metagRoot

F461985

General Info

Members	Datasets	Scaffolds	Average Seq Length
546	333	463	392

Family's Representative Sequence

Representative Sequence	3300009093\|Ga0105240_10004321\|Ga0105240_100043214
Length	435
Sequence	MQFFAGVVVCIRADLTSLDPTHRCRTIRRFIFVHWRARMPVINRIASFHKDMTAWRHDIHSHPETAFEEVRTADVVAEKLKSFGLEVHRGLAKTGVVGVLRAGKSGRAIGLRADMDALDVHETNQFDHKSTIAGKMHACGHDGHTVMLLGAAKYLAETRNFDGTVYFIFQPAEENEGGGRVMVEEGLFEKFPVDGVYGMHNIPGIPVGKFAVRPGPMMAAYDIFEVVLKGVGGHGAMPHHTIDPVVVGAHIVTALQSIVARNVDPMDTAVVSTTQIHAGDAWNVIPQECVLRGTVRTFKKPVQDMIEKNIEKISRNVAAGFGAEVVKWRYERRYPATVNSVQETEFAAHAASALVGLDNVNRNPTPAMGSEDFAWMLLKKPGCYIWIGNGDGEGSCMVHNPGYDFNDDILPIGASYWATLVEQQLAREALPQAAE

Samples

	Sample ID	Description	Type	Environment
1	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
2	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
3	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
4	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
5	2513237082	Paraburkholderia mimosarum STM3621	Isolate	Nodule
6	2513237083	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
7	2519103095	Burkholderia sp. KJ006	Isolate	Nodule
8	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
9	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
10	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
11	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
12	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
13	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
14	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
15	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
16	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
17	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
18	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
19	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
20	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
21	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
22	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
23	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
24	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
25	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
26	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
27	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
28	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
29	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
30	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
31	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
32	2842333319	Skermanella aerolata SEMIA 4010	Isolate	Nodule
33	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
34	2847085930	Erwinia persicina B64	Isolate	Bulb
35	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
36	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
37	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
38	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
39	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
40	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
41	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
42	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
43	2889790730	Chelativorans xinjiangense lm93	Isolate	Rhizosphere
44	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
45	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
46	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
47	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
48	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
49	2904564687	Burkholderia sp. 571	Isolate	Unclassified
50	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
51	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
52	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
53	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
54	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
55	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
56	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
57	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
58	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
59	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
60	2928163908	Burkholderia sp. 567	Isolate	Unclassified
61	2928170801	Burkholderia sp. 572	Isolate	Unclassified
62	2928536128	Burkholderia sola 565	Isolate	Unclassified
63	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
64	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
65	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
66	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
67	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
68	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
69	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
70	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
71	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
72	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
73	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
74	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
75	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
76	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
77	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
78	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
79	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
80	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
81	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
82	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
83	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
84	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
85	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
86	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
87	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
88	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
89	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
90	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
91	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
92	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
93	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
94	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
95	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
96	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
97	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
98	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
99	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
100	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
101	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
102	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
103	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
104	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
105	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
106	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
107	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
108	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
109	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
110	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
111	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
112	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
113	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
114	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
115	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
116	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
117	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
118	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
119	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
120	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
121	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
122	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
123	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
124	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
125	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
126	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
127	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
128	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
129	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
130	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
131	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
132	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
133	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
134	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
135	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
136	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
137	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
138	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
139	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
140	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
141	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
144	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
151	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
152	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
155	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
158	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
180	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
182	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
184	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
185	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
186	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
187	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
188	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
189	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
190	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
191	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
192	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
193	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
194	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
195	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
196	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
197	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
198	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
199	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
200	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
201	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
202	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
203	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
204	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
205	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
206	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
207	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
208	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
209	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
210	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
211	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
212	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
213	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
214	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
215	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
216	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
217	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
218	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
219	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
220	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
221	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
222	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
223	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
224	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
225	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
226	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
227	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
228	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
229	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
230	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
231	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
232	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
233	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
234	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
235	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
236	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
237	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
238	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
239	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
240	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
241	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
242	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
243	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
244	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
245	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
246	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
247	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
248	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
249	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
250	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
251	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
252	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
253	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
254	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
255	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
256	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
257	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
258	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
259	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
260	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
261	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
262	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
263	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
264	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
265	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
266	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
267	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
268	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
269	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
270	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
271	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
272	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
273	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
274	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
275	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
276	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
277	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
278	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
279	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
280	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
281	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
282	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
283	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
284	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
285	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
286	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
287	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
288	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
289	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
290	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
291	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
292	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
293	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
294	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
295	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
296	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
297	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
298	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
299	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
300	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
301	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
302	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
303	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
304	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
305	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
306	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
307	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
308	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
309	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
310	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
311	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
312	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
313	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
314	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
315	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
316	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
317	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
318	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
319	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
320	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
321	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
322	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
323	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
324	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
325	8003955200	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
326	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
327	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
328	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
329	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
330	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
331	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
332	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
333	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	85.16
Metatranscriptomes	0
Isolates	14.84

