71
198 3300005354 Ga0070675_102252589 Ga0070675_1022525891 71
199 3300005355 Ga0070671_100363938 Ga0070671_1003639383 71
200 3300005355 Ga0070671_100528911 Ga0070671_1005289111 71
201 3300005355 Ga0070671_100669749 Ga0070671_1006697491 71
202 3300005355 Ga0070671_100711082 Ga0070671_1007110823 71
203 3300005356 Ga0070674_100026846 Ga0070674_1000268463 71
204 3300005356 Ga0070674_100108075 Ga0070674_1001080753 71
205 3300005364 Ga0070673_100587382 Ga0070673_1005873822 71
206 3300005364 Ga0070673_101039472 Ga0070673_1010394721 71
207 3300005364 Ga0070673_102225643 Ga0070673_1022256432 71
208 3300005365 Ga0070688_100097515 Ga0070688_1000975153 71
209 3300005365 Ga0070688_100100365 Ga0070688_1001003652 71
210 3300005366 Ga0070659_102030106 Ga0070659_1020301061 71
211 3300005367 Ga0070667_100547001 Ga0070667_1005470013 71
212 3300005438 Ga0070701_10199589 Ga0070701_101995893 71
213 3300005438 Ga0070701_10208264 Ga0070701_102082643 71
214 3300005441 Ga0070700_100970286 Ga0070700_1009702862 71
215 3300005455 Ga0070663_100468949 Ga0070663_1004689492 71
216 3300005455 Ga0070663_100942736 Ga0070663_1009427362 71
217 3300005456 Ga0070678_100403684 Ga0070678_1004036843 71
218 3300005456 Ga0070678_100858072 Ga0070678_1008580722 71
219 3300005457 Ga0070662_100636821 Ga0070662_1006368213 71
220 3300005459 Ga0068867_100000479 Ga0068867_10000047921 71
221 3300005459 Ga0068867_100764276 Ga0068867_1007642761 71
222 3300005459 Ga0068867_101063568 Ga0068867_1010635682 71
223 3300005466 Ga0070685_10545693 Ga0070685_105456931 71
224 3300005535 Ga0070684_102372869 Ga0070684_1023728691 71
225 3300005543 Ga0070672_100026863 Ga0070672_1000268636 71
226 3300005543 Ga0070672_100649084 Ga0070672_1006490842 71
227 3300005544 Ga0070686_100078780 Ga0070686_1000787802 71
228 3300005548 Ga0070665_101035735 Ga0070665_1010357353 71
229 3300005564 Ga0070664_100249304 Ga0070664_1002493042 71
230 3300005564 Ga0070664_100491952 Ga0070664_1004919523 71
231 3300005577 Ga0068857_102469174 Ga0068857_1024691742 71
232 3300005578 Ga0068854_100472322 Ga0068854_1004723223 71
233 3300005578 Ga0068854_100859270 Ga0068854_1008592702 71
234 3300005615 Ga0070702_100021044 Ga0070702_1000210444 71
235 3300005615 Ga0070702_100034701 Ga0070702_1000347018 71
236 3300005615 Ga0070702_100247431 Ga0070702_1002474312 71
237 3300005616 Ga0068852_100680747 Ga0068852_1006807473 71
238 3300005616 Ga0068852_100966859 Ga0068852_1009668592 71
239 3300005617 Ga0068859_101423982 Ga0068859_1014239822 71
240 3300005617 Ga0068859_102979314 Ga0068859_1029793142 71
241 3300005618 Ga0068864_100391072 Ga0068864_1003910723 71
242 3300005618 Ga0068864_101179958 Ga0068864_1011799581 71
243 3300005618 Ga0068864_102643493 Ga0068864_1026434932 71
244 3300005718 Ga0068866_10006391 Ga0068866_100063914 71
245 3300005719 Ga0068861_100280999 Ga0068861_1002809993 71
246 3300005719 Ga0068861_100326687 Ga0068861_1003266872 71
