F461979

General Info

Members Datasets Scaffolds Average Seq Length
546 250 1092 183

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100085453|Ga0068865_1000854531
Length 226
Sequence VNCGSRNYRRRKGELSTGHVLPPPCKDLQQKAAAGLPHSKVECAYGTRTDGLVPERLDFPFPVLQKLGETAIAQCPDEGLFATLDEENNSIAIVVKHMTGNMRSRWTDFLTTDGEKPNRDRDSEFEAPPKTRAEILDLWDAGWKCLFTGLEPLTDASMTKTVTIRGEEHSVMQAINRQIAHYAYHVGQIVMLAKHFAGANWKALTVPKKKSAEFNADVAAGKKSQR

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.83
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 19.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100085453 3300006881 Bacteria 2276
2 MRS1b_contig_8667007 2162886011 Bacteria 857
3 rootH2_10177543 3300003320 Bacteria 3163
4 rootH1_10200175 3300003323 Bacteria 1921
5 Ga0065715_10313561 3300005293 Bacteria 1015
6 Ga0070683_100020730 3300005329 Bacteria 5854
7 Ga0070670_100000465 3300005331 Bacteria 32818
8 Ga0068869_100019716 3300005334 Bacteria 4614
9 Ga0070666_10180249 3300005335 Bacteria 1481
10 Ga0070680_100079331 3300005336 Bacteria 2706
11 Ga0070682_100239530 3300005337 Bacteria 1301
12 Ga0068868_100019946 3300005338 Bacteria 5029
13 Ga0068868_100038688 3300005338 Bacteria 3703
14 Ga0070660_100370915 3300005339 Bacteria 1181
15 Ga0070689_100111155 3300005340 Bacteria 2179
16 Ga0070691_10300219 3300005341 Bacteria 877
17 Ga0070687_100004318 3300005343 Bacteria 5657
18 Ga0070661_100061463 3300005344 Unclassified 2757
19 Ga0070661_100208399 3300005344 Bacteria 1495
20 Ga0070673_100023363 3300005364 Bacteria 4517
21 Ga0070673_100096579 3300005364 Bacteria 2425
22 Ga0070659_100306550 3300005366 Bacteria 1325
23 Ga0070659_100773599 3300005366 Bacteria 834
24 Ga0070709_10231026 3300005434 Unclassified 1324
25 Ga0070714_100618552 3300005435 Bacteria 1041
26 Ga0070713_100001854 3300005436 Bacteria 13633
27 Ga0070713_100011214 3300005436 Bacteria 6517
28 Ga0070713_100049596 3300005436 Bacteria 3464
29 Ga0070713_100050793 3300005436 Bacteria 3427
30 Ga0070713_100203521 3300005436 Bacteria 1789
31 Ga0070713_100593014 3300005436 Unclassified 1052
32 Ga0070713_101396240 3300005436 Bacteria 679
33 Ga0070711_100017605 3300005439 Bacteria 4552
34 Ga0070711_100068047 3300005439 Bacteria 2501
35 Ga0070711_100119726 3300005439 Bacteria 1945
36 Ga0070711_100255692 3300005439 Bacteria 1376
37 Ga0070711_100295106 3300005439 Bacteria 1287
38 Ga0070705_100066116 3300005440 Bacteria 2167
39 Ga0070705_100407732 3300005440 Bacteria 1008
40 Ga0070708_100002216 3300005445 Bacteria 15022
41 Ga0070708_100011719 3300005445 Bacteria 7136
42 Ga0070708_100145549 3300005445 Bacteria 2200
43 Ga0070708_100448582 3300005445 Unclassified 1217
44 Ga0070681_10000026 3300005458 Bacteria 107615
45 Ga0070681_10003858 3300005458 Bacteria 14107
46 Ga0070681_10039357 3300005458 Bacteria 4740
47 Ga0070681_10127137 3300005458 Bacteria 2481
48 Ga0070681_10234589 3300005458 Bacteria 1749
49 Ga0070681_11087565 3300005458 Bacteria 720
50 Ga0070685_10101162 3300005466 Bacteria 1761
51 Ga0070706_100009539 3300005467 Bacteria 9024
52 Ga0070706_100066640 3300005467 Bacteria 3330
53 Ga0070706_100163177 3300005467 Bacteria 2081
54 Ga0070707_100016168 3300005468 Bacteria 7002
55 Ga0070707_100036007 3300005468 Bacteria 4722
56 Ga0070707_100044776 3300005468 Bacteria 4236
57 Ga0070707_100630430 3300005468 Unclassified 1035
58 Ga0070707_100670044 3300005468 Bacteria 1000
59 Ga0070698_100038651 3300005471 Bacteria 4917
60 Ga0070699_100003952 3300005518 Bacteria 13102
61 Ga0070699_100140505 3300005518 Bacteria 2132
62 Ga0070679_100002685 3300005530 Bacteria 16206
63 Ga0070679_100057030 3300005530 Bacteria 3892
64 Ga0070679_100220240 3300005530 Bacteria 1859
65 Ga0070679_101024006 3300005530 Unclassified 770
66 Ga0070679_101331344 3300005530 Unclassified 664
67 Ga0070684_100175900 3300005535 Bacteria 1945
68 Ga0070684_100404298 3300005535 Bacteria 1259
69 Ga0070684_100414517 3300005535 Bacteria 1243
70 Ga0070697_100011621 3300005536 Bacteria 6881
71 Ga0070697_100057441 3300005536 Bacteria 3166
72 Ga0070697_100063466 3300005536 Bacteria 3016
73 Ga0068853_100005502 3300005539 Bacteria 9930
74 Ga0068853_100054312 3300005539 Unclassified 3452
75 Ga0068853_100305263 3300005539 Unclassified 1472
76 Ga0070693_100121197 3300005547 Bacteria 1622
77 Ga0070693_100196928 3300005547 Bacteria 1306
78 Ga0070665_100002835 3300005548 Bacteria 18766
79 Ga0070665_100082411 3300005548 Unclassified 3222
80 Ga0070665_100236323 3300005548 Unclassified 1828
81 Ga0070704_100225653 3300005549 Bacteria 1525
82 Ga0068855_100000295 3300005563 Bacteria 61909
83 Ga0068855_100001626 3300005563 Bacteria 28175
84 Ga0068855_100037332 3300005563 Bacteria 5778
85 Ga0068855_100183904 3300005563 Bacteria 2362
86 Ga0068855_100334100 3300005563 Unclassified 1672
87 Ga0070664_100011818 3300005564 Bacteria 7086
88 Ga0070664_100165715 3300005564 Bacteria 1958
89 Ga0068857_100000036 3300005577 Bacteria 72327
90 Ga0068857_100002465 3300005577 Bacteria 15129
91 Ga0068857_100441307 3300005577 Bacteria 1216
92 Ga0068854_100049002 3300005578 Bacteria 3016
93 Ga0068854_100059285 3300005578 Bacteria 2766
94 Ga0068854_100107704 3300005578 Bacteria 2098
95 Ga0068856_100000407 3300005614 Bacteria 47326
