F461888

General Info

Members Datasets Scaffolds Average Seq Length
545 264 1090 71

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2690604|Ga0451807_2690604_258_521
Length 87
Sequence VRHNLADRKDQITMTDHVYRVTEIVGTSPDGVDSAIRNGIARAAQTLHGLDWFEVTTIRGHLADGEVAHFQVGLKVGFRLDDNDPVS

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
160 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
161 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
162 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 2.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 7.52
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_2690604 3300041486 Bacteria 557
2 JGI25406J46586_10020805 3300003203 Bacteria 2645
3 Ga0070658_11222249 3300005327 Bacteria 653
4 Ga0070683_100380886 3300005329 Bacteria 1344
5 Ga0068869_101456329 3300005334 Bacteria 607
6 Ga0070682_100651997 3300005337 Bacteria 838
7 Ga0068868_101891849 3300005338 Bacteria 565
8 Ga0070668_100771936 3300005347 Bacteria 852
9 Ga0070674_100218893 3300005356 Bacteria 1480
10 Ga0070674_100870034 3300005356 Bacteria 783
11 Ga0070659_100919741 3300005366 Bacteria 765
12 Ga0070709_10003615 3300005434 Bacteria 8306
13 Ga0070709_11600949 3300005434 Bacteria 530
14 Ga0070714_100004430 3300005435 Bacteria 10569
15 Ga0070714_100039989 3300005435 Bacteria 3951
16 Ga0070714_100098295 3300005435 Bacteria 2575
17 Ga0070714_100241937 3300005435 Bacteria 1666
18 Ga0070714_100456033 3300005435 Bacteria 1215
19 Ga0070714_100918649 3300005435 Bacteria 850
20 Ga0070714_101454761 3300005435 Bacteria 669
21 Ga0070713_100042513 3300005436 Bacteria 3709
22 Ga0070713_100052566 3300005436 Bacteria 3373
23 Ga0070713_100073433 3300005436 Bacteria 2895
24 Ga0070713_100461236 3300005436 Bacteria 1195
25 Ga0070713_100957593 3300005436 Bacteria 825
26 Ga0070710_10002833 3300005437 Bacteria 8267
27 Ga0070710_10029727 3300005437 Bacteria 2933
28 Ga0070710_10770542 3300005437 Bacteria 685
29 Ga0070711_100060302 3300005439 Bacteria 2637
30 Ga0070711_101057544 3300005439 Bacteria 698
31 Ga0070705_100011329 3300005440 Bacteria 4494
32 Ga0070705_101588511 3300005440 Bacteria 550
33 Ga0070708_100195835 3300005445 Bacteria 1891
34 Ga0070708_100231694 3300005445 Bacteria 1733
35 Ga0070708_100389111 3300005445 Bacteria 1315
36 Ga0070708_101183925 3300005445 Bacteria 715
37 Ga0070663_101264504 3300005455 Bacteria 650
38 Ga0068867_100874933 3300005459 Bacteria 807
39 Ga0070706_100025417 3300005467 Bacteria 5450
40 Ga0070706_100025774 3300005467 Bacteria 5411
41 Ga0070706_100064937 3300005467 Bacteria 3374
42 Ga0070706_100142235 3300005467 Bacteria 2239
43 Ga0070706_100247510 3300005467 Bacteria 1664
44 Ga0070707_100002612 3300005468 Bacteria 17118
45 Ga0070707_100020960 3300005468 Bacteria 6172
46 Ga0070707_100253257 3300005468 Bacteria 1713
47 Ga0070707_100305076 3300005468 Bacteria 1547
48 Ga0070707_100616243 3300005468 Bacteria 1048
49 Ga0070707_102200729 3300005468 Bacteria 519
50 Ga0070698_100002045 3300005471 Bacteria 22412
51 Ga0070698_100113522 3300005471 Bacteria 2674
52 Ga0070698_100158742 3300005471 Bacteria 2206
53 Ga0070698_100619347 3300005471 Bacteria 1023
54 Ga0070699_101246301 3300005518 Bacteria 682
55 Ga0070684_100575481 3300005535 Bacteria 1046
56 Ga0070684_100592778 3300005535 Bacteria 1030
57 Ga0070684_101310281 3300005535 Bacteria 682
58 Ga0070697_100155504 3300005536 Bacteria 1930
59 Ga0070697_100627858 3300005536 Bacteria 945
60 Ga0070697_101044188 3300005536 Bacteria 727
61 Ga0070696_100697406 3300005546 Unclassified 827
62 Ga0070693_100031177 3300005547 Bacteria 2920
63 Ga0070665_100009571 3300005548 Bacteria 9798
64 Ga0070665_100988257 3300005548 Bacteria 854