247 3300005719 Ga0068861_100567546 Ga0068861_1005675461 71
248 3300005834 Ga0068851_10210454 Ga0068851_102104543 71
249 3300005840 Ga0068870_10775427 Ga0068870_107754272 71
250 3300005841 Ga0068863_102114637 Ga0068863_1021146372 71
251 3300005842 Ga0068858_100013304 Ga0068858_1000133046 71
252 3300005842 Ga0068858_100522584 Ga0068858_1005225842 71
253 3300005842 Ga0068858_101109366 Ga0068858_1011093661 71
254 3300005843 Ga0068860_100106859 Ga0068860_1001068593 71
255 3300005843 Ga0068860_101513499 Ga0068860_1015134992 71
256 3300005843 Ga0068860_102445478 Ga0068860_1024454782 71
257 3300005844 Ga0068862_100059528 Ga0068862_1000595285 71
258 3300006038 Ga0075365_10329962 Ga0075365_103299622 71
259 3300006038 Ga0075365_10688298 Ga0075365_106882982 71
260 3300006038 Ga0075365_10755798 Ga0075365_107557982 71
261 3300006038 Ga0075365_11044035 Ga0075365_110440352 71
262 3300006042 Ga0075368_10099631 Ga0075368_100996313 71
263 3300006042 Ga0075368_10104781 Ga0075368_101047812 71
264 3300006048 Ga0075363_100133769 Ga0075363_1001337692 71
265 3300006048 Ga0075363_100301784 Ga0075363_1003017842 71
266 3300006048 Ga0075363_100324509 Ga0075363_1003245091 71
267 3300006051 Ga0075364_10139703 Ga0075364_101397034 71
268 3300006051 Ga0075364_10142522 Ga0075364_101425223 71
269 3300006051 Ga0075364_10332959 Ga0075364_103329593 71
270 3300006051 Ga0075364_10583703 Ga0075364_105837032 71
271 3300006051 Ga0075364_10639676 Ga0075364_106396762 71
272 3300006173 Ga0070716_101689986 Ga0070716_1016899861 71
273 3300006177 Ga0075362_10197120 Ga0075362_101971202 71
274 3300006177 Ga0075362_10513341 Ga0075362_105133412 71
275 3300006177 Ga0075362_10682617 Ga0075362_106826172 71
276 3300006178 Ga0075367_10335132 Ga0075367_103351323 71
277 3300006178 Ga0075367_10579945 Ga0075367_105799452 71
278 3300006178 Ga0075367_10601802 Ga0075367_106018022 71
279 3300006178 Ga0075367_10673668 Ga0075367_106736683 71
280 3300006178 Ga0075367_10731370 Ga0075367_107313702 71
281 3300006186 Ga0075369_10020854 Ga0075369_100208543 71
282 3300006186 Ga0075369_10505835 Ga0075369_105058352 71
283 3300006195 Ga0075366_10172435 Ga0075366_101724353 71
284 3300006195 Ga0075366_10284517 Ga0075366_102845172 71
285 3300006237 Ga0097621_100099137 Ga0097621_1000991375 71
286 3300006237 Ga0097621_101006603 Ga0097621_1010066032 71
287 3300006353 Ga0075370_10074121 Ga0075370_100741213 71
288 3300006353 Ga0075370_10744471 Ga0075370_107444711 71
289 3300006353 Ga0075370_10825800 Ga0075370_108258002 71
290 3300006881 Ga0068865_100017896 Ga0068865_1000178964 71
291 3300006881 Ga0068865_100335903 Ga0068865_1003359032 71
292 3300006931 Ga0097620_101423936 Ga0097620_1014239362 71
293 3300006931 Ga0097620_102979254 Ga0097620_1029792542 71
294 3300009092 Ga0105250_10128504 Ga0105250_101285043 71
295 3300009093 Ga0105240_11359949 Ga0105240_113599492 71
296 3300009094 Ga0111539_11184651 Ga0111539_111846512 71