96 Ga0068856_100001013 3300005614 Bacteria 29894
97 Ga0068856_100005128 3300005614 Bacteria 12934
98 Ga0068856_100006160 3300005614 Bacteria 11767
99 Ga0068856_100011752 3300005614 Bacteria 8490
100 Ga0068856_101238400 3300005614 Bacteria 762
101 Ga0068852_100030307 3300005616 Bacteria 4452
102 Ga0068852_100377962 3300005616 Bacteria 1389
103 Ga0068852_100740503 3300005616 Unclassified 995
104 Ga0068859_100001163 3300005617 Bacteria 26891
105 Ga0068859_100766687 3300005617 Unclassified 1053
106 Ga0068864_100000684 3300005618 Bacteria 28437
107 Ga0068864_100243415 3300005618 Bacteria 1667
108 Ga0068866_10039663 3300005718 Bacteria 2326
109 Ga0068861_100213027 3300005719 Bacteria 1628
110 Ga0068870_10055980 3300005840 Bacteria 2103
111 Ga0068863_100007292 3300005841 Bacteria 10830
112 Ga0068863_100009497 3300005841 Bacteria 9487
113 Ga0068863_100315364 3300005841 Bacteria 1518
114 Ga0068858_100004945 3300005842 Bacteria 13059
115 Ga0068858_100022004 3300005842 Bacteria 5954
116 Ga0068858_100031767 3300005842 Bacteria 4907
117 Ga0068858_100087967 3300005842 Bacteria 2890
118 Ga0068858_100553936 3300005842 Bacteria 1113
119 Ga0068860_100049008 3300005843 Bacteria 4026
120 Ga0068860_100130531 3300005843 Bacteria 2411
121 Ga0068860_100169981 3300005843 Bacteria 2105
122 Ga0068860_100611326 3300005843 Unclassified 1096
123 Ga0068862_100555900 3300005844 Bacteria 1096
124 Ga0081455_10057393 3300005937 Bacteria 3299
125 Ga0070717_10003194 3300006028 Bacteria 11706
126 Ga0070717_10003268 3300006028 Bacteria 11596
127 Ga0070717_10183732 3300006028 Bacteria 1824
128 Ga0070717_10317120 3300006028 Bacteria 1388
129 Ga0070717_10570319 3300006028 Bacteria 1026
130 Ga0070715_10383716 3300006163 Unclassified 776
131 Ga0070716_100005066 3300006173 Bacteria 6357
132 Ga0070716_100007227 3300006173 Bacteria 5461
133 Ga0070716_100104865 3300006173 Unclassified 1741
134 Ga0070716_100130325 3300006173 Bacteria 1589
135 Ga0070712_100028779 3300006175 Bacteria 3719
136 Ga0070712_100030034 3300006175 Bacteria 3648
137 Ga0070712_100035590 3300006175 Bacteria 3380
138 Ga0070712_100234144 3300006175 Bacteria 1460
139 Ga0070712_100292511 3300006175 Unclassified 1315
140 Ga0097621_100000237 3300006237 Bacteria 37036
141 Ga0097621_100001414 3300006237 Bacteria 16502
142 Ga0097621_100008924 3300006237 Bacteria 7247
143 Ga0097621_100053907 3300006237 Bacteria 3278
144 Ga0097621_100403515 3300006237 Bacteria 1224
145 Ga0097621_100585221 3300006237 Bacteria 1019
146 Ga0068871_100001088 3300006358 Bacteria 18235
147 Ga0068871_100002036 3300006358 Bacteria 13700
148 Ga0068871_100005893 3300006358 Bacteria 8617
149 Ga0068871_100165707 3300006358 Bacteria 1892
150 Ga0075428_100268980 3300006844 Bacteria 1834
151 Ga0075431_100592374 3300006847 Unclassified 1093
152 Ga0075434_100010761 3300006871 Bacteria 8591
153 Ga0075434_100021123 3300006871 Bacteria 6327
154 Ga0075434_100326203 3300006871 Unclassified 1556
155 Ga0075434_101256268 3300006871 Unclassified 752
156 Ga0075434_101774539 3300006871 Unclassified 624
157 Ga0068865_100072985 3300006881 Bacteria 2439
158 Ga0068865_100077684 3300006881 Bacteria 2373
159 Ga0075436_100069637 3300006914 Bacteria 2431
160 Ga0075436_100665329 3300006914 Unclassified 770
161 Ga0097620_100001163 3300006931 Bacteria 26891
162 Ga0097620_100766661 3300006931 Unclassified 1053
163 Ga0075435_100069330 3300007076 Bacteria 2875
164 Ga0075435_100099443 3300007076 Bacteria 2409
165 Ga0075435_100152601 3300007076 Unclassified 1943
166 Ga0075435_100194244 3300007076 Unclassified 1718
167 Ga0075435_100363928 3300007076 Unclassified 1241
168 Ga0099794_10012410 3300007265 Bacteria 3677
169 Ga0099794_10024669 3300007265 Bacteria 2762
170 Ga0099794_10055568 3300007265 Bacteria 1913
171 Ga0099794_10198365 3300007265 Bacteria 1027
172 Ga0099794_10435868 3300007265 Bacteria 686
173 Ga0099795_10151595 3300007788 Bacteria 950
174 Ga0105240_10000779 3300009093 Bacteria 57657
175 Ga0105240_10033237 3300009093 Bacteria 6668
176 Ga0105240_10036009 3300009093 Bacteria 6373
177 Ga0105240_10061154 3300009093 Unclassified 4694
178 Ga0105240_10102889 3300009093 Bacteria 3470
179 Ga0105240_10432070 3300009093 Unclassified 1477
180 Ga0105240_10667286 3300009093 Bacteria 1138
181 Ga0105240_11012875 3300009093 Bacteria 888
182 Ga0105245_10012645 3300009098 Bacteria 7349
183 Ga0105245_10266795 3300009098 Bacteria 1668
184 Ga0105247_10022667 3300009101 Bacteria 3782
185 Ga0105247_10474080 3300009101 Bacteria 907
186 Ga0114129_10136536 3300009147 Bacteria 3365
187 Ga0105243_10172419 3300009148 Unclassified 1875
188 Ga0105243_10236321 3300009148 Bacteria 1624
189 Ga0105241_10000207 3300009174 Bacteria 44168
190 Ga0105241_10022060 3300009174 Bacteria 4713
191 Ga0105241_10071710 3300009174 Unclassified 2690
192 Ga0105241_10132720 3300009174 Unclassified 2018
193 Ga0105241_10812618 3300009174 Unclassified 862
194 Ga0105242_10057833 3300009176 Bacteria 3177
195 Ga0105242_10314868 3300009176 Unclassified 1433
196 Ga0105248_10003155 3300009177 Bacteria 18246
197 Ga0105248_10065865 3300009177 Bacteria 4068
198 Ga0105248_10103342 3300009177 Unclassified 3212
199 Ga0105248_10552377 3300009177 Bacteria 1299