Biome Distribution

Category	Percentage (%)
Aerial Root	0.37
Bulb	0.18
Endosphere	15.57
Nodule	2.01
Rhizoplane	3.11
Rhizosphere	64.84
Stem	0
Stem Tuber	0
Unclassified	13.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10031577	3300001989	Bacteria	1829
2	JGI25156J39149_1000205	3300002705	Bacteria	40906
3	JGI25154J39366_1000101	3300002738	Bacteria	76597
4	JGI25165J46597_1001595	3300003214	Bacteria	10972
5	JGI25165J46597_1005351	3300003214	Bacteria	2491
6	rootH1_10062809	3300003316	Bacteria	5504
7	rootH2_10047895	3300003320	Bacteria	14337
8	rootH1_10083155	3300003323	Bacteria	10706
9	Ga0055538_1000008	3300003751	Bacteria	398547
10	Ga0055538_1000084	3300003751	Bacteria	81835
11	Ga0055539_1000012	3300003752	Bacteria	398547
12	Ga0055533_1000015	3300003756	Bacteria	398547
13	Ga0055533_1000095	3300003756	Bacteria	114060
14	Ga0055533_1008087	3300003756	Bacteria	1363
15	Ga0055532_1000010	3300003758	Bacteria	392055
16	Ga0055532_1000264	3300003758	Bacteria	34181
17	Ga0055532_1000351	3300003758	Bacteria	24599
18	Ga0055532_1000512	3300003758	Bacteria	16921
19	Ga0055525_1000017	3300003759	Bacteria	398547
20	Ga0055527_1000008	3300003760	Bacteria	392055
21	Ga0055527_1000268	3300003760	Bacteria	31437
22	Ga0055535_1000007	3300003761	Bacteria	392055
23	Ga0055535_1000157	3300003761	Bacteria	72863
24	Ga0055535_1000563	3300003761	Bacteria	31437
25	Ga0055542_1000011	3300003762	Bacteria	392055
26	Ga0055542_1000204	3300003762	Bacteria	72884
27	Ga0055542_1002102	3300003762	Bacteria	7384
28	Ga0055529_1000009	3300003763	Bacteria	392055
29	Ga0055529_1000221	3300003763	Bacteria	73491
30	Ga0055528_1001385	3300003790	Bacteria	14893
31	Ga0055541_1000009	3300003841	Bacteria	398547
32	Ga0058692_1000098	3300003856	Bacteria	57148
33	Ga0058692_1000202	3300003856	Bacteria	35967
34	Ga0058692_1001424	3300003856	Bacteria	8809
35	Ga0070658_10003024	3300005327	Bacteria	13911
36	Ga0070658_10039170	3300005327	Bacteria	3823
37	Ga0070683_100027919	3300005329	Bacteria	5095
38	Ga0070680_100017398	3300005336	Bacteria	5669
39	Ga0070660_100000457	3300005339	Bacteria	27258
40	Ga0070691_10001406	3300005341	Bacteria	10269
41	Ga0070668_100014373	3300005347	Bacteria	5915
42	Ga0070675_100251586	3300005354	Bacteria	1547
43	Ga0070659_100000108	3300005366	Bacteria	61185
44	Ga0070709_10037203	3300005434	Bacteria	2971
45	Ga0070662_100023500	3300005457	Bacteria	4235
46	Ga0070681_10000320	3300005458	Bacteria	39081
47	Ga0070698_100001190	3300005471	Bacteria	28851
48	Ga0070679_100004504	3300005530	Bacteria	12868
49	Ga0070697_100025217	3300005536	Bacteria	4741
50	Ga0070665_100013946	3300005548	Bacteria	8083
51	Ga0070665_100058939	3300005548	Bacteria	3848
52	Ga0068855_100000838	3300005563	Bacteria	38053
53	Ga0068855_100000904	3300005563	Bacteria	36789
54	Ga0068855_100058519	3300005563	Bacteria	4512
55	Ga0068855_100122262	3300005563	Bacteria	2979
56	Ga0070664_100060345	3300005564	Bacteria	3229
57	Ga0070664_100065890	3300005564	Bacteria	3092
58	Ga0068857_100219106	3300005577	Bacteria	1738
59	Ga0068854_100131749	3300005578	Bacteria	1910
60	Ga0068856_100046845	3300005614	Bacteria	4259
61	Ga0068856_100100644	3300005614	Bacteria	2882
62	Ga0068852_100017751	3300005616	Bacteria	5590
63	Ga0068852_100092879	3300005616	Bacteria	2704
64	Ga0081455_10000116	3300005937	Bacteria	91321
65	Ga0081455_10008619	3300005937	Bacteria	10577
66	Ga0081455_10024560	3300005937	Bacteria	5578
67	Ga0081539_10003020	3300005985	Bacteria	21846
68	Ga0081539_10016756	3300005985	Bacteria	5203
69	Ga0075365_10059001	3300006038	Bacteria	2556
70	Ga0075365_10082610	3300006038	Bacteria	2178
71	Ga0075432_10000877	3300006058	Bacteria	9484
72	Ga0070712_100108276	3300006175	Bacteria	2069
73	Ga0075362_10038336	3300006177	Bacteria	2105
74	Ga0075362_10078907	3300006177	Bacteria	1515
75	Ga0075367_10004904	3300006178	Bacteria	6591
76	Ga0075369_10001815	3300006186	Bacteria	7442
77	Ga0075369_10066329	3300006186	Bacteria	1583
78	Ga0075436_100018894	3300006914	Bacteria	4719
79	Ga0075436_100054452	3300006914	Bacteria	2761
80	Ga0079104_1000068	3300006946	Bacteria	154984
81	Ga0105251_10001827	3300009011	Bacteria	17545
82	Ga0105244_10000333	3300009036	Bacteria	44601
83	Ga0105244_10008807	3300009036	Bacteria	6267
84	Ga0105244_10028520	3300009036	Bacteria	2993
85	Ga0105240_10000586	3300009093	Bacteria	67524
86	Ga0105240_10004321	3300009093	Bacteria	21688
87	Ga0105240_10096407	3300009093	Bacteria	3604
88	Ga0105240_10106278	3300009093	Bacteria	3405
89	Ga0105240_10109642	3300009093	Bacteria	3342
90	Ga0111539_10324922	3300009094	Bacteria	1791
91	Ga0105237_10015581	3300009545	Bacteria	7906
92	Ga0105237_10029105	3300009545	Bacteria	5619
93	Ga0105237_10033998	3300009545	Bacteria	5164
94	Ga0105237_10077543	3300009545	Bacteria	3313
95	Ga0105237_10436713	3300009545	Bacteria	1315
96	Ga0105238_10000111	3300009551	Bacteria	89931
97	Ga0105239_10046397	3300010375	Bacteria	4761
98	Ga0105246_10003091	3300011119	Bacteria	10100
99	Ga0157373_10006300	3300013100	Bacteria	8867
100	Ga0157373_10009596	3300013100	Bacteria	7144
101	Ga0157371_10022553	3300013102	Bacteria	4610
102	Ga0157371_10176889	3300013102	Bacteria	1526
103	Ga0157370_10000260	3300013104	Bacteria	66984
104	Ga0157370_10003456	3300013104	Bacteria	18523
105	Ga0157370_10008025	3300013104	Bacteria	11435
106	Ga0157370_10034702	3300013104	Bacteria	4908
107	Ga0157370_10103259	3300013104	Bacteria	2668
108	Ga0157369_10000214	3300013105	Bacteria	80288
109	Ga0157369_10004707	3300013105	Bacteria	16041
110	Ga0157369_10008342	3300013105	Bacteria	11879
111	Ga0157369_10091243	3300013105	Bacteria	3252
112	Ga0157369_10212156	3300013105	Bacteria	2029
113	Ga0157374_10002568	3300013296	Bacteria	15311
114	Ga0163162_10260013	3300013306	Bacteria	1868
115	Ga0157372_10024223	3300013307	Bacteria	6589
116	Ga0157372_10069853	3300013307	Bacteria	3951
117	Ga0157372_10081515	3300013307	Bacteria	3662
118	Ga0157372_10084477	3300013307	Bacteria	3598
119	Ga0182006_1002600	3300015261	Bacteria	9754
120	Ga0182006_1006021	3300015261	Bacteria	5680
121	Ga0182006_1008796	3300015261	Bacteria	4565
122	Ga0182007_10001588	3300015262	Bacteria	12112
123	Ga0182005_1021802	3300015265	Bacteria	1756
124	Ga0163161_10020929	3300017792	Bacteria	4595
125	Ga0213872_10002340	3300021361	Bacteria	11262
126	Ga0213875_10004095	3300021388	Bacteria	8096
127	Ga0213871_10000826	3300021441	Bacteria	4652
128	Ga0209435_100069	3300025206	Bacteria	64808
129	Ga0209784_100005	3300025224	Bacteria	1040422
130	Ga0209784_100066	3300025224	Bacteria	154427
131	Ga0209566_100005	3300025225	Bacteria	1040422
132	Ga0209566_100125	3300025225	Bacteria	95628
133	Ga0209566_100510	3300025225	Bacteria	26904
134	Ga0209674_100009	3300025226	Bacteria	1040422
135	Ga0209674_100022	3300025226	Bacteria	563656
136	Ga0209674_100344	3300025226	Bacteria	27195
137	Ga0209674_100497	3300025226	Bacteria	16305
138	Ga0209672_100001	3300025228	Bacteria	2828210
139	Ga0209672_100040	3300025228	Bacteria	278858
140	Ga0209672_100044	3300025228	Bacteria	270292
141	Ga0209672_100120	3300025228	Bacteria	83650
142	Ga0209672_101665	3300025228	Bacteria	7231
143	Ga0209147_100001	3300025229	Bacteria	2384371
144	Ga0209147_100037	3300025229	Bacteria	326977
145	Ga0209147_100039	3300025229	Bacteria	311101
146	Ga0209147_100048	3300025229	Bacteria	278858
147	Ga0209563_100012	3300025230	Bacteria	1040422
148	Ga0209563_100370	3300025230	Bacteria	16574
149	Ga0207427_100612	3300025231	Bacteria	17719
150	Ga0209437_100212	3300025233	Bacteria	107265
151	Ga0209258_100001	3300025242	Bacteria	2384269
152	Ga0209258_100062	3300025242	Bacteria	311101
153	Ga0209258_100070	3300025242	Bacteria	278858
154	Ga0209646_1000108	3300025246	Bacteria	158853
155	Ga0209026_1000508	3300025250	Bacteria	27593
156	Ga0209677_100006	3300025253	Bacteria	1040422
157	Ga0209148_1000003	3300025254	Bacteria	2384288
158	Ga0209148_1000075	3300025254	Bacteria	311101
159	Ga0209148_1000691	3300025254	Bacteria	27615
160	Ga0209759_1000002	3300025256	Bacteria	1027596
161	Ga0209759_1000101	3300025256	Bacteria	155034
162	Ga0209759_1000173	3300025256	Bacteria	107724
163	Ga0209759_1000380	3300025256	Bacteria	55490
164	Ga0209759_1007207	3300025256	Bacteria	3613
165	Ga0209759_1015973	3300025256	Bacteria	1915
166	Ga0209233_1000061	3300025261	Bacteria	406211
167	Ga0209233_1011188	3300025261	Bacteria	2652
168	Ga0209455_1000001	3300025272	Bacteria	2384278
169	Ga0209455_1000067	3300025272	Bacteria	311101
170	Ga0209455_1000384	3300025272	Bacteria	39430
171	Ga0209673_1000044	3300025273	Bacteria	290647
172	Ga0207696_1003155	3300025711	Bacteria	7657
173	Ga0207655_1001590	3300025728	Bacteria	20355
174	Ga0207655_1003460	3300025728	Bacteria	11738
175	Ga0207655_1004491	3300025728	Bacteria	9878
176	Ga0207655_1028683	3300025728	Bacteria	2621
177	Ga0207713_1000001	3300025735	Bacteria	2295391
178	Ga0207713_1027199	3300025735	Bacteria	2603
179	Ga0207647_10003607	3300025904	Bacteria	11589
180	Ga0207647_10039918	3300025904	Bacteria	2959
181	Ga0207699_10038378	3300025906	Bacteria	2744
182	Ga0207705_10004932	3300025909	Bacteria	10017
183	Ga0207705_10006064	3300025909	Bacteria	8990
184	Ga0207705_10008789	3300025909	Bacteria	7363
185	Ga0207707_10052094	3300025912	Bacteria	3564
186	Ga0207695_10000661	3300025913	Bacteria	67973