65 Ga0068855_100002279 3300005563 Bacteria 23704
66 Ga0068854_100002389 3300005578 Bacteria 11593
67 Ga0068854_101683731 3300005578 Bacteria 579
68 Ga0068856_100011750 3300005614 Bacteria 8491
69 Ga0068856_100037157 3300005614 Bacteria 4777
70 Ga0068856_100042451 3300005614 Bacteria 4473
71 Ga0068856_101128233 3300005614 Bacteria 801
72 Ga0068856_102190090 3300005614 Bacteria 562
73 Ga0070702_100003462 3300005615 Bacteria 7063
74 Ga0068852_100021315 3300005616 Bacteria 5172
75 Ga0068852_100142084 3300005616 Bacteria 2223
76 Ga0068852_100754173 3300005616 Bacteria 986
77 Ga0068852_100798284 3300005616 Bacteria 958
78 Ga0068864_100941462 3300005618 Bacteria 854
79 Ga0068866_10100969 3300005718 Bacteria 1591
80 Ga0068870_10526971 3300005840 Bacteria 792
81 Ga0068860_100577493 3300005843 Bacteria 1128
82 Ga0081539_10000236 3300005985 Bacteria 129646
83 Ga0070717_10070675 3300006028 Bacteria 2910
84 Ga0070717_10105341 3300006028 Bacteria 2400
85 Ga0070717_10112061 3300006028 Bacteria 2328
86 Ga0070717_10122258 3300006028 Bacteria 2231
87 Ga0070717_10123626 3300006028 Bacteria 2219
88 Ga0070717_10185945 3300006028 Bacteria 1813
89 Ga0070717_10261728 3300006028 Bacteria 1530
90 Ga0070717_10445768 3300006028 Bacteria 1166
91 Ga0070717_11463592 3300006028 Bacteria 620
92 Ga0070715_10009976 3300006163 Bacteria 3369
93 Ga0070715_10273773 3300006163 Bacteria 892
94 Ga0070716_100002394 3300006173 Bacteria 8633
95 Ga0070712_100040893 3300006175 Bacteria 3180
96 Ga0070712_100082080 3300006175 Bacteria 2338
97 Ga0070712_100174264 3300006175 Bacteria 1671
98 Ga0070712_100219312 3300006175 Bacteria 1505
99 Ga0070712_100466227 3300006175 Bacteria 1054
100 Ga0075370_10680122 3300006353 Bacteria 625
101 Ga0075433_10055688 3300006852 Bacteria 3453
102 Ga0075434_100005064 3300006871 Bacteria 11965
103 Ga0075436_100024878 3300006914 Bacteria 4117
104 Ga0075436_100684874 3300006914 Bacteria 759
105 Ga0075435_100021528 3300007076 Bacteria 4960
106 Ga0075435_101405106 3300007076 Bacteria 612
107 Ga0099794_10291362 3300007265 Bacteria 845
108 Ga0099795_10431161 3300007788 Bacteria 604
109 Ga0105240_10059356 3300009093 Bacteria 4774
110 Ga0105245_10093387 3300009098 Bacteria 2772
111 Ga0105245_10349861 3300009098 Bacteria 1464
112 Ga0105245_10753317 3300009098 Bacteria 1010
113 Ga0105245_11277585 3300009098 Bacteria 783
114 Ga0105247_11410981 3300009101 Bacteria 564
115 Ga0105243_10170047 3300009148 Bacteria 1886
116 Ga0105241_10016859 3300009174 Bacteria 5361
117 Ga0105242_10021992 3300009176 Bacteria 5012
118 Ga0105242_12007922 3300009176 Bacteria 621
119 Ga0105242_12913741 3300009176 Bacteria 529
120 Ga0105248_13410054 3300009177 Bacteria 505
121 Ga0105237_10493297 3300009545 Bacteria 1231
122 Ga0105237_12248646 3300009545 Bacteria 555
123 Ga0105238_10028077 3300009551 Bacteria 5733
124 Ga0105238_12712147 3300009551 Bacteria 532
125 Ga0105249_10171392 3300009553 Bacteria 2105
126 Ga0105249_10771257 3300009553 Bacteria 1024
127 Ga0105239_10022538 3300010375 Bacteria 6943
128 Ga0105239_10948760 3300010375 Bacteria 988
129 Ga0105239_11238603 3300010375 Bacteria 860
130 Ga0105239_12203856 3300010375 Bacteria 641
131 Ga0105246_10833357 3300011119 Bacteria 821
132 Ga0157371_11043791 3300013102 Bacteria 625
133 Ga0157370_11555741 3300013104 Bacteria 594
134 Ga0157369_10144876 3300013105 Bacteria 2512
135 Ga0157369_11483539 3300013105 Bacteria 690
136 Ga0157374_10358400 3300013296 Bacteria 1450
137 Ga0157378_10011850 3300013297 Bacteria 7632
138 Ga0157378_11721203 3300013297 Bacteria 674
139 Ga0163162_10239764 3300013306 Bacteria 1944
140 Ga0157372_10188885 3300013307 Bacteria 2386