297 3300009094 Ga0111539_12223003 Ga0111539_122230031 71
298 3300009098 Ga0105245_10254224 Ga0105245_102542243 71
299 3300009098 Ga0105245_10980320 Ga0105245_109803202 71
300 3300009098 Ga0105245_11477823 Ga0105245_114778232 71
301 3300009098 Ga0105245_11875775 Ga0105245_118757752 71
302 3300009101 Ga0105247_10415383 Ga0105247_104153833 71
303 3300009148 Ga0105243_10006064 Ga0105243_100060646 71
304 3300009148 Ga0105243_10079575 Ga0105243_100795754 71
305 3300009148 Ga0105243_10613087 Ga0105243_106130873 71
306 3300009176 Ga0105242_10033023 Ga0105242_100330235 71
307 3300009176 Ga0105242_11175123 Ga0105242_111751232 71
308 3300009177 Ga0105248_10250500 Ga0105248_102505005 71
309 3300009177 Ga0105248_10447415 Ga0105248_104474153 71
310 3300009177 Ga0105248_10909488 Ga0105248_109094882 71
311 3300009551 Ga0105238_11461293 Ga0105238_114612933 71
312 3300009551 Ga0105238_12426426 Ga0105238_124264262 71
313 3300009553 Ga0105249_10031383 Ga0105249_1003138310 71
314 3300009553 Ga0105249_10135272 Ga0105249_101352725 71
315 3300009553 Ga0105249_11696717 Ga0105249_116967172 71
316 3300009553 Ga0105249_13039454 Ga0105249_130394541 71
317 3300010375 Ga0105239_12682526 Ga0105239_126825262 71
318 3300011119 Ga0105246_10278311 Ga0105246_102783113 71
319 3300011119 Ga0105246_10471147 Ga0105246_104711472 71
320 3300011119 Ga0105246_10777948 Ga0105246_107779481 71
321 3300011119 Ga0105246_10893555 Ga0105246_108935553 71
322 3300011119 Ga0105246_11868869 Ga0105246_118688691 71
323 3300013296 Ga0157374_11550209 Ga0157374_115502091 71
324 3300013296 Ga0157374_11854751 Ga0157374_118547512 71
325 3300013296 Ga0157374_12188076 Ga0157374_121880762 71
326 3300013296 Ga0157374_12593600 Ga0157374_125936002 71
327 3300013297 Ga0157378_10001660 Ga0157378_100016603 71
328 3300013297 Ga0157378_10275505 Ga0157378_102755053 71
329 3300013297 Ga0157378_10664393 Ga0157378_106643933 71
330 3300013297 Ga0157378_13061305 Ga0157378_130613051 71
331 3300013308 Ga0157375_10008438 Ga0157375_1000843816 71
332 3300013308 Ga0157375_10013305 Ga0157375_100133058 71
333 3300013308 Ga0157375_12846604 Ga0157375_128466042 71
334 3300014325 Ga0163163_10468780 Ga0163163_104687802 71
335 3300014325 Ga0163163_10535871 Ga0163163_105358713 71
336 3300014326 Ga0157380_10178459 Ga0157380_101784592 71
337 3300014326 Ga0157380_10673682 Ga0157380_106736823 71
338 3300014326 Ga0157380_11281986 Ga0157380_112819861 71
339 3300014326 Ga0157380_12139574 Ga0157380_121395741 71
340 3300014968 Ga0157379_10347296 Ga0157379_103472962 71
341 3300014968 Ga0157379_11549068 Ga0157379_115490682 71
342 3300014969 Ga0157376_11017233 Ga0157376_110172331 71
343 3300017792 Ga0163161_10016026 Ga0163161_100160263 71
344 3300017792 Ga0163161_11132616 Ga0163161_111326162 71
345 3300025271 Ga0207666_1006000 Ga0207666_10060004 71
346 3300025315 Ga0207697_10008759 Ga0207697_100087597 71