200 Ga0105248_10766968 3300009177 Bacteria 1088
201 Ga0105248_12019534 3300009177 Unclassified 655
202 Ga0105237_10024339 3300009545 Bacteria 6196
203 Ga0105238_10000848 3300009551 Bacteria 31448
204 Ga0105249_10016178 3300009553 Bacteria 6614
205 Ga0105249_11008726 3300009553 Unclassified 901
206 Ga0099796_10002244 3300010159 Bacteria 4191
207 Ga0099796_10220394 3300010159 Bacteria 777
208 Ga0105239_10135553 3300010375 Bacteria 2741
209 Ga0157373_10026444 3300013100 Bacteria 4191
210 Ga0157373_10329459 3300013100 Bacteria 1087
211 Ga0157373_10398272 3300013100 Bacteria 986
212 Ga0157371_10126761 3300013102 Bacteria 1816
213 Ga0157371_10132339 3300013102 Bacteria 1775
214 Ga0157371_10722396 3300013102 Bacteria 747
215 Ga0157370_10041920 3300013104 Bacteria 4413
216 Ga0157370_10136073 3300013104 Bacteria 2290
217 Ga0157369_10000124 3300013105 Bacteria 110693
218 Ga0157369_10002390 3300013105 Bacteria 22542
219 Ga0157369_10035151 3300013105 Bacteria 5496
220 Ga0157369_10303484 3300013105 Bacteria 1660
221 Ga0157369_10374488 3300013105 Bacteria 1478
222 Ga0157369_10399210 3300013105 Bacteria 1426
223 Ga0157374_10000162 3300013296 Bacteria 61913
224 Ga0157374_10000667 3300013296 Bacteria 30210
225 Ga0157374_10001625 3300013296 Bacteria 18840
226 Ga0157374_10013807 3300013296 Bacteria 7056
227 Ga0157374_10138030 3300013296 Bacteria 2365
228 Ga0157374_11619040 3300013296 Unclassified 672
229 Ga0157378_10000020 3300013297 Bacteria 131245
230 Ga0157378_10000320 3300013297 Bacteria 47177
231 Ga0157378_10421120 3300013297 Unclassified 1320
232 Ga0157372_10000084 3300013307 Bacteria 98431
233 Ga0157372_10001005 3300013307 Bacteria 30808
234 Ga0157372_10001112 3300013307 Bacteria 29221
235 Ga0157372_10024090 3300013307 Bacteria 6605
236 Ga0157372_10077139 3300013307 Bacteria 3763
237 Ga0157372_10128565 3300013307 Bacteria 2914
238 Ga0157372_10385370 3300013307 Unclassified 1633
239 Ga0157372_10417601 3300013307 Bacteria 1563
240 Ga0157372_10803907 3300013307 Bacteria 1093
241 Ga0157372_11959830 3300013307 Unclassified 673
242 Ga0157375_10485649 3300013308 Bacteria 1400
243 Ga0157375_10616132 3300013308 Bacteria 1244
244 Ga0163163_10167540 3300014325 Bacteria 2243
245 Ga0182008_10118048 3300014497 Unclassified 1317
246 Ga0157377_10529244 3300014745 Bacteria 829
247 Ga0157379_10128917 3300014968 Bacteria 2276
248 Ga0157379_10269320 3300014968 Bacteria 1549
249 Ga0157376_10000023 3300014969 Bacteria 223978
250 Ga0157376_10045297 3300014969 Unclassified 3621
251 Ga0157376_10046895 3300014969 Bacteria 3566
252 Ga0157376_10248677 3300014969 Bacteria 1660
253 Ga0213875_10345991 3300021388 Bacteria 706
254 Ga0207642_10081615 3300025899 Bacteria 1572
255 Ga0207642_10133813 3300025899 Bacteria 1297
256 Ga0207710_10148307 3300025900 Unclassified 1136
257 Ga0207699_10002455 3300025906 Bacteria 8749
258 Ga0207643_10061981 3300025908 Bacteria 2136
259 Ga0207705_10071545 3300025909 Bacteria 2514
260 Ga0207705_10674979 3300025909 Bacteria 803
261 Ga0207684_10004037 3300025910 Bacteria 14023
262 Ga0207684_10053022 3300025910 Bacteria 3443
263 Ga0207684_10056991 3300025910 Bacteria 3315
264 Ga0207684_10296359 3300025910 Unclassified 1394
265 Ga0207684_11060888 3300025910 Bacteria 676
266 Ga0207654_10001292 3300025911 Bacteria 13327
267 Ga0207654_10460636 3300025911 Unclassified 893
268 Ga0207707_10002183 3300025912 Bacteria 17725
269 Ga0207707_10005146 3300025912 Bacteria 11464
270 Ga0207707_10209575 3300025912 Bacteria 1698
271 Ga0207695_10059853 3300025913 Bacteria 3947
272 Ga0207695_10134812 3300025913 Bacteria 2423
273 Ga0207695_10138070 3300025913 Bacteria 2389
274 Ga0207695_10220309 3300025913 Bacteria 1805
275 Ga0207695_10507463 3300025913 Bacteria 1088
276 Ga0207695_10687561 3300025913 Bacteria 904
277 Ga0207671_10213215 3300025914 Bacteria 1511
278 Ga0207671_10527295 3300025914 Bacteria 942
279 Ga0207693_10020109 3300025915 Bacteria 5310
280 Ga0207693_10024857 3300025915 Bacteria 4751
281 Ga0207693_10042906 3300025915 Bacteria 3560
282 Ga0207693_10157842 3300025915 Bacteria 1784
283 Ga0207693_10242309 3300025915 Bacteria 1415
284 Ga0207693_10310341 3300025915 Unclassified 1235
285 Ga0207693_10314653 3300025915 Bacteria 1226
286 Ga0207663_10023504 3300025916 Bacteria 3538
287 Ga0207663_10062269 3300025916 Bacteria 2371
288 Ga0207663_10242845 3300025916 Bacteria 1322
289 Ga0207663_10326758 3300025916 Bacteria 1154
290 Ga0207663_10505262 3300025916 Unclassified 939
291 Ga0207657_10273261 3300025919 Bacteria 1343
292 Ga0207649_10043353 3300025920 Unclassified 2750
293 Ga0207652_10004418 3300025921 Bacteria 11456
294 Ga0207652_10021634 3300025921 Bacteria 5309
295 Ga0207652_10206774 3300025921 Bacteria 1767
296 Ga0207646_10002047 3300025922 Bacteria 24227
297 Ga0207646_10032915 3300025922 Bacteria 4689
298 Ga0207694_10000434 3300025924 Bacteria 38832
299 Ga0207650_10000976 3300025925 Bacteria 21527
300 Ga0207659_10467634 3300025926 Bacteria 1064
301 Ga0207700_10019857 3300025928 Bacteria 4548
302 Ga0207700_10020153 3300025928 Bacteria 4521
303 Ga0207700_10032487 3300025928 Bacteria 3723
304 Ga0207700_10042295 3300025928 Bacteria 3340
305 Ga0207700_10069404 3300025928 Bacteria 2705