141 Ga0157372_10281703 3300013307 Bacteria 1933
142 Ga0157372_11338792 3300013307 Bacteria 826
143 Ga0157372_12512350 3300013307 Bacteria 591
144 Ga0157372_12539661 3300013307 Bacteria 588
145 Ga0157380_12054556 3300014326 Bacteria 634
146 Ga0157377_11427104 3300014745 Bacteria 547
147 Ga0163161_10329889 3300017792 Bacteria 1208
148 Ga0197907_10246229 3300020069 Bacteria 603
149 Ga0197907_11483307 3300020069 Bacteria 1436
150 Ga0206356_10746936 3300020070 Bacteria 504
151 Ga0206355_1277436 3300020076 Bacteria 558
152 Ga0206350_10670759 3300020080 Bacteria 903
153 Ga0206354_10795596 3300020081 Bacteria 844
154 Ga0206353_10151340 3300020082 Bacteria 609
155 Ga0206353_10543439 3300020082 Bacteria 1334
156 Ga0213875_10013075 3300021388 Bacteria 4084
157 Ga0213875_10038640 3300021388 Bacteria 2249
158 Ga0224712_10093734 3300022467 Bacteria 1262
159 Ga0224712_10329721 3300022467 Bacteria 718
160 Ga0224712_10552008 3300022467 Bacteria 560
161 Ga0224712_10575512 3300022467 Bacteria 549
162 Ga0207656_10422596 3300025321 Bacteria 672
163 Ga0207692_10002689 3300025898 Bacteria 6845
164 Ga0207692_10033633 3300025898 Bacteria 2475
165 Ga0207692_10254093 3300025898 Bacteria 1054
166 Ga0207642_10621516 3300025899 Unclassified 674
167 Ga0207710_10786712 3300025900 Bacteria 500
168 Ga0207688_10246385 3300025901 Bacteria 1081
169 Ga0207647_10100032 3300025904 Bacteria 1721
170 Ga0207685_10019066 3300025905 Bacteria 2254
171 Ga0207699_10001858 3300025906 Bacteria 9948
172 Ga0207699_10016827 3300025906 Bacteria 3835
173 Ga0207699_10440810 3300025906 Bacteria 933
174 Ga0207699_10623190 3300025906 Bacteria 787
175 Ga0207705_10213836 3300025909 Bacteria 1463
176 Ga0207684_10000569 3300025910 Bacteria 44877
177 Ga0207684_10042931 3300025910 Bacteria 3833
178 Ga0207684_10156683 3300025910 Bacteria 1960
179 Ga0207684_10352743 3300025910 Bacteria 1266
180 Ga0207695_10006941 3300025913 Bacteria 14542
181 Ga0207671_10001306 3300025914 Bacteria 29237
182 Ga0207693_10010051 3300025915 Bacteria 7687
183 Ga0207693_10088618 3300025915 Bacteria 2425
184 Ga0207693_10358387 3300025915 Bacteria 1141
185 Ga0207693_10394832 3300025915 Bacteria 1082
186 Ga0207693_10489957 3300025915 Bacteria 960
187 Ga0207663_10044045 3300025916 Bacteria 2737
188 Ga0207663_10100013 3300025916 Bacteria 1945
189 Ga0207663_10149745 3300025916 Bacteria 1636
190 Ga0207663_10695770 3300025916 Bacteria 804
191 Ga0207663_11036887 3300025916 Bacteria 658
192 Ga0207660_11019337 3300025917 Bacteria 675
193 Ga0207657_10397595 3300025919 Bacteria 1084
194 Ga0207646_10000193 3300025922 Bacteria 83049
195 Ga0207646_10039879 3300025922 Bacteria 4225
196 Ga0207646_10074114 3300025922 Bacteria 3041
197 Ga0207646_10075944 3300025922 Bacteria 3003
198 Ga0207646_10207480 3300025922 Bacteria 1770
199 Ga0207646_10240638 3300025922 Bacteria 1635
200 Ga0207694_10067394 3300025924 Bacteria 2794
201 Ga0207694_10080914 3300025924 Bacteria 2550
202 Ga0207687_10104096 3300025927 Bacteria 2094
203 Ga0207687_10463812 3300025927 Bacteria 1052
204 Ga0207687_10719011 3300025927 Bacteria 848
205 Ga0207700_10003244 3300025928 Bacteria 9400
206 Ga0207700_10005936 3300025928 Bacteria 7347
207 Ga0207700_10070886 3300025928 Bacteria 2681
208 Ga0207700_10263749 3300025928 Bacteria 1476
209 Ga0207700_10454620 3300025928 Bacteria 1129
210 Ga0207700_10601437 3300025928 Bacteria 979
211 Ga0207700_11797869 3300025928 Bacteria 539
212 Ga0207664_10005967 3300025929 Bacteria 8335
213 Ga0207664_10009023 3300025929 Bacteria 6983
214 Ga0207664_10051212 3300025929 Bacteria 3259
215 Ga0207664_10073509 3300025929 Bacteria 2759
216 Ga0207664_10466982 3300025929 Bacteria 1128