187	Ga0207695_10015469	3300025913	Bacteria	8980
188	Ga0207695_10051571	3300025913	Bacteria	4318
189	Ga0207695_10084901	3300025913	Bacteria	3195
190	Ga0207695_10088117	3300025913	Bacteria	3125
191	Ga0207671_10022495	3300025914	Bacteria	4766
192	Ga0207671_10057071	3300025914	Bacteria	2893
193	Ga0207671_10066883	3300025914	Bacteria	2675
194	Ga0207671_10083459	3300025914	Bacteria	2399
195	Ga0207671_10098429	3300025914	Bacteria	2212
196	Ga0207693_10140864	3300025915	Bacteria	1896
197	Ga0207660_10054571	3300025917	Bacteria	2852
198	Ga0207660_10114095	3300025917	Bacteria	2037
199	Ga0207657_10000110	3300025919	Bacteria	80294
200	Ga0207657_10004191	3300025919	Bacteria	15275
201	Ga0207652_10032219	3300025921	Bacteria	4404
202	Ga0207694_10000199	3300025924	Bacteria	60220
203	Ga0207690_10000016	3300025932	Bacteria	256657
204	Ga0207690_10176187	3300025932	Bacteria	1606
205	Ga0207706_10289009	3300025933	Bacteria	1429
206	Ga0207667_10000028	3300025949	Bacteria	334510
207	Ga0207667_10007165	3300025949	Bacteria	13460
208	Ga0207667_10009007	3300025949	Bacteria	11806
209	Ga0207667_10015099	3300025949	Bacteria	8782
210	Ga0207667_10045640	3300025949	Bacteria	4640
211	Ga0207667_10112807	3300025949	Bacteria	2803
212	Ga0207677_10201649	3300026023	Bacteria	1582
213	Ga0207678_10000574	3300026067	Bacteria	33658
214	Ga0207702_10108045	3300026078	Bacteria	2468
215	Ga0207698_10051787	3300026142	Bacteria	3140
216	Ga0207698_10128752	3300026142	Bacteria	2159
217	Ga0209281_1000168	3300027111	Bacteria	155116
218	Ga0209371_1000005	3300027312	Bacteria	1061740
219	Ga0209371_1000102	3300027312	Bacteria	151286
220	Ga0209371_1000153	3300027312	Bacteria	108815
221	Ga0209371_1000452	3300027312	Bacteria	40935
222	Ga0209371_1000550	3300027312	Bacteria	34721
223	Ga0209371_1000782	3300027312	Bacteria	26291
224	Ga0209371_1001067	3300027312	Bacteria	20503
225	Ga0209371_1001640	3300027312	Bacteria	14413
226	Ga0207428_10019650	3300027907	Bacteria	5758
227	Ga0268265_10305787	3300028380	Bacteria	1434
228	Ga0307515_10001984	3300028794	Bacteria	45309
229	Ga0268256_1000006	3300030500	Bacteria	1063991
230	Ga0268256_1000035	3300030500	Bacteria	384794
231	Ga0268256_1000421	3300030500	Bacteria	38236
232	Ga0268256_1000598	3300030500	Bacteria	28598
233	Ga0268256_1000658	3300030500	Bacteria	26291
234	Ga0268256_1006044	3300030500	Bacteria	4596
235	Ga0268256_1013617	3300030500	Bacteria	2453
236	Ga0307409_100172839	3300031995	Bacteria	1903
237	Ga0307414_10180710	3300032004	Bacteria	1696
238	Ga0373937_0388129	3300036401	Bacteria	1324
239	Ga0395899_0000241	3300037312	Bacteria	72826
240	Ga0395899_0010044	3300037312	Bacteria	7256
241	Ga0395899_0024995	3300037312	Bacteria	4511
242	Ga0395899_0059956	3300037312	Bacteria	2804
243	Ga0395900_0000074	3300037418	Bacteria	184491
244	Ga0395900_0008101	3300037418	Bacteria	10818
245	Ga0395900_0014361	3300037418	Bacteria	8084
246	Ga0395900_0037628	3300037418	Bacteria	4988
247	Ga0395900_0132441	3300037418	Bacteria	2554
248	Ga0395900_0135792	3300037418	Bacteria	2520
249	Ga0395898_0000016	3300037466	Bacteria	435585
250	Ga0395898_0140563	3300037466	Bacteria	2311
251	Ga0395898_0153602	3300037466	Bacteria	2202
252	Ga0395898_0267911	3300037466	Bacteria	1629
253	Ga0395905_0000035	3300037471	Bacteria	272014
254	Ga0436364_0685758	3300037853	Bacteria	26800
255	Ga0436364_0982830	3300037853	Bacteria	39124
256	Ga0395901_0000105	3300038443	Bacteria	114318
257	Ga0395901_0000146	3300038443	Bacteria	91706
258	Ga0395901_0000879	3300038443	Bacteria	33046
259	Ga0395901_0001472	3300038443	Bacteria	24479
260	Ga0395901_0006255	3300038443	Bacteria	12067
261	Ga0395901_0025664	3300038443	Bacteria	6049
262	Ga0395901_0037337	3300038443	Bacteria	5024
263	Ga0436365_0053006	3300039437	Bacteria	19049
264	Ga0436365_0257773	3300039437	Bacteria	1186
265	Ga0436365_0755393	3300039437	Bacteria	1516
266	Ga0436360_0157941	3300039438	Bacteria	3599
267	Ga0436360_0530048	3300039438	Bacteria	4601
268	Ga0436360_0913204	3300039438	Bacteria	2947
269	Ga0436362_1302861	3300039453	Bacteria	1573
270	Ga0439436_0000144	3300041404	Bacteria	16508
271	Ga0439447_000922	3300041407	Bacteria	10732
272	Ga0439447_004510	3300041407	Bacteria	4774
273	Ga0439466_0000001	3300041411	Bacteria	647258
274	Ga0439451_004722	3300042009	Bacteria	2770
275	Ga0439452_000001	3300042010	Bacteria	1725439
276	Ga0439452_011885	3300042010	Bacteria	2492
277	Ga0439463_007582	3300042016	Bacteria	2675
278	Ga0450907_000167	3300042146	Bacteria	24105
279	Ga0466969_0001340	3300044656	Bacteria	13284
280	Ga0466972_0088792	3300044658	Bacteria	1467
281	Ga0466965_0004474	3300044683	Bacteria	6221
282	Ga0466965_0013219	3300044683	Bacteria	3892
283	Ga0466966_0000009	3300044684	Bacteria	150954
284	Ga0466966_0018014	3300044684	Bacteria	4664
285	Ga0466961_0000825	3300044693	Bacteria	19372
286	Ga0466961_0022957	3300044693	Bacteria	4014
287	Ga0466963_0007149	3300044694	Bacteria	6651
288	Ga0466963_0066976	3300044694	Bacteria	2409
289	Ga0466971_0019947	3300044719	Bacteria	2979
290	Ga0466971_0023410	3300044719	Bacteria	2753
291	Ga0466957_0000908	3300044842	Bacteria	15151
292	Ga0466957_0004620	3300044842	Bacteria	7692
293	Ga0466957_0052128	3300044842	Bacteria	2491
294	Ga0466957_0104613	3300044842	Bacteria	1788
295	Ga0466960_0005960	3300044901	Bacteria	4863
296	Ga0466959_0006203	3300045049	Bacteria	8260
297	Ga0466959_0045586	3300045049	Bacteria	3228
298	Ga0466958_0021988	3300045836	Bacteria	3730
299	Ga0466958_0024318	3300045836	Bacteria	3564
300	Ga0466967_0319675	3300045976	Bacteria	1496
301	Ga0495617_009972	3300046452	Bacteria	3256
302	Ga0495627_006004	3300046453	Bacteria	4816
303	Ga0495603_0081097	3300046455	Bacteria	1901
304	Ga0495591_000059	3300046458	Bacteria	130522
305	Ga0495591_003010	3300046458	Bacteria	8969
306	Ga0495629_0145260	3300046459	Bacteria	1650
307	Ga0495651_0066850	3300046462	Bacteria	2743
308	Ga0495650_0007178	3300046471	Bacteria	6755
309	Ga0495580_0204833	3300046472	Bacteria	1358
310	Ga0495582_0006408	3300046473	Bacteria	6537
311	Ga0495605_0000036	3300046474	Bacteria	203902
312	Ga0495605_0061860	3300046474	Bacteria	1790
313	Ga0495639_0004600	3300046475	Bacteria	5918
314	Ga0495585_0010905	3300046492	Bacteria	5399
315	Ga0495594_0006259	3300046499	Bacteria	6121
316	Ga0495596_0001570	3300046500	Bacteria	13022
317	Ga0495607_0022885	3300046501	Bacteria	3919
318	Ga0495607_0035646	3300046501	Bacteria	3007
319	Ga0495583_0000028	3300046506	Bacteria	255787
320	Ga0495583_0003370	3300046506	Bacteria	12273
321	Ga0495583_0003876	3300046506	Bacteria	11077
322	Ga0495606_0000112	3300046507	Bacteria	138076
323	Ga0495610_0002063	3300046512	Bacteria	17146
324	Ga0495620_0000073	3300046515	Bacteria	83446
325	Ga0495628_0003075	3300046516	Bacteria	14949
326	Ga0495628_0235451	3300046516	Bacteria	1371
327	Ga0495630_0003683	3300046517	Bacteria	10683
328	Ga0495630_0022455	3300046517	Bacteria	4660
329	Ga0495630_0153010	3300046517	Bacteria	1755
330	Ga0495631_0006361	3300046518	Bacteria	6109
331	Ga0495631_0009676	3300046518	Bacteria	4807
332	Ga0495632_0016334	3300046519	Bacteria	4132
333	Ga0495637_0025327	3300046520	Bacteria	2674
334	Ga0495637_0049693	3300046520	Bacteria	1760
335	Ga0495643_0014101	3300046522	Bacteria	4765
336	Ga0495648_0000392	3300046524	Bacteria	47998
337	Ga0495648_0000560	3300046524	Bacteria	39735
338	Ga0495648_0001641	3300046524	Bacteria	21739
339	Ga0495648_0006236	3300046524	Bacteria	9753
340	Ga0495666_0010709	3300046526	Bacteria	4573
341	Ga0495652_0005427	3300046529	Bacteria	12012
342	Ga0495654_0000009	3300046530	Bacteria	381872
343	Ga0495654_0000246	3300046530	Bacteria	50620
344	Ga0495665_0000067	3300046531	Bacteria	43494
345	Ga0495586_0009005	3300046535	Bacteria	5310
346	Ga0495587_0006977	3300046536	Bacteria	7335
347	Ga0495587_0045976	3300046536	Bacteria	2593
348	Ga0495609_0000115	3300046538	Bacteria	93419
349	Ga0495597_0000635	3300046542	Bacteria	28659
350	Ga0495645_0151127	3300046543	Bacteria	1613
351	Ga0495622_0014787	3300046557	Bacteria	3627
352	Ga0495622_0018819	3300046557	Bacteria	3217
353	Ga0495633_0000028	3300046558	Bacteria	203214
354	Ga0495668_0060216	3300046616	Bacteria	2094
355	Ga0495611_0006438	3300046648	Bacteria	5006
356	Ga0495611_0014727	3300046648	Bacteria	3344
357	Ga0495635_0043006	3300046663	Bacteria	3118
358	Ga0495661_0000211	3300046665	Bacteria	67481
359	Ga0495661_0029530	3300046665	Bacteria	3498
360	Ga0495599_0011912	3300046678	Bacteria	5350
361	Ga0495623_0004181	3300046679	Bacteria	9513
362	Ga0495646_0000220	3300046680	Bacteria	28302
363	Ga0495613_0056371	3300046689	Bacteria	2885
364	Ga0495624_0000356	3300046690	Bacteria	36264
365	Ga0495670_0013367	3300046691	Bacteria	4038
366	Ga0495671_0014537	3300046692	Bacteria	4232
367	Ga0495671_0015462	3300046692	Bacteria	4087
368	Ga0495649_0009018	3300046694	Bacteria	5956
369	Ga0495589_0001586	3300046794	Bacteria	13040
370	Ga0495589_0003366	3300046794	Bacteria	8669
371	Ga0495600_0198568	3300046809	Bacteria	1288
372	Ga0495660_0002289	3300046810	Bacteria	12310
373	Ga0495581_0004683	3300047315	Bacteria	7902
374	Ga0495604_0001313	3300047317	Bacteria	20315
375	Ga0495604_0008974	3300047317	Bacteria	7906
376	Ga0495604_0025650	3300047317	Bacteria	4695
377	Ga0495674_0015050	3300047319	Bacteria	7239