306 Ga0207700_10081294 3300025928 Unclassified 2530
307 Ga0207700_10093857 3300025928 Unclassified 2376
308 Ga0207700_10299331 3300025928 Bacteria 1389
309 Ga0207664_10024972 3300025929 Unclassified 4494
310 Ga0207690_10116194 3300025932 Bacteria 1935
311 Ga0207690_10174301 3300025932 Bacteria 1614
312 Ga0207709_10275388 3300025935 Bacteria 1240
313 Ga0207670_10215094 3300025936 Bacteria 1468
314 Ga0207704_10182856 3300025938 Bacteria 1517
315 Ga0207704_10370061 3300025938 Bacteria 1122
316 Ga0207665_10000556 3300025939 Bacteria 25140
317 Ga0207665_10002878 3300025939 Bacteria 11548
318 Ga0207665_10136646 3300025939 Unclassified 1745
319 Ga0207665_10251151 3300025939 Unclassified 1307
320 Ga0207711_10032769 3300025941 Bacteria 4394
321 Ga0207711_10102800 3300025941 Unclassified 2530
322 Ga0207711_10419814 3300025941 Unclassified 1244
323 Ga0207689_10028604 3300025942 Bacteria 4661
324 Ga0207661_10051439 3300025944 Bacteria 3287
325 Ga0207661_10678824 3300025944 Unclassified 947
326 Ga0207661_10728896 3300025944 Bacteria 912
327 Ga0207679_10029021 3300025945 Bacteria 3847
328 Ga0207667_10000591 3300025949 Bacteria 47010
329 Ga0207667_10021571 3300025949 Bacteria 7135
330 Ga0207667_10033618 3300025949 Bacteria 5512
331 Ga0207667_10138730 3300025949 Bacteria 2503
332 Ga0207667_10789048 3300025949 Bacteria 947
333 Ga0207712_10417399 3300025961 Unclassified 1131
334 Ga0207640_10015658 3300025981 Bacteria 4394
335 Ga0207640_10817612 3300025981 Bacteria 808
336 Ga0207677_10012856 3300026023 Bacteria 4832
337 Ga0207677_10031938 3300026023 Bacteria 3378
338 Ga0207677_10068336 3300026023 Bacteria 2493
339 Ga0207703_10013497 3300026035 Bacteria 6365
340 Ga0207703_10023687 3300026035 Bacteria 4828
341 Ga0207703_10042596 3300026035 Bacteria 3642
342 Ga0207703_10082609 3300026035 Bacteria 2682
343 Ga0207639_10038473 3300026041 Unclassified 3559
344 Ga0207639_10137685 3300026041 Bacteria 2030
345 Ga0207702_10000114 3300026078 Bacteria 93951
346 Ga0207702_10004430 3300026078 Bacteria 12479
347 Ga0207702_10016226 3300026078 Bacteria 6164
348 Ga0207702_10021789 3300026078 Bacteria 5307
349 Ga0207702_10038302 3300026078 Bacteria 4015
350 Ga0207702_10116383 3300026078 Bacteria 2385
351 Ga0207641_10004416 3300026088 Bacteria 12188
352 Ga0207641_10006671 3300026088 Bacteria 9691
353 Ga0207641_10108879 3300026088 Bacteria 2453
354 Ga0207641_10254174 3300026088 Bacteria 1642
355 Ga0207641_10795685 3300026088 Unclassified 935
356 Ga0207676_10025253 3300026095 Bacteria 4408
357 Ga0207676_10223818 3300026095 Bacteria 1677
358 Ga0207674_10000860 3300026116 Bacteria 39670
359 Ga0207674_10001389 3300026116 Bacteria 31181
360 Ga0207674_10984281 3300026116 Bacteria 812
361 Ga0207675_100270870 3300026118 Bacteria 1648
362 Ga0207698_10021391 3300026142 Bacteria 4473
363 Ga0207698_10467084 3300026142 Bacteria 1221
364 Ga0209588_1070959 3300027671 Unclassified 1125
365 Ga0268266_10000204 3300028379 Bacteria 104000
366 Ga0268266_10184238 3300028379 Bacteria 1903
367 Ga0268266_10436498 3300028379 Bacteria 1243
368 Ga0268264_10143469 3300028381 Bacteria 2132
369 Ga0268264_10339201 3300028381 Bacteria 1427
370 Ga0268264_10390535 3300028381 Bacteria 1335
371 Ga0268264_10801512 3300028381 Unclassified 941
372 Ga0268264_10883386 3300028381 Bacteria 896
373 Ga0265334_10033899 3300028573 Bacteria 2029
374 Ga0265318_10017503 3300028577 Bacteria 2941
375 Ga0265336_10081779 3300028666 Unclassified 963
376 Ga0265338_10022309 3300028800 Bacteria 6558
377 Ga0265338_10070630 3300028800 Bacteria 2992
378 Ga0265338_10096089 3300028800 Bacteria 2432
379 Ga0265338_10281647 3300028800 Unclassified 1214
380 Ga0265324_10023221 3300029957 Bacteria 2210
381 Ga0316182_1270272 3300030745 Bacteria 912
382 Ga0265330_10001092 3300031235 Bacteria 16324
383 Ga0265332_10310999 3300031238 Unclassified 650
384 Ga0265328_10001524 3300031239 Bacteria 10705
385 Ga0265328_10235932 3300031239 Unclassified 698
386 Ga0265320_10006234 3300031240 Bacteria 7537
387 Ga0265320_10011855 3300031240 Bacteria 5108
388 Ga0265325_10001008 3300031241 Bacteria 20272
389 Ga0265325_10276784 3300031241 Bacteria 753
390 Ga0265329_10111994 3300031242 Unclassified 872
391 Ga0265329_10149485 3300031242 Unclassified 756
392 Ga0265340_10001788 3300031247 Bacteria 12271
393 Ga0265339_10007711 3300031249 Bacteria 6925
394 Ga0265339_10016611 3300031249 Bacteria 4382
395 Ga0265339_10092550 3300031249 Unclassified 1582
396 Ga0265331_10029372 3300031250 Bacteria 2744
397 Ga0265331_10083017 3300031250 Bacteria 1486
398 Ga0265316_10001309 3300031344 Bacteria 26795
399 Ga0265316_10003468 3300031344 Bacteria 15938
400 Ga0265316_10011051 3300031344 Bacteria 8180
401 Ga0265313_10004181 3300031595 Bacteria 11206
402 Ga0265314_10000162 3300031711 Bacteria 101818
403 Ga0265314_10006038 3300031711 Bacteria 10780
404 Ga0265314_10089126 3300031711 Unclassified 2013
405 Ga0265342_10000816 3300031712 Bacteria 31275
406 Ga0265342_10149794 3300031712 Bacteria 1296
407 Ga0373928_0184601 3300035084 Bacteria 594
408 Ga0373944_0059996 3300035089 Unclassified 1218
409 Ga0373932_0034992 3300035112 Bacteria 1418
410 Ga0373936_0021449 3300035113 Bacteria 2512