217 Ga0207664_10537878 3300025929 Bacteria 1048
218 Ga0207664_10920100 3300025929 Bacteria 785
219 Ga0207644_11422173 3300025931 Bacteria 582
220 Ga0207690_10982253 3300025932 Bacteria 702
221 Ga0207686_10252011 3300025934 Bacteria 1290
222 Ga0207686_11393736 3300025934 Bacteria 577
223 Ga0207709_10310760 3300025935 Bacteria 1176
224 Ga0207669_10221928 3300025937 Bacteria 1388
225 Ga0207704_10388148 3300025938 Bacteria 1098
226 Ga0207665_10003624 3300025939 Bacteria 10319
227 Ga0207665_10271329 3300025939 Bacteria 1260
228 Ga0207665_10920551 3300025939 Bacteria 694
229 Ga0207711_11232289 3300025941 Bacteria 690
230 Ga0207661_10367097 3300025944 Bacteria 1301
231 Ga0207661_12166987 3300025944 Bacteria 502
232 Ga0207679_10839556 3300025945 Bacteria 839
233 Ga0207667_10043091 3300025949 Bacteria 4790
234 Ga0207668_10427014 3300025972 Bacteria 1126
235 Ga0207668_11497614 3300025972 Bacteria 609
236 Ga0207640_10814085 3300025981 Bacteria 810
237 Ga0207640_10865783 3300025981 Bacteria 787
238 Ga0207640_11125184 3300025981 Bacteria 696
239 Ga0207677_11301168 3300026023 Unclassified 668
240 Ga0207677_12247226 3300026023 Bacteria 508
241 Ga0207639_10437165 3300026041 Bacteria 1186
242 Ga0207678_10015819 3300026067 Bacteria 6632
243 Ga0207678_10040762 3300026067 Bacteria 4026
244 Ga0207678_10963169 3300026067 Bacteria 755
245 Ga0207702_10039988 3300026078 Bacteria 3931
246 Ga0207702_10187167 3300026078 Bacteria 1910
247 Ga0207702_10627513 3300026078 Bacteria 1056
248 Ga0207702_11192297 3300026078 Bacteria 756
249 Ga0207702_11919460 3300026078 Bacteria 583
250 Ga0207648_10228510 3300026089 Unclassified 1655
251 Ga0207648_11052900 3300026089 Bacteria 762
252 Ga0207676_10274852 3300026095 Bacteria 1527
253 Ga0207676_11132334 3300026095 Bacteria 774
254 Ga0207683_11534843 3300026121 Bacteria 615
255 Ga0207698_10127567 3300026142 Bacteria 2167
256 Ga0207698_10286926 3300026142 Bacteria 1525
257 Ga0207698_10339858 3300026142 Bacteria 1414
258 Ga0207698_10715696 3300026142 Bacteria 997
259 Ga0207698_12096357 3300026142 Bacteria 579
260 Ga0209588_1253983 3300027671 Bacteria 536
261 Ga0268266_10165702 3300028379 Bacteria 2002
262 Ga0268266_10696454 3300028379 Bacteria 979
263 Ga0268266_11803244 3300028379 Bacteria 586
264 Ga0268264_12074465 3300028381 Bacteria 577
265 Ga0265336_10004704 3300028666 Bacteria 5122
266 Ga0307517_10151827 3300028786 Unclassified 1586
267 Ga0307517_10441106 3300028786 Bacteria 677
268 Ga0265338_10000175 3300028800 Bacteria 118915
269 Ga0265760_10137040 3300031090 Bacteria 795
270 Ga0307410_11291564 3300031852 Bacteria 638
271 Ga0373945_0189533 3300035116 Bacteria 850
272 Ga0373945_0199699 3300035116 Bacteria 830
273 Ga0373953_0022381 3300035117 Bacteria 2383
274 Ga0373943_0086560 3300035170 Bacteria 1616
275 Ga0373943_0812472 3300035170 Bacteria 557
276 Ga0373946_0340249 3300035171 Bacteria 748
277 Ga0373955_0078434 3300035172 Bacteria 1861
278 Ga0373955_1027914 3300035172 Bacteria 508
279 Ga0373924_0314218 3300035410 Bacteria 696
280 Ga0373931_1216744 3300035691 Bacteria 516
281 Ga0373935_0049682 3300035692 Bacteria 2659
282 Ga0373935_1499773 3300035692 Bacteria 505
283 Ga0373927_0782619 3300035695 Bacteria 630
284 Ga0373927_0878223 3300035695 Bacteria 592
285 Ga0373933_0110537 3300035724 Bacteria 1714
286 Ga0373933_0168685 3300035724 Bacteria 1392
287 Ga0373947_1168604 3300035725 Bacteria 524
288 Ga0373937_0230213 3300036401 Bacteria 1745
289 Ga0373937_0447320 3300036401 Bacteria 1227
290 Ga0372808_000547 3300036459 Bacteria 3087
291 Ga0373925_0015625 3300037068 Bacteria 5492
292 Ga0373925_1157691 3300037068 Bacteria 636
293 Ga0373925_1536347 3300037068 Bacteria 544