378	Ga0495672_0000015	3300047320	Bacteria	502855
379	Ga0495672_0020348	3300047320	Bacteria	4352
380	Ga0495672_0052058	3300047320	Bacteria	2407
381	Ga0495680_0001377	3300047322	Bacteria	26282
382	Ga0495683_0000091	3300047323	Bacteria	91313
383	Ga0495683_0019614	3300047323	Bacteria	3490
384	Ga0495675_0007846	3300047444	Bacteria	6593
385	Ga0495679_000083	3300047446	Bacteria	87051
386	Ga0495679_002028	3300047446	Bacteria	10707
387	Ga0495673_0003738	3300047469	Bacteria	9882
388	Ga0495673_0010678	3300047469	Bacteria	4978
389	Ga0495681_0001059	3300047470	Bacteria	20990
390	Ga0495681_0008999	3300047470	Bacteria	6197
391	Ga0495681_0041952	3300047470	Bacteria	2218
392	Ga0495686_0000119	3300047472	Bacteria	165244
393	Ga0495593_0000220	3300047673	Bacteria	30381
394	Ga0495602_0001823	3300048088	Bacteria	21295
395	Ga0496100_0017350	3300048903	Bacteria	4248
396	Ga0496101_0001303	3300048904	Bacteria	14907
397	Ga0496101_0131453	3300048904	Bacteria	1901
398	Ga0496102_0001042	3300048905	Bacteria	25728
399	Ga0496102_0026784	3300048905	Bacteria	5146
400	Ga0496104_0012350	3300048907	Bacteria	7676
401	Ga0496105_0023875	3300048908	Bacteria	4965
402	Ga0496110_0118958	3300048913	Bacteria	2379
403	Ga0496116_0000143	3300048919	Bacteria	149129
404	Ga0496116_0000631	3300048919	Bacteria	46228
405	Ga0496117_0000009	3300048920	Bacteria	613759
406	Ga0496117_0000138	3300048920	Bacteria	159456
407	Ga0496117_0018566	3300048920	Bacteria	5752
408	Ga0496118_0000017	3300048921	Bacteria	549445
409	Ga0496118_0001574	3300048921	Bacteria	33838
410	Ga0496118_0008877	3300048921	Bacteria	10274
411	Ga0496118_0022653	3300048921	Bacteria	5482
412	Ga0496118_0049407	3300048921	Bacteria	3239
413	Ga0496119_0000012	3300048922	Bacteria	411917
414	Ga0496119_0000027	3300048922	Bacteria	249124
415	Ga0496119_0000773	3300048922	Bacteria	42871
416	Ga0496120_0000022	3300048923	Bacteria	249124
417	Ga0496120_0002549	3300048923	Bacteria	18169
418	Ga0496121_0000215	3300048924	Bacteria	127059
419	Ga0496121_0023412	3300048924	Bacteria	5949
420	Ga0496122_0000755	3300048925	Bacteria	62678
421	Ga0496123_0001304	3300048926	Bacteria	35436
422	Ga0496124_0008890	3300048927	Bacteria	10419
423	Ga0496124_0054585	3300048927	Bacteria	3381
424	Ga0496125_0027261	3300048928	Bacteria	5183
425	Ga0496126_0017152	3300048929	Bacteria	7221
426	Ga0496126_0067554	3300048929	Bacteria	3194
427	Ga0496126_0360485	3300048929	Bacteria	1187
428	Ga0495678_000020	3300049459	Bacteria	253654
429	Ga0495678_009432	3300049459	Bacteria	4829
430	Ga0495678_035117	3300049459	Bacteria	2058
431	Ga0495682_0000318	3300049460	Bacteria	35731
432	Ga0501032_0043052	3300049569	Bacteria	3060
433	Ga0501034_0008458	3300049571	Bacteria	10869
434	Ga0501034_0079004	3300049571	Bacteria	3293
435	Ga0501034_0129557	3300049571	Bacteria	2507
436	Ga0501034_0142212	3300049571	Bacteria	2378
437	Ga0501037_0139361	3300049573	Bacteria	1736
438	Ga0501043_0094929	3300049579	Bacteria	2344
439	Ga0501043_0303737	3300049579	Bacteria	1219
440	Ga0501046_0093306	3300049580	Bacteria	2314
441	Ga0501047_0278151	3300049581	Bacteria	1519
442	Ga0501048_0158236	3300049582	Bacteria	1603
443	nmdc:mga03683_1614_c1	3300050489	Bacteria	6754
444	nmdc:mga00v17_5650_c1	3300050491	Bacteria	3104
445	nmdc:mga00v17_93967_c1	3300050491	Bacteria	1886
446	nmdc:mga0yw44_80262_c1	3300050492	Bacteria	2043
447	nmdc:mga0k408_52779_c1	3300050493	Bacteria	2356
448	nmdc:mga06z11_18378_c1	3300050494	Bacteria	3192
449	nmdc:mga08y16_312898_c1	3300050511	Bacteria	1617
450	nmdc:mga08x19_27516_c1	3300050514	Bacteria	3556
451	nmdc:mga08x19_52928_c1	3300050514	Bacteria	2611
452	nmdc:mga0sz30_20827_c1	3300050516	Bacteria	2647
453	nmdc:mga0sz30_619_c1	3300050516	Bacteria	13165
454	Ga0500643_000207	3300053087	Bacteria	55425
455	Ga0500647_0026103	3300053091	Bacteria	2754
456	Ga0500641_0000688	3300053096	Bacteria	12215
457	Ga0500559_0001328	3300053136	Bacteria	14239
458	Ga0500616_0000459	3300053153	Bacteria	53223
459	Ga0500616_0006717	3300053153	Bacteria	7469
460	Ga0500616_0097727	3300053153	Bacteria	1441
461	Ga0500552_000382	3300053733	Bacteria	4113
462	Ga0466962_0024590	3300061719	Bacteria	2892
463	Ga0466962_0050767	3300061719	Bacteria	1983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025933	Ga0207706_10289009	Ga0207706_102890091	332
2	3300046809	Ga0495600_0198568	Ga0495600_0198568_210_1259	346
3	3300039437	Ga0436365_0257773	Ga0436365_0257773_81_1166	351
4	3300025924	Ga0207694_10000199	Ga0207694_1000019921	352
5	3300041404	Ga0439436_0000144	Ga0439436_0000144_14170_15381	357
6	3300049569	Ga0501032_0043052	Ga0501032_0043052_897_2108	357
7	3300049571	Ga0501034_0129557	Ga0501034_0129557_392_1603	357
8	3300049573	Ga0501037_0139361	Ga0501037_0139361_268_1479	357
9	3300039437	Ga0436365_0755393	Ga0436365_0755393_409_1506	364
10	3300003751	Ga0055538_1000008	Ga0055538_1000008325	365
11	3300003752	Ga0055539_1000012	Ga0055539_1000012325	365
12	3300003756	Ga0055533_1000015	Ga0055533_1000015325	365
13	3300003759	Ga0055525_1000017	Ga0055525_100001718	365
14	3300003841	Ga0055541_1000009	Ga0055541_1000009325	365
15	3300025224	Ga0209784_100005	Ga0209784_100005322	365
16	3300025225	Ga0209566_100005	Ga0209566_100005322	365
17	3300025226	Ga0209674_100009	Ga0209674_100009322	365
18	3300025230	Ga0209563_100012	Ga0209563_100012322	365
19	3300025253	Ga0209677_100006	Ga0209677_100006322	365
20	3300053153	Ga0500616_0006717	Ga0500616_0006717_4324_5637	367
21	iso_pu_bacteria	2599185299	2599926272	368
22	iso_pu_bacteria	2608642108	2608671785	368
23	iso_pu_bacteria	2648501693	2650897033	368
24	iso_pu_bacteria	2684622997	2686353927	368
25	iso_pu_bacteria	2808606414	2809125491	368
26	iso_pu_bacteria	2844528606	2844528899	368
27	iso_pu_bacteria	2847797336	2847799216	368
28	iso_pu_bacteria	2865014394	2865017946	368
29	iso_pu_bacteria	2881609920	2881612791	368
30	iso_pu_bacteria	2945951305	2945952463	368
31	iso_pu_bacteria	2984494565	2984497236	368
32	iso_pu_bacteria	2990261002	2990261188	368
33	3300003856	Ga0058692_1000202	Ga0058692_10002025	370
34	3300003856	Ga0058692_1001424	Ga0058692_10014247	370
35	3300027312	Ga0209371_1000005	Ga0209371_1000005674	370
36	3300027312	Ga0209371_1000153	Ga0209371_100015370	370
37	3300027312	Ga0209371_1000452	Ga0209371_10004528	370
38	3300030500	Ga0268256_1000006	Ga0268256_1000006383	370
39	3300030500	Ga0268256_1000598	Ga0268256_100059821	370
40	iso_pu_bacteria	2511231025	2511382407	370
41	iso_pu_bacteria	2847085930	2847086938	370
42	3300003856	Ga0058692_1000098	Ga0058692_100009814	371
43	3300005347	Ga0070668_100014373	Ga0070668_1000143734	371
44	3300005457	Ga0070662_100023500	Ga0070662_1000235002	371
45	3300009011	Ga0105251_10001827	Ga0105251_1000182715	371
46	3300009036	Ga0105244_10028520	Ga0105244_100285202	371
47	3300013100	Ga0157373_10009596	Ga0157373_100095965	371
48	3300013102	Ga0157371_10176889	Ga0157371_101768892	371
49	3300013105	Ga0157369_10004707	Ga0157369_1000470710	371
50	3300013306	Ga0163162_10260013	Ga0163162_102600132	371
51	3300013307	Ga0157372_10024223	Ga0157372_100242235	371
52	3300013307	Ga0157372_10069853	Ga0157372_100698534	371
53	3300015261	Ga0182006_1002600	Ga0182006_10026005	371
54	3300017792	Ga0163161_10020929	Ga0163161_100209292	371
55	3300025233	Ga0209437_100212	Ga0209437_10021247	371
56	3300025711	Ga0207696_1003155	Ga0207696_10031554	371
57	3300025728	Ga0207655_1001590	Ga0207655_100159014	371
58	3300025728	Ga0207655_1003460	Ga0207655_10034605	371
59	3300025735	Ga0207713_1000001	Ga0207713_10000011596	371
60	3300025735	Ga0207713_1027199	Ga0207713_10271993	371
61	3300027312	Ga0209371_1000102	Ga0209371_100010221	371
62	3300027312	Ga0209371_1000550	Ga0209371_100055015	371
63	3300027312	Ga0209371_1001067	Ga0209371_10010672	371
64	3300027312	Ga0209371_1001640	Ga0209371_10016407	371
65	3300030500	Ga0268256_1000035	Ga0268256_1000035213	371
66	3300030500	Ga0268256_1000421	Ga0268256_100042122	371
67	3300030500	Ga0268256_1006044	Ga0268256_10060443	371
68	3300030500	Ga0268256_1013617	Ga0268256_10136172	371
69	3300037312	Ga0395899_0000241	Ga0395899_0000241_12553_13737	371
70	3300037466	Ga0395898_0000016	Ga0395898_0000016_375348_376532	371
71	3300041411	Ga0439466_0000001	Ga0439466_0000001_97393_98526	371
72	3300042010	Ga0439452_011885	Ga0439452_011885_630_1763	371
73	3300042016	Ga0439463_007582	Ga0439463_007582_389_1522	371
74	3300042146	Ga0450907_000167	Ga0450907_000167_2348_3481	371
75	3300046492	Ga0495585_0010905	Ga0495585_0010905_1336_2469	371
76	3300046500	Ga0495596_0001570	Ga0495596_0001570_1312_2445	371
77	3300047320	Ga0495672_0000015	Ga0495672_0000015_362594_363727	371
78	3300048903	Ga0496100_0017350	Ga0496100_0017350_449_1582	371
79	3300048905	Ga0496102_0001042	Ga0496102_0001042_15330_16463	371
80	3300048905	Ga0496102_0026784	Ga0496102_0026784_92_1225	371
81	3300048908	Ga0496105_0023875	Ga0496105_0023875_1625_2758	371
82	3300048920	Ga0496117_0000009	Ga0496117_0000009_193249_194382	371
83	3300048920	Ga0496117_0018566	Ga0496117_0018566_2307_3440	371
84	3300048921	Ga0496118_0000017	Ga0496118_0000017_128935_130068	371
85	3300048921	Ga0496118_0008877	Ga0496118_0008877_2313_3446	371
86	3300048922	Ga0496119_0000027	Ga0496119_0000027_87622_88755	371
87	3300048922	Ga0496119_0000773	Ga0496119_0000773_19298_20431	371