411 Ga0373936_0287821 3300035113 Unclassified 739
412 Ga0373953_0017372 3300035117 Unclassified 2644
413 Ga0373954_0018941 3300035118 Bacteria 3102
414 Ga0373956_0067478 3300035119 Bacteria 1628
415 Ga0373957_0030112 3300035120 Bacteria 1987
416 Ga0373960_0015981 3300035121 Bacteria 1924
417 Ga0373943_0137277 3300035170 Unclassified 1314
418 Ga0373946_0392033 3300035171 Unclassified 700
419 Ga0373955_0001416 3300035172 Bacteria 10215
420 Ga0373924_0286803 3300035410 Bacteria 730
421 Ga0373931_0150486 3300035691 Bacteria 1356
422 Ga0373935_0003735 3300035692 Bacteria 8888
423 Ga0373935_0044416 3300035692 Bacteria 2800
424 Ga0373927_0021060 3300035695 Bacteria 4273
425 Ga0373927_0101231 3300035695 Unclassified 1874
426 Ga0373927_0114443 3300035695 Bacteria 1758
427 Ga0373933_0000231 3300035724 Bacteria 37069
428 Ga0373947_0002800 3300035725 Bacteria 10424
429 Ga0373947_0003087 3300035725 Bacteria 9923
430 Ga0373937_0008629 3300036401 Bacteria 8853
431 Ga0373925_0005289 3300037068 Bacteria 9634
432 Ga0373925_0005802 3300037068 Bacteria 9172
433 Ga0373925_0099255 3300037068 Bacteria 2236
434 Ga0395900_1303873 3300037418 Unclassified 640
435 Ga0395898_0346471 3300037466 Unclassified 1417
436 Ga0395898_1167918 3300037466 Bacteria 702
437 Ga0395905_0055416 3300037471 Bacteria 3710
438 Ga0395905_0099180 3300037471 Unclassified 2736
439 Ga0436364_0017915 3300037853 Unclassified 3084
440 Ga0436364_0174993 3300037853 Bacteria 3146
441 Ga0436364_1481004 3300037853 Bacteria 706
442 Ga0395901_0819517 3300038443 Unclassified 918
443 Ga0436365_1197618 3300039437 Bacteria 23465
444 Ga0436365_1582809 3300039437 Unclassified 1045
445 Ga0436362_1047476 3300039453 Unclassified 818
446 Ga0466966_0277298 3300044684 Bacteria 1009
447 Ga0466961_0113332 3300044693 Bacteria 1705
448 Ga0466963_0266980 3300044694 Bacteria 1202
449 Ga0466957_1052055 3300044842 Bacteria 586
450 Ga0466959_0227875 3300045049 Bacteria 1291
451 Ga0451576_0978716 3300045051 Bacteria 887
452 Ga0495592_0196153 3300046454 Bacteria 1365
453 Ga0495592_0407245 3300046454 Bacteria 860
454 Ga0495592_0604395 3300046454 Bacteria 668
455 Ga0495641_0030216 3300046461 Bacteria 2601
456 Ga0495651_0022576 3300046462 Bacteria 4891
457 Ga0495653_0710967 3300046463 Bacteria 609
458 Ga0495580_0002272 3300046472 Bacteria 16772
459 Ga0495580_0007720 3300046472 Bacteria 8625
460 Ga0495580_0023143 3300046472 Bacteria 4565
461 Ga0495580_0056801 3300046472 Bacteria 2756
462 Ga0495580_0218778 3300046472 Bacteria 1309
463 Ga0495582_0000074 3300046473 Bacteria 50012
464 Ga0495582_0009132 3300046473 Bacteria 5470
465 Ga0495582_0380853 3300046473 Bacteria 813
466 Ga0495664_0022020 3300046477 Bacteria 3687
467 Ga0495664_0291888 3300046477 Bacteria 985
468 Ga0495594_0638944 3300046499 Bacteria 603
469 Ga0495608_0010050 3300046511 Bacteria 6601
470 Ga0495618_0025507 3300046514 Bacteria 3669
471 Ga0495628_0081741 3300046516 Bacteria 2509
472 Ga0495630_0004428 3300046517 Bacteria 9857
473 Ga0495630_0125294 3300046517 Bacteria 1949
474 Ga0495630_0126245 3300046517 Unclassified 1942
475 Ga0495666_0078519 3300046526 Unclassified 1564
476 Ga0495652_0003676 3300046529 Bacteria 15011
477 Ga0495652_0022599 3300046529 Bacteria 5581
478 Ga0495665_0002866 3300046531 Bacteria 9323
479 Ga0495665_0040840 3300046531 Bacteria 2470
480 Ga0495665_0044348 3300046531 Bacteria 2363
481 Ga0495665_0272837 3300046531 Bacteria 868
482 Ga0495640_0075463 3300046533 Bacteria 2252
483 Ga0495640_0139549 3300046533 Bacteria 1563
484 Ga0495586_0468945 3300046535 Bacteria 726
485 Ga0495645_0211756 3300046543 Unclassified 1308
486 Ga0495622_0215033 3300046557 Bacteria 853
487 Ga0495667_0093203 3300046559 Bacteria 1950
488 Ga0495667_0361091 3300046559 Bacteria 917
489 Ga0495634_0114430 3300046642 Bacteria 1732
490 Ga0495635_0161844 3300046663 Bacteria 1523
491 Ga0495623_0009448 3300046679 Bacteria 6332
492 Ga0495623_0056137 3300046679 Bacteria 2480
493 Ga0495646_0004591 3300046680 Bacteria 8705
494 Ga0495658_0719655 3300046683 Bacteria 639
495 Ga0495613_0131026 3300046689 Unclassified 1796
496 Ga0495613_0311957 3300046689 Bacteria 1087
497 Ga0495613_0319929 3300046689 Bacteria 1071
498 Ga0495624_0012771 3300046690 Bacteria 5734
499 Ga0495604_0003148 3300047317 Bacteria 13183
500 Ga0495604_0191949 3300047317 Unclassified 1422
501 Ga0495674_0054235 3300047319 Bacteria 3521
502 Ga0495674_0108059 3300047319 Bacteria 2361
503 Ga0495674_0379171 3300047319 Bacteria 1144
504 Ga0495674_0490751 3300047319 Bacteria 983
505 Ga0495674_0607891 3300047319 Bacteria 866
506 Ga0495680_0050855 3300047322 Bacteria 3239
507 Ga0495675_0374889 3300047444 Unclassified 833
508 Ga0495684_0014804 3300047471 Bacteria 6006
509 Ga0495684_0044337 3300047471 Unclassified 3405
510 Ga0495593_0073382 3300047673 Unclassified 1775
511 Ga0495602_0020548 3300048088 Bacteria 6523
512 Ga0495602_0091176 3300048088 Bacteria 2529
513 Ga0496102_0092913 3300048905 Bacteria 2795
514 Ga0496109_0942718 3300048912 Unclassified 801
515 Ga0496112_0003224 3300048915 Bacteria 13436
516 Ga0496112_0077460 3300048915 Bacteria 3288
517 Ga0496112_0080459 3300048915 Bacteria 3222
518 Ga0496113_0414914 3300048916 Unclassified 1081