347 3300025321 Ga0207656_10182304 Ga0207656_101823042 71
348 3300025899 Ga0207642_10005005 Ga0207642_100050056 71
349 3300025900 Ga0207710_10573673 Ga0207710_105736732 71
350 3300025901 Ga0207688_10032475 Ga0207688_100324755 71
351 3300025904 Ga0207647_10609874 Ga0207647_106098742 71
352 3300025908 Ga0207643_10163958 Ga0207643_101639582 71
353 3300025908 Ga0207643_10260791 Ga0207643_102607912 71
354 3300025918 Ga0207662_10007284 Ga0207662_100072842 71
355 3300025918 Ga0207662_10186254 Ga0207662_101862543 71
356 3300025923 Ga0207681_10155213 Ga0207681_101552133 71
357 3300025923 Ga0207681_10522600 Ga0207681_105226002 71
358 3300025925 Ga0207650_10825221 Ga0207650_108252212 71
359 3300025925 Ga0207650_11480596 Ga0207650_114805962 71
360 3300025926 Ga0207659_10698275 Ga0207659_106982752 71
361 3300025927 Ga0207687_10088696 Ga0207687_100886963 71
362 3300025927 Ga0207687_11862560 Ga0207687_118625601 71
363 3300025931 Ga0207644_10072994 Ga0207644_100729943 71
364 3300025931 Ga0207644_10654911 Ga0207644_106549113 71
365 3300025933 Ga0207706_10289810 Ga0207706_102898102 71
366 3300025933 Ga0207706_10393952 Ga0207706_103939523 71
367 3300025934 Ga0207686_10011355 Ga0207686_100113555 71
368 3300025934 Ga0207686_11073492 Ga0207686_110734922 71
369 3300025934 Ga0207686_11173944 Ga0207686_111739442 71
370 3300025935 Ga0207709_10070302 Ga0207709_100703024 71
371 3300025935 Ga0207709_10233819 Ga0207709_102338195 71
372 3300025936 Ga0207670_10271484 Ga0207670_102714843 71
373 3300025937 Ga0207669_10031386 Ga0207669_100313866 71
374 3300025937 Ga0207669_10387134 Ga0207669_103871342 71
375 3300025938 Ga0207704_10023335 Ga0207704_100233353 71
376 3300025938 Ga0207704_10233263 Ga0207704_102332632 71
377 3300025940 Ga0207691_10007702 Ga0207691_1000770213 71
378 3300025940 Ga0207691_10115737 Ga0207691_101157372 71
379 3300025940 Ga0207691_10418152 Ga0207691_104181522 71
380 3300025941 Ga0207711_10355069 Ga0207711_103550692 71
381 3300025942 Ga0207689_10215133 Ga0207689_102151332 71
382 3300025942 Ga0207689_11250704 Ga0207689_112507043 71
383 3300025944 Ga0207661_11422227 Ga0207661_114222272 71
384 3300025945 Ga0207679_10420960 Ga0207679_104209603 71
385 3300025945 Ga0207679_10584532 Ga0207679_105845322 71
386 3300025945 Ga0207679_10625426 Ga0207679_106254262 71
387 3300025960 Ga0207651_10719202 Ga0207651_107192022 71
388 3300025961 Ga0207712_10107447 Ga0207712_101074473 71
389 3300025961 Ga0207712_10151411 Ga0207712_101514115 71
390 3300025961 Ga0207712_10261127 Ga0207712_102611274 71
391 3300025972 Ga0207668_10124847 Ga0207668_101248475 71
392 3300025972 Ga0207668_10718963 Ga0207668_107189633 71
393 3300025972 Ga0207668_10734549 Ga0207668_107345492 71
394 3300025981 Ga0207640_10318613 Ga0207640_103186132 71
395 3300025981 Ga0207640_10369792 Ga0207640_103697922 71
396 3300025986 Ga0207658_11280177 Ga0207658_112801771 71