88	3300048923	Ga0496120_0000022	Ga0496120_0000022_87622_88755	371
89	3300048923	Ga0496120_0002549	Ga0496120_0002549_16853_17986	371
90	3300048924	Ga0496121_0000215	Ga0496121_0000215_2789_3922	371
91	3300048925	Ga0496122_0000755	Ga0496122_0000755_49274_50407	371
92	3300048926	Ga0496123_0001304	Ga0496123_0001304_14159_15292	371
93	3300048927	Ga0496124_0008890	Ga0496124_0008890_7580_8713	371
94	3300048928	Ga0496125_0027261	Ga0496125_0027261_3548_4681	371
95	3300048929	Ga0496126_0360485	Ga0496126_0360485_49_1176	371
96	3300049459	Ga0495678_035117	Ga0495678_035117_27_1160	371
97	3300050491	nmdc:mga00v17_93967_c1	nmdc:mga00v17_93967_c1_705_1838	371
98	3300009036	Ga0105244_10008807	Ga0105244_100088073	372
99	3300011119	Ga0105246_10003091	Ga0105246_100030912	372
100	3300046452	Ga0495617_009972	Ga0495617_009972_390_1529	372
101	3300046458	Ga0495591_000059	Ga0495591_000059_64076_65215	372
102	3300046530	Ga0495654_0000009	Ga0495654_0000009_25436_26575	372
103	3300048904	Ga0496101_0131453	Ga0496101_0131453_232_1371	372
104	3300048922	Ga0496119_0000012	Ga0496119_0000012_8049_9182	372
105	3300048927	Ga0496124_0054585	Ga0496124_0054585_806_1945	372
106	3300048929	Ga0496126_0017152	Ga0496126_0017152_3940_5079	372
107	3300032004	Ga0307414_10180710	Ga0307414_101807101	373
108	3300003316	rootH1_10062809	rootH1_100628092	374
109	3300025913	Ga0207695_10051571	Ga0207695_100515713	374
110	3300036401	Ga0373937_0388129	Ga0373937_0388129_13_1167	374
111	3300044842	Ga0466957_0104613	Ga0466957_0104613_41_1189	374
112	3300046678	Ga0495599_0011912	Ga0495599_0011912_2336_3460	374
113	3300046679	Ga0495623_0004181	Ga0495623_0004181_176_1300	374
114	3300047317	Ga0495604_0001313	Ga0495604_0001313_12513_13637	374
115	3300048088	Ga0495602_0001823	Ga0495602_0001823_897_2021	374
116	3300048913	Ga0496110_0118958	Ga0496110_0118958_378_1547	374
117	3300050493	nmdc:mga0k408_52779_c1	nmdc:mga0k408_52779_c1_18_1172	374
118	3300053153	Ga0500616_0097727	Ga0500616_0097727_136_1317	374
119	3300025917	Ga0207660_10114095	Ga0207660_101140952	375
120	3300049571	Ga0501034_0142212	Ga0501034_0142212_680_1846	375
121	iso_pu_bacteria	8002285264	8002286502	375
122	3300013104	Ga0157370_10000260	Ga0157370_1000026024	376
123	3300028380	Ga0268265_10305787	Ga0268265_103057872	376
124	3300044684	Ga0466966_0018014	Ga0466966_0018014_2352_3536	376
125	3300048919	Ga0496116_0000631	Ga0496116_0000631_21267_22424	376
126	3300048920	Ga0496117_0000138	Ga0496117_0000138_137360_138517	376
127	3300048921	Ga0496118_0001574	Ga0496118_0001574_8473_9630	376
128	iso_pu_bacteria	2738543024	2739306198	376
129	3300025949	Ga0207667_10009007	Ga0207667_100090072	377
130	iso_pu_bacteria	2512047030	2512352835	378
131	3300005563	Ga0068855_100000904	Ga0068855_10000090428	379
132	3300025728	Ga0207655_1004491	Ga0207655_10044913	379
133	3300025949	Ga0207667_10000028	Ga0207667_1000002847	379
134	3300041407	Ga0439447_000922	Ga0439447_000922_857_2023	379
135	3300046524	Ga0495648_0001641	Ga0495648_0001641_8989_10155	379
136	3300009036	Ga0105244_10000333	Ga0105244_1000033337	380
137	3300042010	Ga0439452_000001	Ga0439452_000001_1469946_1471127	380
138	iso_pu_bacteria	2599185188	2599501537	380
139	iso_pu_bacteria	2599185300	2599931544	380
140	3300025228	Ga0209672_101665	Ga0209672_1016652	381
141	3300037418	Ga0395900_0135792	Ga0395900_0135792_605_1798	381
142	3300037466	Ga0395898_0153602	Ga0395898_0153602_185_1378	381
143	iso_pu_bacteria	2739367655	2739611927	381
144	iso_pu_bacteria	2881927736	2881929680	381
145	3300005327	Ga0070658_10003024	Ga0070658_1000302411	382
146	3300005563	Ga0068855_100000838	Ga0068855_1000008385	382
147	3300009545	Ga0105237_10033998	Ga0105237_100339982	382
148	3300013104	Ga0157370_10003456	Ga0157370_1000345614	382
149	3300025909	Ga0207705_10004932	Ga0207705_100049327	382
150	3300025914	Ga0207671_10066883	Ga0207671_100668832	382
151	3300025949	Ga0207667_10007165	Ga0207667_1000716510	382
152	3300028794	Ga0307515_10001984	Ga0307515_100019847	382
153	3300046462	Ga0495651_0066850	Ga0495651_0066850_1576_2724	382
154	3300046543	Ga0495645_0151127	Ga0495645_0151127_78_1292	382
155	3300048919	Ga0496116_0000143	Ga0496116_0000143_21210_22397	382
156	iso_pu_bacteria	2842333319	2842333927	382
157	iso_pu_bacteria	2889790730	2889790929	382
158	iso_pu_bacteria	2889914905	2889918362	382
159	iso_pu_bacteria	2908446538	2908447627	382
160	3300037418	Ga0395900_0008101	Ga0395900_0008101_2051_3235	383
161	3300038443	Ga0395901_0000146	Ga0395901_0000146_8540_9724	383
162	3300046520	Ga0495637_0025327	Ga0495637_0025327_877_2070	383
163	3300047470	Ga0495681_0041952	Ga0495681_0041952_556_1749	383
164	3300053087	Ga0500643_000207	Ga0500643_000207_19151_20344	383
165	3300053136	Ga0500559_0001328	Ga0500559_0001328_6231_7424	383
166	iso_pu_bacteria	2511231015	2511318519	383
167	iso_pu_bacteria	2511231017	2511331795	383
168	iso_pu_bacteria	2521172590	2521559796	383
169	iso_pu_bacteria	2919046199	2919047515	383
170	3300005577	Ga0068857_100219106	Ga0068857_1002191062	384
171	3300037471	Ga0395905_0000035	Ga0395905_0000035_269911_271065	384
172	3300044684	Ga0466966_0000009	Ga0466966_0000009_62138_63292	384
173	3300045836	Ga0466958_0024318	Ga0466958_0024318_791_1945	384
174	3300046459	Ga0495629_0145260	Ga0495629_0145260_409_1572	384
175	3300047472	Ga0495686_0000119	Ga0495686_0000119_134826_136022	384
176	3300048921	Ga0496118_0022653	Ga0496118_0022653_2085_3302	384
177	3300061719	Ga0466962_0050767	Ga0466962_0050767_466_1620	384
178	3300039453	Ga0436362_1302861	Ga0436362_1302861_64_1233	385
179	3300046507	Ga0495606_0000112	Ga0495606_0000112_47940_49115	385
180	3300049579	Ga0501043_0094929	Ga0501043_0094929_802_1992	385
181	3300049581	Ga0501047_0278151	Ga0501047_0278151_300_1490	385
182	3300005327	Ga0070658_10039170	Ga0070658_100391702	386
183	3300005329	Ga0070683_100027919	Ga0070683_1000279194	386
184	3300005336	Ga0070680_100017398	Ga0070680_1000173982	386
185	3300005341	Ga0070691_10001406	Ga0070691_1000140611	386
186	3300005354	Ga0070675_100251586	Ga0070675_1002515862	386
187	3300005434	Ga0070709_10037203	Ga0070709_100372033	386
188	3300005458	Ga0070681_10000320	Ga0070681_100003207	386
189	3300005471	Ga0070698_100001190	Ga0070698_10000119029	386
190	3300005530	Ga0070679_100004504	Ga0070679_10000450410	386
191	3300005536	Ga0070697_100025217	Ga0070697_1000252174	386
192	3300005548	Ga0070665_100013946	Ga0070665_1000139462	386
193	3300005548	Ga0070665_100058939	Ga0070665_1000589392	386
194	3300005564	Ga0070664_100060345	Ga0070664_1000603454	386
195	3300005614	Ga0068856_100046845	Ga0068856_1000468454	386
196	3300005614	Ga0068856_100100644	Ga0068856_1001006442	386
197	3300005616	Ga0068852_100092879	Ga0068852_1000928792	386
198	3300005937	Ga0081455_10000116	Ga0081455_1000011619	386
199	3300005937	Ga0081455_10008619	Ga0081455_100086197	386
200	3300005937	Ga0081455_10024560	Ga0081455_100245606	386
201	3300005985	Ga0081539_10003020	Ga0081539_1000302018	386
202	3300005985	Ga0081539_10016756	Ga0081539_100167561	386
203	3300006038	Ga0075365_10059001	Ga0075365_100590012	386
204	3300006038	Ga0075365_10082610	Ga0075365_100826102	386
205	3300006058	Ga0075432_10000877	Ga0075432_100008773	386
206	3300006175	Ga0070712_100108276	Ga0070712_1001082762	386
207	3300006177	Ga0075362_10038336	Ga0075362_100383362	386
208	3300006177	Ga0075362_10078907	Ga0075362_100789072	386
209	3300006178	Ga0075367_10004904	Ga0075367_100049042	386
210	3300006186	Ga0075369_10001815	Ga0075369_100018155	386
211	3300006186	Ga0075369_10066329	Ga0075369_100663292	386
212	3300006914	Ga0075436_100018894	Ga0075436_1000188944	386
213	3300006914	Ga0075436_100054452	Ga0075436_1000544523	386
214	3300006946	Ga0079104_1000068	Ga0079104_100006858	386
215	3300009093	Ga0105240_10004321	Ga0105240_100043214	386
216	3300009094	Ga0111539_10324922	Ga0111539_103249222	386
217	3300013104	Ga0157370_10103259	Ga0157370_101032592	386
218	3300013105	Ga0157369_10212156	Ga0157369_102121562	386
219	3300013307	Ga0157372_10081515	Ga0157372_100815153	386
220	3300021441	Ga0213871_10000826	Ga0213871_100008263	386
221	3300025728	Ga0207655_1028683	Ga0207655_10286832	386
222	3300025904	Ga0207647_10039918	Ga0207647_100399182	386
223	3300025906	Ga0207699_10038378	Ga0207699_100383782	386
224	3300025909	Ga0207705_10006064	Ga0207705_100060646	386
225	3300025912	Ga0207707_10052094	Ga0207707_100520943	386
226	3300025914	Ga0207671_10057071	Ga0207671_100570713	386
227	3300025915	Ga0207693_10140864	Ga0207693_101408642	386
228	3300025917	Ga0207660_10054571	Ga0207660_100545712	386
229	3300025921	Ga0207652_10032219	Ga0207652_100322194	386
230	3300025932	Ga0207690_10176187	Ga0207690_101761872	386
231	3300025949	Ga0207667_10112807	Ga0207667_101128072	386
232	3300026023	Ga0207677_10201649	Ga0207677_102016492	386
233	3300026078	Ga0207702_10108045	Ga0207702_101080451	386
234	3300026142	Ga0207698_10128752	Ga0207698_101287522	386
235	3300027111	Ga0209281_1000168	Ga0209281_1000168102	386
236	3300027907	Ga0207428_10019650	Ga0207428_100196503	386
237	3300037312	Ga0395899_0010044	Ga0395899_0010044_4597_5859	386
238	3300037312	Ga0395899_0024995	Ga0395899_0024995_997_2190	386
239	3300037418	Ga0395900_0132441	Ga0395900_0132441_1186_2379	386