519 Ga0496114_0040729 3300048917 Bacteria 3847
520 Ga0496115_0014532 3300048918 Bacteria 5961
521 Ga0496115_0016242 3300048918 Bacteria 5665
522 Ga0496115_0531727 3300048918 Bacteria 942
523 Ga0501034_0056548 3300049571 Unclassified 3947
524 Ga0501036_0264449 3300049572 Unclassified 1441
525 Ga0501038_0066368 3300049574 Unclassified 3073
526 Ga0501039_0508993 3300049575 Unclassified 945
527 Ga0501043_0029710 3300049579 Unclassified 4295
528 Ga0501046_0080176 3300049580 Unclassified 2523
529 Ga0501047_0137545 3300049581 Unclassified 2322
530 Ga0501070_0003207 3300049586 Bacteria 14223
531 Ga0501073_0218314 3300049589 Unclassified 1317
532 Ga0501075_0999363 3300049591 Unclassified 636
533 Ga0501035_0030776 3300049822 Bacteria 4892
534 Ga0501044_0149083 3300049823 Unclassified 2322
535 nmdc:mga06r32_596970_c1 3300050510 Unclassified 1075
536 nmdc:mga0n895_1460343_c1 3300050512 Unclassified 651
537 nmdc:mga0n895_176562_c1 3300050512 Bacteria 2167
538 nmdc:mga0n895_22392_c1 3300050512 Bacteria 5924
539 nmdc:mga0n895_574981_c1 3300050512 Bacteria 1131
540 nmdc:mga0rr50_110968_c1 3300050513 Bacteria 2170
541 nmdc:mga0rr50_14900_c1 3300050513 Bacteria 5116
542 nmdc:mga0rr50_293068_c1 3300050513 Unclassified 1360
543 nmdc:mga08x19_1062335_c1 3300050514 Unclassified 575
544 nmdc:mga08x19_11346_c1 3300050514 Bacteria 5364
545 Ga0500604_0181820 3300053151 Bacteria 721
546 Ga0501082_1140828 3300060353 Bacteria 681
547 Ga0068865_100085453
548 MRS1b_contig_8667007
549 rootH2_10177543
550 rootH1_10200175
551 Ga0065715_10313561
552 Ga0070683_100020730
553 Ga0070670_100000465
554 Ga0068869_100019716
555 Ga0070666_10180249
556 Ga0070680_100079331
557 Ga0070682_100239530
558 Ga0068868_100019946
559 Ga0068868_100038688
560 Ga0070660_100370915
561 Ga0070689_100111155
562 Ga0070691_10300219
563 Ga0070687_100004318
564 Ga0070661_100061463
565 Ga0070661_100208399
566 Ga0070673_100023363
567 Ga0070673_100096579
568 Ga0070659_100306550
569 Ga0070659_100773599
570 Ga0070709_10231026
571 Ga0070714_100618552
572 Ga0070713_100001854
573 Ga0070713_100011214
574 Ga0070713_100049596
575 Ga0070713_100050793
576 Ga0070713_100203521
577 Ga0070713_100593014
578 Ga0070713_101396240
579 Ga0070711_100017605
580 Ga0070711_100068047
581 Ga0070711_100119726
582 Ga0070711_100255692
583 Ga0070711_100295106
584 Ga0070705_100066116
585 Ga0070705_100407732
586 Ga0070708_100002216
587 Ga0070708_100011719
588 Ga0070708_100145549
589 Ga0070708_100448582
590 Ga0070681_10000026
591 Ga0070681_10003858
592 Ga0070681_10039357
593 Ga0070681_10127137
594 Ga0070681_10234589
595 Ga0070681_11087565
596 Ga0070685_10101162
597 Ga0070706_100009539
598 Ga0070706_100066640
599 Ga0070706_100163177
600 Ga0070707_100016168
601 Ga0070707_100036007
602 Ga0070707_100044776
603 Ga0070707_100630430
604 Ga0070707_100670044
605 Ga0070698_100038651
606 Ga0070699_100003952
607 Ga0070699_100140505
608 Ga0070679_100002685
609 Ga0070679_100057030
610 Ga0070679_100220240
611 Ga0070679_101024006
612 Ga0070679_101331344
613 Ga0070684_100175900
614 Ga0070684_100404298
615 Ga0070684_100414517
616 Ga0070697_100011621
617 Ga0070697_100057441
618 Ga0070697_100063466
619 Ga0068853_100005502
620 Ga0068853_100054312
621 Ga0068853_100305263
622 Ga0070693_100121197
623 Ga0070693_100196928
624 Ga0070665_100002835
625 Ga0070665_100082411
626 Ga0070665_100236323
627 Ga0070704_100225653
628 Ga0068855_100000295
629 Ga0068855_100001626
630 Ga0068855_100037332
631 Ga0068855_100183904
632 Ga0068855_100334100
633 Ga0070664_100011818
634 Ga0070664_100165715
635 Ga0068857_100000036
636 Ga0068857_100002465
637 Ga0068857_100441307
638 Ga0068854_100049002
639 Ga0068854_100059285
640 Ga0068854_100107704
641 Ga0068856_100000407
642 Ga0068856_100001013
643 Ga0068856_100005128
644 Ga0068856_100006160
645 Ga0068856_100011752
646 Ga0068856_101238400
647 Ga0068852_100030307
648 Ga0068852_100377962
649 Ga0068852_100740503
650 Ga0068859_100001163
651 Ga0068859_100766687
652 Ga0068864_100000684
653 Ga0068864_100243415
654 Ga0068866_10039663
655 Ga0068861_100213027
656 Ga0068870_10055980
657 Ga0068863_100007292
658 Ga0068863_100009497
659 Ga0068863_100315364
660 Ga0068858_100004945
661 Ga0068858_100022004
662 Ga0068858_100031767
663 Ga0068858_100087967
664 Ga0068858_100553936
665 Ga0068860_100049008
666 Ga0068860_100130531
667 Ga0068860_100169981
668 Ga0068860_100611326
669 Ga0068862_100555900
670 Ga0081455_10057393
671 Ga0070717_10003194
672 Ga0070717_10003268
673 Ga0070717_10183732
674 Ga0070717_10317120
675 Ga0070717_10570319
676 Ga0070715_10383716
677 Ga0070716_100005066
678 Ga0070716_100007227
679 Ga0070716_100104865
680 Ga0070716_100130325
681 Ga0070712_100028779
682 Ga0070712_100030034
683 Ga0070712_100035590
684 Ga0070712_100234144
685 Ga0070712_100292511
686 Ga0097621_100000237
687 Ga0097621_100001414
688 Ga0097621_100008924
689 Ga0097621_100053907
690 Ga0097621_100403515
691 Ga0097621_100585221
692 Ga0068871_100001088
693 Ga0068871_100002036
694 Ga0068871_100005893
695 Ga0068871_100165707
696 Ga0075428_100268980
697 Ga0075431_100592374
698 Ga0075434_100010761
699 Ga0075434_100021123
700 Ga0075434_100326203
701 Ga0075434_101256268
702 Ga0075434_101774539