397 3300026023 Ga0207677_10785806 Ga0207677_107858062 71
398 3300026023 Ga0207677_10920003 Ga0207677_109200032 71
399 3300026023 Ga0207677_11801632 Ga0207677_118016322 71
400 3300026023 Ga0207677_11970496 Ga0207677_119704962 71
401 3300026035 Ga0207703_10930362 Ga0207703_109303621 71
402 3300026035 Ga0207703_12004732 Ga0207703_120047321 71
403 3300026041 Ga0207639_10413621 Ga0207639_104136213 71
404 3300026041 Ga0207639_11931737 Ga0207639_119317372 71
405 3300026067 Ga0207678_10196682 Ga0207678_101966823 71
406 3300026067 Ga0207678_10631753 Ga0207678_106317532 71
407 3300026075 Ga0207708_10181033 Ga0207708_101810333 71
408 3300026075 Ga0207708_10204665 Ga0207708_102046652 71
409 3300026088 Ga0207641_11793970 Ga0207641_117939702 71
410 3300026088 Ga0207641_12591216 Ga0207641_125912162 71
411 3300026089 Ga0207648_10002304 Ga0207648_1000230417 71
412 3300026095 Ga0207676_10812356 Ga0207676_108123562 71
413 3300026095 Ga0207676_11820670 Ga0207676_118206702 71
414 3300026095 Ga0207676_12407353 Ga0207676_124073532 71
415 3300026116 Ga0207674_12208684 Ga0207674_122086842 71
416 3300026118 Ga0207675_100018499 Ga0207675_10001849910 71
417 3300026118 Ga0207675_100065945 Ga0207675_1000659452 71
418 3300026118 Ga0207675_101175132 Ga0207675_1011751322 71
419 3300026118 Ga0207675_102616243 Ga0207675_1026162432 71
420 3300026121 Ga0207683_10464447 Ga0207683_104644473 71
421 3300026121 Ga0207683_10557196 Ga0207683_105571963 71
422 3300026142 Ga0207698_10155811 Ga0207698_101558114 71
423 3300026142 Ga0207698_12452231 Ga0207698_124522311 71
424 3300027424 Ga0209984_1037445 Ga0209984_10374452 71
425 3300027866 Ga0209813_10167780 Ga0209813_101677802 71
426 3300027876 Ga0209974_10441342 Ga0209974_104413422 71
427 3300027876 Ga0209974_10471753 Ga0209974_104717532 71
428 3300028379 Ga0268266_12058553 Ga0268266_120585532 71
429 3300028380 Ga0268265_10743395 Ga0268265_107433952 71
430 3300028380 Ga0268265_11581163 Ga0268265_115811632 71
431 3300028381 Ga0268264_10270383 Ga0268264_102703835 71
432 3300028381 Ga0268264_10516781 Ga0268264_105167812 71
433 3300028381 Ga0268264_11161839 Ga0268264_111618392 71
434 3300031665 Ga0316575_10151984 Ga0316575_101519842 71
435 3300031727 Ga0316576_10727055 Ga0316576_107270553 71
436 3300031728 Ga0316578_10787276 Ga0316578_107872762 71
437 3300031995 Ga0307409_101839447 Ga0307409_1018394472 71
438 3300035398 Ga0316574_0142716 Ga0316574_0142716_18_233 71
439 3300035398 Ga0316574_0172679 Ga0316574_0172679_287_502 71
440 3300036712 Ga0316584_0679625 Ga0316584_0679625_361_576 71
441 3300041408 Ga0439453_0033181 Ga0439453_0033181_281_502 71
442 3300041413 Ga0439465_0163059 Ga0439465_0163059_254_475 71
443 3300041443 Ga0451789_1167412 Ga0451789_1167412_96_317 71
444 3300041451 Ga0451791_0621744 Ga0451791_0621744_108_338 71
445 3300041451 Ga0451791_1862888 Ga0451791_1862888_39_263 71
446 3300041453 Ga0451797_1347861 Ga0451797_1347861_317_532 71