294 Ga0436364_1355369 3300037853 Bacteria 7247
295 Ga0439436_0048398 3300041404 Bacteria 1206
296 Ga0439438_181487 3300041405 Bacteria 500
297 Ga0439439_0015540 3300041406 Bacteria 1860
298 Ga0451789_1064750 3300041443 Bacteria 988
299 Ga0451791_0884675 3300041451 Bacteria 931
300 Ga0451791_0921622 3300041451 Bacteria 2329
301 Ga0451791_0936142 3300041451 Bacteria 647
302 Ga0451793_0473593 3300041452 Bacteria 2230
303 Ga0451797_1387150 3300041453 Bacteria 665
304 Ga0451795_0817514 3300041456 Bacteria 1155
305 Ga0451800_1690863 3300041459 Bacteria 869
306 Ga0451841_0768465 3300041498 Bacteria 732
307 Ga0451843_1527834 3300041509 Bacteria 541
308 Ga0451853_0347077 3300041512 Bacteria 10114
309 Ga0451853_2367374 3300041512 Bacteria 551
310 Ga0451853_3225939 3300041512 Bacteria 3716
311 Ga0439433_0031965 3300041999 Bacteria 1206
312 Ga0439457_000023 3300042014 Bacteria 30792
313 Ga0450894_000744 3300042131 Bacteria 5359
314 Ga0450898_065177 3300042134 Bacteria 722
315 Ga0450898_153708 3300042134 Bacteria 504
316 Ga0450899_008901 3300042135 Bacteria 1102
317 Ga0450906_003375 3300042145 Bacteria 3438
318 Ga0466969_0040492 3300044656 Bacteria 2334
319 Ga0466969_0126513 3300044656 Bacteria 1187
320 Ga0466972_0030157 3300044658 Bacteria 2670
321 Ga0466965_0164923 3300044683 Bacteria 1163
322 Ga0466966_0009102 3300044684 Bacteria 6577
323 Ga0466966_0138636 3300044684 Bacteria 1487
324 Ga0466966_0289286 3300044684 Bacteria 985
325 Ga0466961_0015286 3300044693 Bacteria 4930
326 Ga0466961_0048263 3300044693 Bacteria 2721
327 Ga0466961_0088511 3300044693 Bacteria 1956
328 Ga0466961_0903851 3300044693 Bacteria 526
329 Ga0466963_0027366 3300044694 Bacteria 3650
330 Ga0466963_0085815 3300044694 Bacteria 2138
331 Ga0466963_0173941 3300044694 Bacteria 1502
332 Ga0466963_0279931 3300044694 Bacteria 1172
333 Ga0466963_0302107 3300044694 Bacteria 1126
334 Ga0466963_0334031 3300044694 Bacteria 1067
335 Ga0466963_0407156 3300044694 Bacteria 959
336 Ga0466971_0004721 3300044719 Bacteria 5893
337 Ga0466971_0109115 3300044719 Bacteria 1276
338 Ga0466971_0235494 3300044719 Bacteria 870
339 Ga0466968_0061201 3300044735 Bacteria 1624
340 Ga0466970_0070839 3300044765 Bacteria 1875
341 Ga0466970_0074155 3300044765 Bacteria 1831
342 Ga0466970_0219058 3300044765 Bacteria 1062
343 Ga0466970_0479826 3300044765 Bacteria 715
344 Ga0466970_0554957 3300044765 Bacteria 664
345 Ga0466970_0645696 3300044765 Bacteria 615
346 Ga0466957_0251923 3300044842 Bacteria 1174
347 Ga0466957_0428074 3300044842 Bacteria 909
348 Ga0466957_0505061 3300044842 Bacteria 839
349 Ga0466957_1119385 3300044842 Bacteria 568
350 Ga0466957_1129734 3300044842 Bacteria 565
351 Ga0466957_1232501 3300044842 Bacteria 542
352 Ga0466960_0020989 3300044901 Bacteria 2902
353 Ga0466960_0634493 3300044901 Bacteria 636
354 Ga0466959_0045918 3300045049 Bacteria 3215
355 Ga0466959_0151950 3300045049 Bacteria 1632
356 Ga0466959_0164422 3300045049 Bacteria 1559
357 Ga0466959_0174840 3300045049 Bacteria 1505
358 Ga0466959_0392517 3300045049 Bacteria 944
359 Ga0466958_0020703 3300045836 Bacteria 3838
360 Ga0466958_0021338 3300045836 Bacteria 3783
361 Ga0466958_0061599 3300045836 Bacteria 2286
362 Ga0466958_0242973 3300045836 Bacteria 1150
363 Ga0466958_0316905 3300045836 Bacteria 1002
364 Ga0466958_0334066 3300045836 Bacteria 975
365 Ga0466958_0539211 3300045836 Bacteria 758
366 Ga0466958_1022606 3300045836 Bacteria 539
367 Ga0466958_1106731 3300045836 Bacteria 517
368 Ga0466967_0014446 3300045976 Bacteria 6152
369 Ga0466967_0058935 3300045976 Bacteria 3396
370 Ga0466967_0187890 3300045976 Bacteria 1951
371 Ga0466967_0333494 3300045976 Bacteria 1465