240	3300037466	Ga0395898_0140563	Ga0395898_0140563_739_1932	386
241	3300038443	Ga0395901_0001472	Ga0395901_0001472_22785_24047	386
242	3300038443	Ga0395901_0025664	Ga0395901_0025664_4497_5690	386
243	3300038443	Ga0395901_0037337	Ga0395901_0037337_3542_4735	386
244	3300039437	Ga0436365_0053006	Ga0436365_0053006_11956_13149	386
245	3300039438	Ga0436360_0913204	Ga0436360_0913204_697_1890	386
246	3300041407	Ga0439447_004510	Ga0439447_004510_2059_3234	386
247	3300042009	Ga0439451_004722	Ga0439451_004722_1290_2465	386
248	3300044694	Ga0466963_0066976	Ga0466963_0066976_575_1768	386
249	3300045976	Ga0466967_0319675	Ga0466967_0319675_221_1414	386
250	3300046453	Ga0495627_006004	Ga0495627_006004_3429_4604	386
251	3300046455	Ga0495603_0081097	Ga0495603_0081097_525_1700	386
252	3300046458	Ga0495591_003010	Ga0495591_003010_1829_3004	386
253	3300046471	Ga0495650_0007178	Ga0495650_0007178_2072_3247	386
254	3300046473	Ga0495582_0006408	Ga0495582_0006408_3500_4675	386
255	3300046474	Ga0495605_0000036	Ga0495605_0000036_80890_82065	386
256	3300046474	Ga0495605_0061860	Ga0495605_0061860_462_1637	386
257	3300046475	Ga0495639_0004600	Ga0495639_0004600_3464_4639	386
258	3300046499	Ga0495594_0006259	Ga0495594_0006259_2474_3649	386
259	3300046501	Ga0495607_0022885	Ga0495607_0022885_1523_2701	386
260	3300046501	Ga0495607_0035646	Ga0495607_0035646_1144_2319	386
261	3300046506	Ga0495583_0000028	Ga0495583_0000028_94139_95314	386
262	3300046506	Ga0495583_0003370	Ga0495583_0003370_3977_5152	386
263	3300046506	Ga0495583_0003876	Ga0495583_0003876_6010_7188	386
264	3300046512	Ga0495610_0002063	Ga0495610_0002063_841_2016	386
265	3300046515	Ga0495620_0000073	Ga0495620_0000073_31611_32786	386
266	3300046516	Ga0495628_0235451	Ga0495628_0235451_140_1315	386
267	3300046517	Ga0495630_0003683	Ga0495630_0003683_7698_8873	386
268	3300046517	Ga0495630_0153010	Ga0495630_0153010_557_1732	386
269	3300046518	Ga0495631_0006361	Ga0495631_0006361_1478_2653	386
270	3300046518	Ga0495631_0009676	Ga0495631_0009676_2142_3317	386
271	3300046519	Ga0495632_0016334	Ga0495632_0016334_979_2154	386
272	3300046520	Ga0495637_0049693	Ga0495637_0049693_529_1704	386
273	3300046522	Ga0495643_0014101	Ga0495643_0014101_1939_3114	386
274	3300046524	Ga0495648_0000392	Ga0495648_0000392_5456_6631	386
275	3300046524	Ga0495648_0000560	Ga0495648_0000560_15697_16872	386
276	3300046524	Ga0495648_0006236	Ga0495648_0006236_2610_3785	386
277	3300046526	Ga0495666_0010709	Ga0495666_0010709_44_1219	386
278	3300046530	Ga0495654_0000246	Ga0495654_0000246_13088_14263	386
279	3300046535	Ga0495586_0009005	Ga0495586_0009005_3926_5101	386
280	3300046536	Ga0495587_0006977	Ga0495587_0006977_2610_3785	386
281	3300046538	Ga0495609_0000115	Ga0495609_0000115_80891_82066	386
282	3300046542	Ga0495597_0000635	Ga0495597_0000635_8195_9370	386
283	3300046557	Ga0495622_0014787	Ga0495622_0014787_1000_2175	386
284	3300046557	Ga0495622_0018819	Ga0495622_0018819_737_1912	386
285	3300046558	Ga0495633_0000028	Ga0495633_0000028_151700_152875	386
286	3300046616	Ga0495668_0060216	Ga0495668_0060216_851_2026	386
287	3300046648	Ga0495611_0006438	Ga0495611_0006438_1596_2771	386
288	3300046648	Ga0495611_0014727	Ga0495611_0014727_1594_2769	386
289	3300046665	Ga0495661_0000211	Ga0495661_0000211_15476_16651	386
290	3300046665	Ga0495661_0029530	Ga0495661_0029530_508_1683	386
291	3300046689	Ga0495613_0056371	Ga0495613_0056371_998_2173	386
292	3300046691	Ga0495670_0013367	Ga0495670_0013367_2044_3219	386
293	3300046692	Ga0495671_0014537	Ga0495671_0014537_713_1888	386
294	3300046692	Ga0495671_0015462	Ga0495671_0015462_283_1458	386
295	3300046794	Ga0495589_0003366	Ga0495589_0003366_4789_5964	386
296	3300046810	Ga0495660_0002289	Ga0495660_0002289_9403_10578	386
297	3300047315	Ga0495581_0004683	Ga0495581_0004683_2956_4131	386
298	3300047317	Ga0495604_0008974	Ga0495604_0008974_4366_5541	386
299	3300047320	Ga0495672_0020348	Ga0495672_0020348_1065_2240	386
300	3300047320	Ga0495672_0052058	Ga0495672_0052058_580_1755	386
301	3300047323	Ga0495683_0000091	Ga0495683_0000091_39494_40669	386
302	3300047323	Ga0495683_0019614	Ga0495683_0019614_1718_2893	386
303	3300047444	Ga0495675_0007846	Ga0495675_0007846_2927_4102	386
304	3300047446	Ga0495679_000083	Ga0495679_000083_35526_36701	386
305	3300047469	Ga0495673_0003738	Ga0495673_0003738_6243_7418	386
306	3300047469	Ga0495673_0010678	Ga0495673_0010678_1742_2917	386
307	3300047470	Ga0495681_0001059	Ga0495681_0001059_6334_7509	386
308	3300047470	Ga0495681_0008999	Ga0495681_0008999_2841_4016	386
309	3300048929	Ga0496126_0067554	Ga0496126_0067554_363_1556	386
310	3300049459	Ga0495678_000020	Ga0495678_000020_92242_93417	386
311	3300049459	Ga0495678_009432	Ga0495678_009432_1885_3060	386
312	3300049460	Ga0495682_0000318	Ga0495682_0000318_29818_30993	386
313	3300049571	Ga0501034_0008458	Ga0501034_0008458_2638_3831	386
314	3300049571	Ga0501034_0079004	Ga0501034_0079004_1069_2262	386
315	3300049579	Ga0501043_0303737	Ga0501043_0303737_14_1207	386
316	3300049580	Ga0501046_0093306	Ga0501046_0093306_934_2127	386
317	3300049582	Ga0501048_0158236	Ga0501048_0158236_103_1296	386
318	3300050489	nmdc:mga03683_1614_c1	nmdc:mga03683_1614_c1_735_1928	386
319	3300050491	nmdc:mga00v17_5650_c1	nmdc:mga00v17_5650_c1_1096_2271	386
320	3300050492	nmdc:mga0yw44_80262_c1	nmdc:mga0yw44_80262_c1_754_1947	386
321	3300050494	nmdc:mga06z11_18378_c1	nmdc:mga06z11_18378_c1_1636_2829	386
322	3300050511	nmdc:mga08y16_312898_c1	nmdc:mga08y16_312898_c1_200_1393	386
323	3300050514	nmdc:mga08x19_27516_c1	nmdc:mga08x19_27516_c1_219_1394	386
324	3300050514	nmdc:mga08x19_52928_c1	nmdc:mga08x19_52928_c1_908_2083	386
325	3300050516	nmdc:mga0sz30_20827_c1	nmdc:mga0sz30_20827_c1_86_1279	386
326	3300050516	nmdc:mga0sz30_619_c1	nmdc:mga0sz30_619_c1_7998_9191	386
327	3300053091	Ga0500647_0026103	Ga0500647_0026103_289_1482	386
328	3300053096	Ga0500641_0000688	Ga0500641_0000688_4730_5923	386
329	3300053153	Ga0500616_0000459	Ga0500616_0000459_38817_40010	386
330	3300053733	Ga0500552_000382	Ga0500552_000382_221_1414	386
331	iso_pu_bacteria	2599185240	2599746255	386
332	iso_pu_bacteria	2599185355	2600208350	386
333	iso_pu_bacteria	2675903129	2676744034	386
334	3300003751	Ga0055538_1000084	Ga0055538_100008462	387
335	3300021388	Ga0213875_10004095	Ga0213875_100040956	387
336	3300031995	Ga0307409_100172839	Ga0307409_1001728392	387
337	3300037853	Ga0436364_0685758	Ga0436364_0685758_1125_2297	387
338	3300037853	Ga0436364_0982830	Ga0436364_0982830_13739_14911	387
339	3300039438	Ga0436360_0157941	Ga0436360_0157941_1061_2239	387
340	3300039438	Ga0436360_0530048	Ga0436360_0530048_2621_3799	387
341	iso_pu_bacteria	2996310559	2996316777	387
342	3300021361	Ga0213872_10002340	Ga0213872_100023403	388
343	3300046516	Ga0495628_0003075	Ga0495628_0003075_4190_5380	388
344	3300046517	Ga0495630_0022455	Ga0495630_0022455_759_1949	388
345	3300046529	Ga0495652_0005427	Ga0495652_0005427_8351_9541	388
346	3300046531	Ga0495665_0000067	Ga0495665_0000067_34830_36020	388
347	3300046536	Ga0495587_0045976	Ga0495587_0045976_792_1982	388
348	3300046663	Ga0495635_0043006	Ga0495635_0043006_926_2116	388
349	3300046680	Ga0495646_0000220	Ga0495646_0000220_24885_26075	388
350	3300046690	Ga0495624_0000356	Ga0495624_0000356_31630_32820	388
351	3300047317	Ga0495604_0025650	Ga0495604_0025650_454_1644	388
352	3300047319	Ga0495674_0015050	Ga0495674_0015050_3466_4656	388
353	3300047322	Ga0495680_0001377	Ga0495680_0001377_2775_3965	388
354	3300047673	Ga0495593_0000220	Ga0495593_0000220_2424_3614	388
355	3300048904	Ga0496101_0001303	Ga0496101_0001303_1030_2220	388
356	3300048907	Ga0496104_0012350	Ga0496104_0012350_6162_7352	388
357	3300013104	Ga0157370_10034702	Ga0157370_100347024	389
358	3300013105	Ga0157369_10008342	Ga0157369_100083428	389
359	3300046794	Ga0495589_0001586	Ga0495589_0001586_5459_6688	389
360	3300047446	Ga0495679_002028	Ga0495679_002028_3455_4684	389
361	iso_pu_bacteria	2857357740	2857365044	389
362	iso_pu_bacteria	2885270888	2885279509	389
363	3300001989	JGI24739J22299_10031577	JGI24739J22299_100315771	390
364	3300002705	JGI25156J39149_1000205	JGI25156J39149_100020533	390
365	3300002738	JGI25154J39366_1000101	JGI25154J39366_100010168	390
366	3300003214	JGI25165J46597_1001595	JGI25165J46597_10015952	390
367	3300003214	JGI25165J46597_1005351	JGI25165J46597_10053512	390
368	3300003320	rootH2_10047895	rootH2_100478955	390
369	3300003323	rootH1_10083155	rootH1_100831559	390
370	3300003756	Ga0055533_1000095	Ga0055533_100009567	390
371	3300003756	Ga0055533_1008087	Ga0055533_10080871	390
372	3300003758	Ga0055532_1000010	Ga0055532_1000010113	390
373	3300003758	Ga0055532_1000264	Ga0055532_100026423	390
374	3300003758	Ga0055532_1000351	Ga0055532_10003514	390
375	3300003758	Ga0055532_1000512	Ga0055532_10005126	390
376	3300003760	Ga0055527_1000008	Ga0055527_1000008113	390
377	3300003760	Ga0055527_1000268	Ga0055527_100026821	390
378	3300003761	Ga0055535_1000007	Ga0055535_1000007113	390
379	3300003761	Ga0055535_1000157	Ga0055535_100015765	390
380	3300003761	Ga0055535_1000563	Ga0055535_100056321	390
381	3300003762	Ga0055542_1000011	Ga0055542_1000011113	390
382	3300003762	Ga0055542_1000204	Ga0055542_10002049	390
383	3300003762	Ga0055542_1002102	Ga0055542_10021022	390