447 3300041456 Ga0451795_0658193 Ga0451795_0658193_12_248 71
448 3300041458 Ga0451798_0437780 Ga0451798_0437780_653_868 71
449 3300041458 Ga0451798_0752664 Ga0451798_0752664_591_809 71
450 3300041460 Ga0451802_1758674 Ga0451802_1758674_13_237 71
451 3300041460 Ga0451802_1848169 Ga0451802_1848169_153_371 71
452 3300041486 Ga0451807_1771037 Ga0451807_1771037_78_296 71
453 3300041486 Ga0451807_1861075 Ga0451807_1861075_63_281 71
454 3300041491 Ga0451833_1382332 Ga0451833_1382332_30_245 71
455 3300041492 Ga0451835_1129083 Ga0451835_1129083_548_772 71
456 3300041494 Ga0451837_0628354 Ga0451837_0628354_14_238 71
457 3300041496 Ga0451839_1064396 Ga0451839_1064396_183_404 71
458 3300041498 Ga0451841_1123218 Ga0451841_1123218_312_536 71
459 3300041503 Ga0451847_0501849 Ga0451847_0501849_377_592 71
460 3300041503 Ga0451847_0892850 Ga0451847_0892850_283_498 71
461 3300041511 Ga0451855_1091895 Ga0451855_1091895_233_448 71
462 3300041512 Ga0451853_0753440 Ga0451853_0753440_20_244 71
463 3300041512 Ga0451853_1202791 Ga0451853_1202791_314_535 71
464 3300041512 Ga0451853_3101716 Ga0451853_3101716_203_421 71
465 3300041997 Ga0439431_0021026 Ga0439431_0021026_307_528 71
466 3300042006 Ga0439432_254694 Ga0439432_254694_222_443 71
467 3300042009 Ga0439451_066756 Ga0439451_066756_143_364 71
468 3300042125 Ga0450923_066887 Ga0450923_066887_299_520 71
469 3300042436 Ga0439435_0017047 Ga0439435_0017047_1421_1642 71
470 3300042439 Ga0439464_0026382 Ga0439464_0026382_1014_1235 71
471 3300042461 Ga0439460_0375402 Ga0439460_0375402_134_355 71
472 3300042876 Ga0451577_0007199 Ga0451577_0007199_7482_7697 71
473 3300044712 Ga0453684_0017333 Ga0453684_0017333_6960_7175 71
474 3300046455 Ga0495603_0712684 Ga0495603_0712684_23_238 71
475 3300046459 Ga0495629_0319732 Ga0495629_0319732_163_384 71
476 3300046461 Ga0495641_0009979 Ga0495641_0009979_135_356 71
477 3300046533 Ga0495640_0926951 Ga0495640_0926951_244_459 71
478 3300046683 Ga0495658_0432806 Ga0495658_0432806_454_675 71
479 3300046689 Ga0495613_0246149 Ga0495613_0246149_688_909 71
480 3300046690 Ga0495624_0203993 Ga0495624_0203993_105_326 71
481 3300046691 Ga0495670_0043650 Ga0495670_0043650_526_741 71
482 3300047321 Ga0495676_0151750 Ga0495676_0151750_989_1210 71
483 3300047321 Ga0495676_0239413 Ga0495676_0239413_53_268 71
484 3300048903 Ga0496100_0791873 Ga0496100_0791873_224_439 71
485 3300048903 Ga0496100_1142687 Ga0496100_1142687_182_415 71
486 3300048904 Ga0496101_0137882 Ga0496101_0137882_1462_1677 71
487 3300048904 Ga0496101_0513626 Ga0496101_0513626_654_872 71
488 3300048905 Ga0496102_0123784 Ga0496102_0123784_610_825 71
489 3300048905 Ga0496102_0933000 Ga0496102_0933000_347_580 71
490 3300048906 Ga0496103_0283504 Ga0496103_0283504_10_225 71
491 3300048907 Ga0496104_0003461 Ga0496104_0003461_9261_9476 71
492 3300048907 Ga0496104_0730065 Ga0496104_0730065_512_727 71