372 Ga0466967_0788229 3300045976 Bacteria 943
373 Ga0466967_0919813 3300045976 Bacteria 870
374 Ga0466967_1171370 3300045976 Bacteria 766
375 Ga0466967_1521941 3300045976 Bacteria 666
376 Ga0466967_2260762 3300045976 Bacteria 539
377 Ga0495592_0469720 3300046454 Bacteria 785
378 Ga0495592_0588029 3300046454 Bacteria 680
379 Ga0495592_0845921 3300046454 Bacteria 541
380 Ga0495603_0341518 3300046455 Bacteria 859
381 Ga0495629_0016288 3300046459 Bacteria 5334
382 Ga0495629_0160340 3300046459 Bacteria 1562
383 Ga0495651_0019981 3300046462 Bacteria 5196
384 Ga0495651_0042247 3300046462 Bacteria 3541
385 Ga0495653_0009846 3300046463 Bacteria 7816
386 Ga0495653_0191098 3300046463 Bacteria 1397
387 Ga0495664_0035678 3300046477 Bacteria 2929
388 Ga0495664_0063311 3300046477 Bacteria 2204
389 Ga0495664_0209293 3300046477 Bacteria 1181
390 Ga0495664_0686460 3300046477 Bacteria 605
391 Ga0495594_0445039 3300046499 Bacteria 737
392 Ga0495596_0194491 3300046500 Bacteria 788
393 Ga0495606_0476310 3300046507 Bacteria 635
394 Ga0495608_0250935 3300046511 Bacteria 1103
395 Ga0495618_0106797 3300046514 Bacteria 1793
396 Ga0495618_0554911 3300046514 Bacteria 687
397 Ga0495628_0052047 3300046516 Bacteria 3235
398 Ga0495628_0157114 3300046516 Unclassified 1729
399 Ga0495628_0166825 3300046516 Bacteria 1671
400 Ga0495628_0379574 3300046516 Bacteria 1035
401 Ga0495628_0651379 3300046516 Bacteria 748
402 Ga0495630_0416102 3300046517 Bacteria 1030
403 Ga0495630_1446170 3300046517 Bacteria 516
404 Ga0495652_0013821 3300046529 Bacteria 7263
405 Ga0495652_0463014 3300046529 Bacteria 885
406 Ga0495665_0014683 3300046531 Bacteria 4222
407 Ga0495665_0442315 3300046531 Bacteria 657
408 Ga0495640_0044495 3300046533 Bacteria 3086
409 Ga0495640_0077661 3300046533 Bacteria 2213
410 Ga0495586_0101678 3300046535 Bacteria 1595
411 Ga0495587_0020078 3300046536 Bacteria 4128
412 Ga0495587_0747948 3300046536 Bacteria 535
413 Ga0495645_0059876 3300046543 Bacteria 2760
414 Ga0495645_0373145 3300046543 Bacteria 914
415 Ga0495645_0622459 3300046543 Bacteria 662
416 Ga0495667_0002433 3300046559 Bacteria 12430
417 Ga0495634_0084256 3300046642 Bacteria 2073
418 Ga0495634_0290112 3300046642 Bacteria 991
419 Ga0495634_0600421 3300046642 Bacteria 639
420 Ga0495634_0706114 3300046642 Bacteria 579
421 Ga0495635_0054716 3300046663 Bacteria 2748
422 Ga0495657_0014250 3300046675 Bacteria 5841
423 Ga0495657_0251870 3300046675 Bacteria 1063
424 Ga0495599_0010625 3300046678 Bacteria 5635
425 Ga0495599_0040558 3300046678 Bacteria 2923
426 Ga0495623_0099816 3300046679 Bacteria 1770
427 Ga0495646_0086787 3300046680 Bacteria 1814
428 Ga0495646_0097620 3300046680 Bacteria 1688
429 Ga0495646_0658708 3300046680 Bacteria 529
430 Ga0495658_0062619 3300046683 Bacteria 2139
431 Ga0495613_0188002 3300046689 Bacteria 1461
432 Ga0495624_0034031 3300046690 Bacteria 3299
433 Ga0495624_0353195 3300046690 Bacteria 884
434 Ga0495649_0280279 3300046694 Bacteria 852
435 Ga0495600_0028755 3300046809 Bacteria 3597
436 Ga0495600_0178220 3300046809 Bacteria 1370
437 Ga0495604_0051517 3300047317 Bacteria 3190
438 Ga0495604_1025846 3300047317 Bacteria 509
439 Ga0495674_0006942 3300047319 Bacteria 10830
440 Ga0495674_0043866 3300047319 Bacteria 3977
441 Ga0495674_0069441 3300047319 Bacteria 3046
442 Ga0495674_0206666 3300047319 Bacteria 1627
443 Ga0495672_0297145 3300047320 Bacteria 766
444 Ga0495676_0128255 3300047321 Bacteria 1835
445 Ga0495676_0284256 3300047321 Bacteria 1119
446 Ga0495680_0019121 3300047322 Bacteria 5796
447 Ga0495683_0418005 3300047323 Bacteria 555
448 Ga0495675_0059553 3300047444 Bacteria 2421
449 Ga0495675_0423094 3300047444 Bacteria 774