384	3300003763	Ga0055529_1000009	Ga0055529_1000009113	390
385	3300003763	Ga0055529_1000221	Ga0055529_100022110	390
386	3300003790	Ga0055528_1001385	Ga0055528_10013854	390
387	3300005339	Ga0070660_100000457	Ga0070660_1000004578	390
388	3300005366	Ga0070659_100000108	Ga0070659_1000001088	390
389	3300005563	Ga0068855_100058519	Ga0068855_1000585193	390
390	3300005563	Ga0068855_100122262	Ga0068855_1001222622	390
391	3300005564	Ga0070664_100065890	Ga0070664_1000658902	390
392	3300005578	Ga0068854_100131749	Ga0068854_1001317492	390
393	3300005616	Ga0068852_100017751	Ga0068852_1000177513	390
394	3300009093	Ga0105240_10000586	Ga0105240_100005868	390
395	3300009093	Ga0105240_10096407	Ga0105240_100964072	390
396	3300009093	Ga0105240_10106278	Ga0105240_101062783	390
397	3300009093	Ga0105240_10109642	Ga0105240_101096424	390
398	3300009545	Ga0105237_10015581	Ga0105237_100155815	390
399	3300009545	Ga0105237_10029105	Ga0105237_100291053	390
400	3300009545	Ga0105237_10077543	Ga0105237_100775432	390
401	3300009545	Ga0105237_10436713	Ga0105237_104367131	390
402	3300009551	Ga0105238_10000111	Ga0105238_1000011150	390
403	3300010375	Ga0105239_10046397	Ga0105239_100463974	390
404	3300013100	Ga0157373_10006300	Ga0157373_100063003	390
405	3300013102	Ga0157371_10022553	Ga0157371_100225535	390
406	3300013104	Ga0157370_10008025	Ga0157370_100080254	390
407	3300013105	Ga0157369_10000214	Ga0157369_1000021418	390
408	3300013105	Ga0157369_10091243	Ga0157369_100912432	390
409	3300013296	Ga0157374_10002568	Ga0157374_100025688	390
410	3300013307	Ga0157372_10084477	Ga0157372_100844772	390
411	3300015261	Ga0182006_1006021	Ga0182006_10060216	390
412	3300015261	Ga0182006_1008796	Ga0182006_10087962	390
413	3300015262	Ga0182007_10001588	Ga0182007_100015886	390
414	3300015265	Ga0182005_1021802	Ga0182005_10218022	390
415	3300025206	Ga0209435_100069	Ga0209435_1000693	390
416	3300025224	Ga0209784_100066	Ga0209784_10006642	390
417	3300025224	Ga0209784_100066	Ga0209784_10006656	390
418	3300025225	Ga0209566_100125	Ga0209566_10012541	390
419	3300025225	Ga0209566_100125	Ga0209566_10012554	390
420	3300025225	Ga0209566_100510	Ga0209566_1005109	390
421	3300025226	Ga0209674_100022	Ga0209674_100022260	390
422	3300025226	Ga0209674_100344	Ga0209674_10034412	390
423	3300025226	Ga0209674_100497	Ga0209674_10049714	390
424	3300025228	Ga0209672_100001	Ga0209672_100001253	390
425	3300025228	Ga0209672_100040	Ga0209672_100040119	390
426	3300025228	Ga0209672_100044	Ga0209672_10004465	390
427	3300025228	Ga0209672_100120	Ga0209672_10012065	390
428	3300025229	Ga0209147_100001	Ga0209147_100001253	390
429	3300025229	Ga0209147_100037	Ga0209147_100037266	390
430	3300025229	Ga0209147_100039	Ga0209147_10003965	390
431	3300025229	Ga0209147_100048	Ga0209147_100048119	390
432	3300025230	Ga0209563_100370	Ga0209563_1003709	390
433	3300025231	Ga0207427_100612	Ga0207427_1006123	390
434	3300025242	Ga0209258_100001	Ga0209258_100001253	390
435	3300025242	Ga0209258_100062	Ga0209258_10006265	390
436	3300025242	Ga0209258_100070	Ga0209258_100070119	390
437	3300025246	Ga0209646_1000108	Ga0209646_100010820	390
438	3300025250	Ga0209026_1000508	Ga0209026_10005084	390
439	3300025254	Ga0209148_1000003	Ga0209148_1000003253	390
440	3300025254	Ga0209148_1000075	Ga0209148_100007565	390
441	3300025254	Ga0209148_1000691	Ga0209148_100069111	390
442	3300025256	Ga0209759_1000002	Ga0209759_1000002238	390
443	3300025256	Ga0209759_1000101	Ga0209759_10001015	390
444	3300025256	Ga0209759_1000173	Ga0209759_100017389	390
445	3300025256	Ga0209759_1000380	Ga0209759_100038013	390
446	3300025256	Ga0209759_1007207	Ga0209759_10072072	390
447	3300025256	Ga0209759_1015973	Ga0209759_10159732	390
448	3300025261	Ga0209233_1000061	Ga0209233_1000061227	390
449	3300025261	Ga0209233_1011188	Ga0209233_10111883	390
450	3300025272	Ga0209455_1000001	Ga0209455_1000001253	390
451	3300025272	Ga0209455_1000067	Ga0209455_100006765	390
452	3300025272	Ga0209455_1000384	Ga0209455_100038417	390
453	3300025273	Ga0209673_1000044	Ga0209673_1000044164	390
454	3300025904	Ga0207647_10003607	Ga0207647_100036075	390
455	3300025909	Ga0207705_10008789	Ga0207705_100087894	390
456	3300025913	Ga0207695_10000661	Ga0207695_1000066142	390
457	3300025913	Ga0207695_10015469	Ga0207695_100154697	390
458	3300025913	Ga0207695_10084901	Ga0207695_100849013	390
459	3300025913	Ga0207695_10088117	Ga0207695_100881173	390
460	3300025914	Ga0207671_10022495	Ga0207671_100224953	390
461	3300025914	Ga0207671_10083459	Ga0207671_100834592	390
462	3300025914	Ga0207671_10098429	Ga0207671_100984291	390
463	3300025919	Ga0207657_10000110	Ga0207657_1000011053	390
464	3300025919	Ga0207657_10004191	Ga0207657_100041915	390
465	3300025932	Ga0207690_10000016	Ga0207690_10000016202	390
466	3300025949	Ga0207667_10015099	Ga0207667_100150992	390
467	3300025949	Ga0207667_10045640	Ga0207667_100456402	390
468	3300026067	Ga0207678_10000574	Ga0207678_1000057415	390
469	3300026142	Ga0207698_10051787	Ga0207698_100517872	390
470	3300027312	Ga0209371_1000782	Ga0209371_100078225	390
471	3300030500	Ga0268256_1000658	Ga0268256_10006582	390
472	3300037312	Ga0395899_0059956	Ga0395899_0059956_1430_2614	390
473	3300037418	Ga0395900_0000074	Ga0395900_0000074_176368_177567	390
474	3300037418	Ga0395900_0014361	Ga0395900_0014361_6525_7709	390
475	3300037418	Ga0395900_0037628	Ga0395900_0037628_3333_4517	390
476	3300037466	Ga0395898_0267911	Ga0395898_0267911_413_1600	390
477	3300038443	Ga0395901_0000105	Ga0395901_0000105_19077_20306	390
478	3300038443	Ga0395901_0000879	Ga0395901_0000879_19240_20424	390
479	3300038443	Ga0395901_0006255	Ga0395901_0006255_6828_8012	390
480	3300044656	Ga0466969_0001340	Ga0466969_0001340_10890_12179	390
481	3300044658	Ga0466972_0088792	Ga0466972_0088792_178_1422	390
482	3300044683	Ga0466965_0004474	Ga0466965_0004474_4668_5957	390
483	3300044683	Ga0466965_0013219	Ga0466965_0013219_1638_2846	390
484	3300044693	Ga0466961_0000825	Ga0466961_0000825_2441_3625	390
485	3300044693	Ga0466961_0022957	Ga0466961_0022957_748_1935	390
486	3300044694	Ga0466963_0007149	Ga0466963_0007149_983_2272	390
487	3300044719	Ga0466971_0019947	Ga0466971_0019947_1143_2432	390
488	3300044719	Ga0466971_0023410	Ga0466971_0023410_93_1277	390
489	3300044842	Ga0466957_0000908	Ga0466957_0000908_10462_11751	390
490	3300044842	Ga0466957_0004620	Ga0466957_0004620_5567_6835	390
491	3300044842	Ga0466957_0052128	Ga0466957_0052128_506_1750	390
492	3300044901	Ga0466960_0005960	Ga0466960_0005960_2576_3820	390
493	3300045049	Ga0466959_0006203	Ga0466959_0006203_6288_7496	390
494	3300045049	Ga0466959_0045586	Ga0466959_0045586_834_2123	390
495	3300045836	Ga0466958_0021988	Ga0466958_0021988_2278_3567	390
496	3300046472	Ga0495580_0204833	Ga0495580_0204833_55_1263	390
497	3300046694	Ga0495649_0009018	Ga0495649_0009018_3653_4864	390
498	3300048921	Ga0496118_0049407	Ga0496118_0049407_374_1570	390
499	3300048924	Ga0496121_0023412	Ga0496121_0023412_3205_4389	390
500	3300061719	Ga0466962_0024590	Ga0466962_0024590_1131_2420	390
501	iso_pu_bacteria	2513237082	2513556694	390
502	iso_pu_bacteria	2513237083	2513563963	390
503	iso_pu_bacteria	2519103095	2519463101	390
504	iso_pu_bacteria	2521172590	2521557028	390
505	iso_pu_bacteria	2551306416	2553004825	390
506	iso_pu_bacteria	2582581311	2585293455	390
507	iso_pu_bacteria	2599185239	2599737895	390
508	iso_pu_bacteria	2808606384	2808972568	390
509	iso_pu_bacteria	2808606390	2809007439	390
510	iso_pu_bacteria	2808606391	2809014535	390
511	iso_pu_bacteria	2816332253	2817263512	390
512	iso_pu_bacteria	2816332256	2817276889	390
513	iso_pu_bacteria	2816332286	2817457210	390
514	iso_pu_bacteria	2818991449	2819616792	390
515	iso_pu_bacteria	2818991452	2819631740	390
516	iso_pu_bacteria	2863421361	2863422993	390
517	iso_pu_bacteria	2870068957	2870075716	390
518	iso_pu_bacteria	2900634093	2900640672	390
519	iso_pu_bacteria	2904439833	2904440270	390
520	iso_pu_bacteria	2904483920	2904485498	390
521	iso_pu_bacteria	2904530477	2904530818	390
522	iso_pu_bacteria	2904564687	2904566833	390
523	iso_pu_bacteria	2904571731	2904574223	390
524	iso_pu_bacteria	2904584206	2904585768	390
525	iso_pu_bacteria	2904589729	2904592419	390
526	iso_pu_bacteria	2904601388	2904601447	390
527	iso_pu_bacteria	2919046199	2919049835	390
528	iso_pu_bacteria	2919079590	2919082902	390
529	iso_pu_bacteria	2923510766	2923515658	390
530	iso_pu_bacteria	2928130867	2928134557	390
531	iso_pu_bacteria	2928157003	2928162334	390
532	iso_pu_bacteria	2928163908	2928166242	390
533	iso_pu_bacteria	2928170801	2928173597	390
534	iso_pu_bacteria	2928536128	2928539733	390
535	iso_pu_bacteria	2981990288	2981995672	390
536	iso_pu_bacteria	641736154	642414370	390
537	iso_pu_bacteria	642555113	642616601	390
538	iso_pu_bacteria	8003955200	8003960102	390
539	iso_pu_bacteria	8018845410	8018847469	390
540	iso_pu_bacteria	8020807995	8020813373	390
541	iso_pu_bacteria	8020938398	8020940503	390
542	iso_pu_bacteria	8020945358	8020951143	390
543	iso_pu_bacteria	8020953355	8020955118	390
544	iso_pu_bacteria	8021120328	8021125008	390
545	iso_pu_bacteria	8040167225	8040170106	390
546	iso_pu_bacteria	8040173305	8040175335	390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