493 3300048907 Ga0496104_0741449 Ga0496104_0741449_366_599 71
494 3300048908 Ga0496105_0032478 Ga0496105_0032478_2586_2801 71
495 3300048909 Ga0496106_0005388 Ga0496106_0005388_1417_1632 71
496 3300048910 Ga0496107_0029229 Ga0496107_0029229_3678_3893 71
497 3300048911 Ga0496108_0190206 Ga0496108_0190206_1170_1403 71
498 3300048911 Ga0496108_0370500 Ga0496108_0370500_943_1161 71
499 3300048912 Ga0496109_0109404 Ga0496109_0109404_1054_1269 71
500 3300048912 Ga0496109_0113003 Ga0496109_0113003_215_433 71
501 3300048912 Ga0496109_0131380 Ga0496109_0131380_487_720 71
502 3300048913 Ga0496110_0005006 Ga0496110_0005006_6376_6591 71
503 3300048913 Ga0496110_0010815 Ga0496110_0010815_5694_5927 71
504 3300048913 Ga0496110_0058384 Ga0496110_0058384_503_721 71
505 3300048914 Ga0496111_0014227 Ga0496111_0014227_3828_4043 71
506 3300048914 Ga0496111_1322305 Ga0496111_1322305_85_300 71
507 3300048916 Ga0496113_0093415 Ga0496113_0093415_598_831 71
508 3300048916 Ga0496113_1174846 Ga0496113_1174846_249_467 71
509 3300048917 Ga0496114_0029016 Ga0496114_0029016_2527_2742 71
510 3300048917 Ga0496114_0131309 Ga0496114_0131309_1178_1393 71
511 3300048917 Ga0496114_0588627 Ga0496114_0588627_29_247 71
512 3300049588 Ga0501072_1576536 Ga0501072_1576536_165_386 71
513 3300049589 Ga0501073_0092961 Ga0501073_0092961_407_622 71
514 3300049589 Ga0501073_0387359 Ga0501073_0387359_194_409 71
515 3300049591 Ga0501075_1363052 Ga0501075_1363052_230_451 71
516 3300049592 Ga0501076_0245709 Ga0501076_0245709_1034_1255 71
517 3300050489 nmdc:mga03683_357218_c1 nmdc:mga03683_357218_c1_104_325 71
518 3300050489 nmdc:mga03683_668642_c1 nmdc:mga03683_668642_c1_239_460 71
519 3300050490 nmdc:mga03n38_136828_c1 nmdc:mga03n38_136828_c1_182_400 71
520 3300050490 nmdc:mga03n38_156867_c1 nmdc:mga03n38_156867_c1_261_479 71
521 3300050490 nmdc:mga03n38_321359_c1 nmdc:mga03n38_321359_c1_282_500 71
522 3300050491 nmdc:mga00v17_192554_c1 nmdc:mga00v17_192554_c1_560_775 71
523 3300050491 nmdc:mga00v17_373980_c1 nmdc:mga00v17_373980_c1_230_448 71
524 3300050491 nmdc:mga00v17_440041_c1 nmdc:mga00v17_440041_c1_200_418 71
525 3300050491 nmdc:mga00v17_527263_c1 nmdc:mga00v17_527263_c1_234_455 71
526 3300050491 nmdc:mga00v17_664291_c1 nmdc:mga00v17_664291_c1_173_394 71
527 3300050491 nmdc:mga00v17_845201_c1 nmdc:mga00v17_845201_c1_154_369 71
528 3300050491 nmdc:mga00v17_964163_c1 nmdc:mga00v17_964163_c1_134_355 71
529 3300050492 nmdc:mga0yw44_1141883_c1 nmdc:mga0yw44_1141883_c1_248_463 71
530 3300050492 nmdc:mga0yw44_253688_c1 nmdc:mga0yw44_253688_c1_802_1017 71
531 3300050492 nmdc:mga0yw44_273497_c1 nmdc:mga0yw44_273497_c1_377_598 71
532 3300050492 nmdc:mga0yw44_63706_c1 nmdc:mga0yw44_63706_c1_2010_2228 71
533 3300050492 nmdc:mga0yw44_784597_c1 nmdc:mga0yw44_784597_c1_168_389 71
534 3300050493 nmdc:mga0k408_119778_c1 nmdc:mga0k408_119778_c1_13_231 71
535 3300050493 nmdc:mga0k408_337853_c1 nmdc:mga0k408_337853_c1_321_536 71