450 Ga0495675_0823183 3300047444 Bacteria 513
451 Ga0495685_097793 3300047447 Bacteria 970
452 Ga0495681_0253953 3300047470 Bacteria 693
453 Ga0495684_0028271 3300047471 Bacteria 4305
454 Ga0495684_0223877 3300047471 Bacteria 1378
455 Ga0495593_0047325 3300047673 Bacteria 2288
456 Ga0495602_0064843 3300048088 Bacteria 3155
457 Ga0495602_0128316 3300048088 Bacteria 2027
458 Ga0496100_0308114 3300048903 Bacteria 1187
459 Ga0496101_0234510 3300048904 Bacteria 1427
460 Ga0496101_1040578 3300048904 Bacteria 643
461 Ga0496102_0087478 3300048905 Bacteria 2879
462 Ga0496102_1470527 3300048905 Bacteria 600
463 Ga0496104_0000863 3300048907 Bacteria 26109
464 Ga0496104_0510269 3300048907 Bacteria 1113
465 Ga0496104_1425264 3300048907 Bacteria 596
466 Ga0496105_0004042 3300048908 Bacteria 10979
467 Ga0496105_0946870 3300048908 Bacteria 647
468 Ga0496105_1063349 3300048908 Bacteria 602
469 Ga0496108_0035944 3300048911 Bacteria 4120
470 Ga0496108_0123659 3300048911 Bacteria 2220
471 Ga0496108_0553078 3300048911 Bacteria 1004
472 Ga0496108_0826145 3300048911 Bacteria 798
473 Ga0496108_1088883 3300048911 Bacteria 679
474 Ga0496109_0009561 3300048912 Bacteria 8267
475 Ga0496109_0091973 3300048912 Bacteria 2805
476 Ga0496109_1401233 3300048912 Bacteria 634
477 Ga0496110_0364743 3300048913 Bacteria 1316
478 Ga0496110_1511332 3300048913 Bacteria 581
479 Ga0496111_0440586 3300048914 Bacteria 962
480 Ga0496111_0564073 3300048914 Bacteria 835
481 Ga0496112_0015122 3300048915 Bacteria 7190
482 Ga0496112_0019425 3300048915 Bacteria 6414
483 Ga0496112_0147683 3300048915 Bacteria 2319
484 Ga0496113_0036678 3300048916 Bacteria 3593
485 Ga0496113_0523624 3300048916 Bacteria 952
486 Ga0496113_0750676 3300048916 Bacteria 777
487 Ga0496114_0380090 3300048917 Bacteria 1250
488 Ga0496114_1601706 3300048917 Bacteria 539
489 Ga0496115_0311265 3300048918 Bacteria 1289
490 Ga0501031_0009914 3300049568 Bacteria 6203
491 Ga0501032_0010998 3300049569 Bacteria 6506
492 Ga0501033_0028111 3300049570 Bacteria 4227
493 Ga0501034_0025806 3300049571 Bacteria 5984
494 Ga0501034_0158711 3300049571 Bacteria 2234
495 Ga0501036_0005982 3300049572 Bacteria 9864
496 Ga0501037_0002730 3300049573 Bacteria 12756
497 Ga0501037_0108689 3300049573 Bacteria 1998
498 Ga0501038_0008199 3300049574 Bacteria 9607
499 Ga0501038_0609074 3300049574 Bacteria 826
500 Ga0501039_0106686 3300049575 Bacteria 2188
501 Ga0501042_0018451 3300049578 Bacteria 4830
502 Ga0501042_0085593 3300049578 Bacteria 2260
503 Ga0501043_0001428 3300049579 Bacteria 20870
504 Ga0501043_0066322 3300049579 Bacteria 2834
505 Ga0501046_0051916 3300049580 Bacteria 3233
506 Ga0501046_0337288 3300049580 Bacteria 1096
507 Ga0501047_0000072 3300049581 Bacteria 126542
508 Ga0501047_0009093 3300049581 Bacteria 9381
509 Ga0501047_0318467 3300049581 Bacteria 1395
510 Ga0501048_0009290 3300049582 Bacteria 7386
511 Ga0501048_0028985 3300049582 Bacteria 4017
512 Ga0501048_0716354 3300049582 Bacteria 719
513 Ga0501069_0342075 3300049585 Bacteria 881
514 Ga0501074_0038202 3300049590 Bacteria 3479
515 Ga0501076_1460005 3300049592 Bacteria 562
516 Ga0501035_0029305 3300049822 Bacteria 5019
517 Ga0501044_0083442 3300049823 Bacteria 3231
518 Ga0501044_0140572 3300049823 Bacteria 2403
519 Ga0501044_0197650 3300049823 Bacteria 1970
520 nmdc:mga03n38_194404_c1 3300050490 Bacteria 1047
521 nmdc:mga0qj67_48634_c1 3300050509 Bacteria 3350
522 nmdc:mga0qj67_792456_c1 3300050509 Bacteria 750
523 nmdc:mga0n895_50057_c1 3300050512 Bacteria 4096
524 nmdc:mga0rr50_761043_c1 3300050513 Bacteria 827
525 nmdc:mga0rr50_880542_c1 3300050513 Bacteria 763
526 nmdc:mga08x19_492224_c1 3300050514 Bacteria 865