703 Ga0068865_100072985
704 Ga0068865_100077684
705 Ga0075436_100069637
706 Ga0075436_100665329
707 Ga0097620_100001163
708 Ga0097620_100766661
709 Ga0075435_100069330
710 Ga0075435_100099443
711 Ga0075435_100152601
712 Ga0075435_100194244
713 Ga0075435_100363928
714 Ga0099794_10012410
715 Ga0099794_10024669
716 Ga0099794_10055568
717 Ga0099794_10198365
718 Ga0099794_10435868
719 Ga0099795_10151595
720 Ga0105240_10000779
721 Ga0105240_10033237
722 Ga0105240_10036009
723 Ga0105240_10061154
724 Ga0105240_10102889
725 Ga0105240_10432070
726 Ga0105240_10667286
727 Ga0105240_11012875
728 Ga0105245_10012645
729 Ga0105245_10266795
730 Ga0105247_10022667
731 Ga0105247_10474080
732 Ga0114129_10136536
733 Ga0105243_10172419
734 Ga0105243_10236321
735 Ga0105241_10000207
736 Ga0105241_10022060
737 Ga0105241_10071710
738 Ga0105241_10132720
739 Ga0105241_10812618
740 Ga0105242_10057833
741 Ga0105242_10314868
742 Ga0105248_10003155
743 Ga0105248_10065865
744 Ga0105248_10103342
745 Ga0105248_10552377
746 Ga0105248_10766968
747 Ga0105248_12019534
748 Ga0105237_10024339
749 Ga0105238_10000848
750 Ga0105249_10016178
751 Ga0105249_11008726
752 Ga0099796_10002244
753 Ga0099796_10220394
754 Ga0105239_10135553
755 Ga0157373_10026444
756 Ga0157373_10329459
757 Ga0157373_10398272
758 Ga0157371_10126761
759 Ga0157371_10132339
760 Ga0157371_10722396
761 Ga0157370_10041920
762 Ga0157370_10136073
763 Ga0157369_10000124
764 Ga0157369_10002390
765 Ga0157369_10035151
766 Ga0157369_10303484
767 Ga0157369_10374488
768 Ga0157369_10399210
769 Ga0157374_10000162
770 Ga0157374_10000667
771 Ga0157374_10001625
772 Ga0157374_10013807
773 Ga0157374_10138030
774 Ga0157374_11619040
775 Ga0157378_10000020
776 Ga0157378_10000320
777 Ga0157378_10421120
778 Ga0157372_10000084
779 Ga0157372_10001005
780 Ga0157372_10001112
781 Ga0157372_10024090
782 Ga0157372_10077139
783 Ga0157372_10128565
784 Ga0157372_10385370
785 Ga0157372_10417601
786 Ga0157372_10803907
787 Ga0157372_11959830
788 Ga0157375_10485649
789 Ga0157375_10616132
790 Ga0163163_10167540
791 Ga0182008_10118048
792 Ga0157377_10529244
793 Ga0157379_10128917
794 Ga0157379_10269320
795 Ga0157376_10000023
796 Ga0157376_10045297
797 Ga0157376_10046895
798 Ga0157376_10248677
799 Ga0213875_10345991
800 Ga0207642_10081615
801 Ga0207642_10133813
802 Ga0207710_10148307
803 Ga0207699_10002455
804 Ga0207643_10061981
805 Ga0207705_10071545
806 Ga0207705_10674979
807 Ga0207684_10004037
808 Ga0207684_10053022
809 Ga0207684_10056991
810 Ga0207684_10296359
811 Ga0207684_11060888
812 Ga0207654_10001292
813 Ga0207654_10460636
814 Ga0207707_10002183
815 Ga0207707_10005146
816 Ga0207707_10209575
817 Ga0207695_10059853
818 Ga0207695_10134812
819 Ga0207695_10138070
820 Ga0207695_10220309
821 Ga0207695_10507463
822 Ga0207695_10687561
823 Ga0207671_10213215
824 Ga0207671_10527295
825 Ga0207693_10020109
826 Ga0207693_10024857
827 Ga0207693_10042906
828 Ga0207693_10157842
829 Ga0207693_10242309
830 Ga0207693_10310341
831 Ga0207693_10314653
832 Ga0207663_10023504
833 Ga0207663_10062269
834 Ga0207663_10242845
835 Ga0207663_10326758
836 Ga0207663_10505262
837 Ga0207657_10273261
838 Ga0207649_10043353
839 Ga0207652_10004418
840 Ga0207652_10021634
841 Ga0207652_10206774
842 Ga0207646_10002047
843 Ga0207646_10032915
844 Ga0207694_10000434
845 Ga0207650_10000976
846 Ga0207659_10467634
847 Ga0207700_10019857
848 Ga0207700_10020153
849 Ga0207700_10032487
850 Ga0207700_10042295
851 Ga0207700_10069404
852 Ga0207700_10081294
853 Ga0207700_10093857
854 Ga0207700_10299331
855 Ga0207664_10024972
856 Ga0207690_10116194
857 Ga0207690_10174301
858 Ga0207709_10275388
859 Ga0207670_10215094
860 Ga0207704_10182856
861 Ga0207704_10370061
862 Ga0207665_10000556
863 Ga0207665_10002878
864 Ga0207665_10136646
865 Ga0207665_10251151
866 Ga0207711_10032769
867 Ga0207711_10102800
868 Ga0207711_10419814
869 Ga0207689_10028604
870 Ga0207661_10051439
871 Ga0207661_10678824
872 Ga0207661_10728896
873 Ga0207679_10029021
874 Ga0207667_10000591
875 Ga0207667_10021571
876 Ga0207667_10033618
877 Ga0207667_10138730
878 Ga0207667_10789048
879 Ga0207712_10417399
880 Ga0207640_10015658
881 Ga0207640_10817612
882 Ga0207677_10012856
883 Ga0207677_10031938
884 Ga0207677_10068336
885 Ga0207703_10013497
886 Ga0207703_10023687
887 Ga0207703_10042596
888 Ga0207703_10082609
889 Ga0207639_10038473
890 Ga0207639_10137685
891 Ga0207702_10000114
892 Ga0207702_10004430
893 Ga0207702_10016226
894 Ga0207702_10021789
895 Ga0207702_10038302
896 Ga0207702_10116383
897 Ga0207641_10004416
898 Ga0207641_10006671
899 Ga0207641_10108879
900 Ga0207641_10254174
901 Ga0207641_10795685
902 Ga0207676_10025253
903 Ga0207676_10223818
904 Ga0207674_10000860
905 Ga0207674_10001389
906 Ga0207674_10984281
907 Ga0207675_100270870
908 Ga0207698_10021391
909 Ga0207698_10467084
910 Ga0209588_1070959
911 Ga0268266_10000204
912 Ga0268266_10184238
913 Ga0268266_10436498
914 Ga0268264_10143469
915 Ga0268264_10339201
916 Ga0268264_10390535
917 Ga0268264_10801512
918 Ga0268264_10883386
919 Ga0265334_10033899
920 Ga0265318_10017503
921 Ga0265336_10081779
922 Ga0265338_10022309
923 Ga0265338_10070630
924 Ga0265338_10096089
925 Ga0265338_10281647