110

423

0.95 PF07687

M20_dimer

Peptidase dimerisation domain

223

321

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4ewt-assembly1.cif.gz_D	the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus	0.9544	5	387
4ewt-assembly1.cif.gz_B	the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus	0.9495	5	384
1ysj-assembly1.cif.gz_A	crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family	0.9427	8	390
1ysj-assembly1.cif.gz_B	crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family	0.9427	8	390
1ysj-assembly1.cif.gz_B	crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family	0.9376	8	390

ID	Description	Score	Start	End	Superfamily
af_A0A0R0IPM0_41_149_3.30.70.360	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9732	183	290	3.30.70.360
af_A0A0R0IPM1_21_184_3.40.630.10	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9674	11	119	3.40.630.10
4ewtD02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9627	182	295	3.30.70.360
af_A0A0R0IPM0_41_149_3.30.70.360	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.956	183	290	3.30.70.360
4ewtD02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9466	182	295	3.30.70.360

ID	Description	Score	Start	End	GO Terms
AF-A0A3A1VML7-F1-model_v4	deleted	0.9813	109	279
AF-A0A1C2EDY4-F1-model_v4	Peptidase M20	0.9771	5	387	GO:0016787 GO:0046872
AF-A0A164HNZ5-F1-model_v4	Putative Thermostable carboxypeptidase 1	0.9766	4	164	GO:0004180
AF-A0A848EJJ0-F1-model_v4	Amidohydrolase	0.9765	1	387	GO:0016787 GO:0046872
AF-A0A534GGS6-F1-model_v4	Amidohydrolase	0.9758	5	110	GO:0016787

Feature Viewer

pLDDT	pTM	Quality
94.92	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F461985

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

110

423

0.95

PF07687

M20_dimer

Peptidase dimerisation domain

223

321

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map