536 3300050493 nmdc:mga0k408_570046_c1 nmdc:mga0k408_570046_c1_125_346 71
537 3300050494 nmdc:mga06z11_152093_c1 nmdc:mga06z11_152093_c1_273_488 71
538 3300050494 nmdc:mga06z11_304814_c1 nmdc:mga06z11_304814_c1_474_692 71
539 3300050494 nmdc:mga06z11_883897_c1 nmdc:mga06z11_883897_c1_11_226 71
540 3300050496 nmdc:mga07m45_446462_c1 nmdc:mga07m45_446462_c1_382_597 71
541 3300050511 nmdc:mga08y16_1504819_c1 nmdc:mga08y16_1504819_c1_276_527 71
542 3300050516 nmdc:mga0sz30_19142_c1 nmdc:mga0sz30_19142_c1_1616_1834 71
543 3300050516 nmdc:mga0sz30_500573_c1 nmdc:mga0sz30_500573_c1_244_462 71
544 3300053129 Ga0500628_129784 Ga0500628_129784_197_412 71
545 3300053129 Ga0500628_141110 Ga0500628_141110_293_508 71
546 3300060353 Ga0501082_1332779 Ga0501082_1332779_94_309 71

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

7

62

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nd5-assembly2.cif.gz_22 crystal structure of the thermus thermophilus 70s ribosome in complex with chloramphenicol and bound to mrna and a-, p-, and e-site trnas at 2.60a resolution 0.9715 6 63
6cfj-assembly1.cif.gz_12 crystal structure of the thermus thermophilus 70s ribosome in complex with histidyl-cam and bound to mrna and a-, p-, and e-site trnas at 2.8a resolution 0.9703 6 63
4v7j-assembly2.cif.gz_B2 structure of rele nuclease bound to the 70s ribosome (precleavage state) 0.9699 6 63
5dfe-assembly1.cif.gz_R2 70s termination complex containing e. coli rf2 0.9668 6 62
5doy-assembly2.cif.gz_22 crystal structure of the thermus thermophilus 70s ribosome in complex with antibiotic hygromycin a, mrna and three trnas in the a, p and e sites at 2.6a resolution 0.9666 6 63
ID Description Score Start End Superfamily
4l6lY00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9449 16 55 1.10.287.310
af_A0A1D6JR08_188_264_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9388 13 66 1.10.287.660
af_A0A0R4IIN4_82_162_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9366 13 67 1.10.287.660
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9318 10 67 1.10.287.310
af_A0JPF7_83_159_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9274 13 67 1.10.287.660
ID Description Score Start End GO Terms
AF-A0A2H0S933-F1-model_v4 Large ribosomal subunit protein uL29 0.9968 3 63 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2M7UPP0-F1-model_v4 Large ribosomal subunit protein uL29 0.9849 3 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2M8EL55-F1-model_v4 Large ribosomal subunit protein uL29 0.9799 3 65 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0G0MUX2-F1-model_v4 50S ribosomal protein L29 0.9766 3 69 GO:0003735
GO:0005840
GO:0006412
AF-A0A4D6Y511-F1-model_v4 Large ribosomal subunit protein uL29 0.974 8 65 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
93.27 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map