926 Ga0265324_10023221
927 Ga0316182_1270272
928 Ga0265330_10001092
929 Ga0265332_10310999
930 Ga0265328_10001524
931 Ga0265328_10235932
932 Ga0265320_10006234
933 Ga0265320_10011855
934 Ga0265325_10001008
935 Ga0265325_10276784
936 Ga0265329_10111994
937 Ga0265329_10149485
938 Ga0265340_10001788
939 Ga0265339_10007711
940 Ga0265339_10016611
941 Ga0265339_10092550
942 Ga0265331_10029372
943 Ga0265331_10083017
944 Ga0265316_10001309
945 Ga0265316_10003468
946 Ga0265316_10011051
947 Ga0265313_10004181
948 Ga0265314_10000162
949 Ga0265314_10006038
950 Ga0265314_10089126
951 Ga0265342_10000816
952 Ga0265342_10149794
953 Ga0373928_0184601
954 Ga0373944_0059996
955 Ga0373932_0034992
956 Ga0373936_0021449
957 Ga0373936_0287821
958 Ga0373953_0017372
959 Ga0373954_0018941
960 Ga0373956_0067478
961 Ga0373957_0030112
962 Ga0373960_0015981
963 Ga0373943_0137277
964 Ga0373946_0392033
965 Ga0373955_0001416
966 Ga0373924_0286803
967 Ga0373931_0150486
968 Ga0373935_0003735
969 Ga0373935_0044416
970 Ga0373927_0021060
971 Ga0373927_0101231
972 Ga0373927_0114443
973 Ga0373933_0000231
974 Ga0373947_0002800
975 Ga0373947_0003087
976 Ga0373937_0008629
977 Ga0373925_0005289
978 Ga0373925_0005802
979 Ga0373925_0099255
980 Ga0395900_1303873
981 Ga0395898_0346471
982 Ga0395898_1167918
983 Ga0395905_0055416
984 Ga0395905_0099180
985 Ga0436364_0017915
986 Ga0436364_0174993
987 Ga0436364_1481004
988 Ga0395901_0819517
989 Ga0436365_1197618
990 Ga0436365_1582809
991 Ga0436362_1047476
992 Ga0466966_0277298
993 Ga0466961_0113332
994 Ga0466963_0266980
995 Ga0466957_1052055
996 Ga0466959_0227875
997 Ga0451576_0978716
998 Ga0495592_0196153
999 Ga0495592_0407245
1000 Ga0495592_0604395
1001 Ga0495641_0030216
1002 Ga0495651_0022576
1003 Ga0495653_0710967
1004 Ga0495580_0002272
1005 Ga0495580_0007720
1006 Ga0495580_0023143
1007 Ga0495580_0056801
1008 Ga0495580_0218778
1009 Ga0495582_0000074
1010 Ga0495582_0009132
1011 Ga0495582_0380853
1012 Ga0495664_0022020
1013 Ga0495664_0291888
1014 Ga0495594_0638944
1015 Ga0495608_0010050
1016 Ga0495618_0025507
1017 Ga0495628_0081741
1018 Ga0495630_0004428
1019 Ga0495630_0125294
1020 Ga0495630_0126245
1021 Ga0495666_0078519
1022 Ga0495652_0003676
1023 Ga0495652_0022599
1024 Ga0495665_0002866
1025 Ga0495665_0040840
1026 Ga0495665_0044348
1027 Ga0495665_0272837
1028 Ga0495640_0075463
1029 Ga0495640_0139549
1030 Ga0495586_0468945
1031 Ga0495645_0211756
1032 Ga0495622_0215033
1033 Ga0495667_0093203
1034 Ga0495667_0361091
1035 Ga0495634_0114430
1036 Ga0495635_0161844
1037 Ga0495623_0009448
1038 Ga0495623_0056137
1039 Ga0495646_0004591
1040 Ga0495658_0719655
1041 Ga0495613_0131026
1042 Ga0495613_0311957
1043 Ga0495613_0319929
1044 Ga0495624_0012771
1045 Ga0495604_0003148
1046 Ga0495604_0191949
1047 Ga0495674_0054235
1048 Ga0495674_0108059
1049 Ga0495674_0379171
1050 Ga0495674_0490751
1051 Ga0495674_0607891
1052 Ga0495680_0050855
1053 Ga0495675_0374889
1054 Ga0495684_0014804
1055 Ga0495684_0044337
1056 Ga0495593_0073382
1057 Ga0495602_0020548
1058 Ga0495602_0091176
1059 Ga0496102_0092913
1060 Ga0496109_0942718
1061 Ga0496112_0003224
1062 Ga0496112_0077460
1063 Ga0496112_0080459
1064 Ga0496113_0414914
1065 Ga0496114_0040729
1066 Ga0496115_0014532
1067 Ga0496115_0016242
1068 Ga0496115_0531727
1069 Ga0501034_0056548
1070 Ga0501036_0264449
1071 Ga0501038_0066368
1072 Ga0501039_0508993
1073 Ga0501043_0029710
1074 Ga0501046_0080176
1075 Ga0501047_0137545
1076 Ga0501070_0003207
1077 Ga0501073_0218314
1078 Ga0501075_0999363
1079 Ga0501035_0030776
1080 Ga0501044_0149083
1081 nmdc:mga06r32_596970_c1
1082 nmdc:mga0n895_1460343_c1
1083 nmdc:mga0n895_176562_c1
1084 nmdc:mga0n895_22392_c1
1085 nmdc:mga0n895_574981_c1
1086 nmdc:mga0rr50_110968_c1
1087 nmdc:mga0rr50_14900_c1
1088 nmdc:mga0rr50_293068_c1
1089 nmdc:mga08x19_1062335_c1
1090 nmdc:mga08x19_11346_c1
1091 Ga0500604_0181820
1092 Ga0501082_1140828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07609

DUF1572

Protein of unknown function (DUF1572)

55

210

0.97

PF12867

DinB_2

DinB superfamily

65

189

0.9

PF04978

DUF664

Protein of unknown function (DUF664)

69

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7512 10 143
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.7468 10 151
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7466 11 145
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7404 2 152
2qnl-assembly1.cif.gz_A-2 crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.7392 9 148
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7466 11 145 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7394 10 151 1.20.120.450
2qnlA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7311 9 148 1.20.120.450
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7136 5 151 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7111 10 151 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9FJG2-F1-model_v4 DUF1572 domain-containing protein 0.9778 1 150
AF-A0A4U3AX87-F1-model_v4 deleted 0.9733 17 148
AF-A0A855BLG0-F1-model_v4 deleted 0.9719 9 176
AF-A0A2V9FJG2-F1-model_v4 DUF1572 domain-containing protein 0.9714 1 150
AF-A0A4Y8Q8V5-F1-model_v4 DUF1572 domain-containing protein 0.9711 9 170

Map