527 nmdc:mga08x19_56176_c1 3300050514 Bacteria 2540
528 nmdc:mga0a205_35534_c1 3300050515 Bacteria 4785
529 Ga0495601_0001283 3300053077 Bacteria 13781
530 Ga0495601_0301308 3300053077 Bacteria 1044
531 Ga0495601_0452371 3300053077 Bacteria 830
532 Ga0495601_0503562 3300053077 Bacteria 781
533 Ga0495601_1062886 3300053077 Bacteria 507
534 Ga0495612_0015360 3300053078 Bacteria 3069
535 Ga0495612_0139478 3300053078 Bacteria 1051
536 Ga0495612_0191630 3300053078 Bacteria 900
537 Ga0495655_0093829 3300053083 Bacteria 878
538 Ga0495595_0315093 3300053084 Bacteria 788
539 Ga0495619_0168620 3300053085 Bacteria 1513
540 Ga0500628_023320 3300053129 Bacteria 1275
541 Ga0501084_0050155 3300054114 Bacteria 3494
542 Ga0466962_0024547 3300061719 Bacteria 2896
543 Ga0466962_0026543 3300061719 Bacteria 2780
544 Ga0466962_0120947 3300061719 Bacteria 1263
545 Ga0466962_0686817 3300061719 Bacteria 525
546 Ga0451807_2690604
547 JGI25406J46586_10020805
548 Ga0070658_11222249
549 Ga0070683_100380886
550 Ga0068869_101456329
551 Ga0070682_100651997
552 Ga0068868_101891849
553 Ga0070668_100771936
554 Ga0070674_100218893
555 Ga0070674_100870034
556 Ga0070659_100919741
557 Ga0070709_10003615
558 Ga0070709_11600949
559 Ga0070714_100004430
560 Ga0070714_100039989
561 Ga0070714_100098295
562 Ga0070714_100241937
563 Ga0070714_100456033
564 Ga0070714_100918649
565 Ga0070714_101454761
566 Ga0070713_100042513
567 Ga0070713_100052566
568 Ga0070713_100073433
569 Ga0070713_100461236
570 Ga0070713_100957593
571 Ga0070710_10002833
572 Ga0070710_10029727
573 Ga0070710_10770542
574 Ga0070711_100060302
575 Ga0070711_101057544
576 Ga0070705_100011329
577 Ga0070705_101588511
578 Ga0070708_100195835
579 Ga0070708_100231694
580 Ga0070708_100389111
581 Ga0070708_101183925
582 Ga0070663_101264504
583 Ga0068867_100874933
584 Ga0070706_100025417
585 Ga0070706_100025774
586 Ga0070706_100064937
587 Ga0070706_100142235
588 Ga0070706_100247510
589 Ga0070707_100002612
590 Ga0070707_100020960
591 Ga0070707_100253257
592 Ga0070707_100305076
593 Ga0070707_100616243
594 Ga0070707_102200729
595 Ga0070698_100002045
596 Ga0070698_100113522
597 Ga0070698_100158742
598 Ga0070698_100619347
599 Ga0070699_101246301
600 Ga0070684_100575481
601 Ga0070684_100592778
602 Ga0070684_101310281
603 Ga0070697_100155504
604 Ga0070697_100627858
605 Ga0070697_101044188
606 Ga0070696_100697406
607 Ga0070693_100031177
608 Ga0070665_100009571
609 Ga0070665_100988257
610 Ga0068855_100002279
611 Ga0068854_100002389
612 Ga0068854_101683731
613 Ga0068856_100011750
614 Ga0068856_100037157
615 Ga0068856_100042451
616 Ga0068856_101128233
617 Ga0068856_102190090
618 Ga0070702_100003462
619 Ga0068852_100021315
620 Ga0068852_100142084
621 Ga0068852_100754173
622 Ga0068852_100798284
623 Ga0068864_100941462
624 Ga0068866_10100969
625 Ga0068870_10526971
626 Ga0068860_100577493
627 Ga0081539_10000236
628 Ga0070717_10070675
629 Ga0070717_10105341
630 Ga0070717_10112061
631 Ga0070717_10122258
632 Ga0070717_10123626
633 Ga0070717_10185945
634 Ga0070717_10261728
635 Ga0070717_10445768
636 Ga0070717_11463592
637 Ga0070715_10009976
638 Ga0070715_10273773
639 Ga0070716_100002394
640 Ga0070712_100040893
641 Ga0070712_100082080
642 Ga0070712_100174264
643 Ga0070712_100219312
644 Ga0070712_100466227
645 Ga0075370_10680122
646 Ga0075433_10055688
647 Ga0075434_100005064
648 Ga0075436_100024878
649 Ga0075436_100684874
650 Ga0075435_100021528
651 Ga0075435_101405106
652 Ga0099794_10291362
653 Ga0099795_10431161
654 Ga0105240_10059356
655 Ga0105245_10093387
656 Ga0105245_10349861
657 Ga0105245_10753317
658 Ga0105245_11277585
659 Ga0105247_11410981
660 Ga0105243_10170047
661 Ga0105241_10016859
662 Ga0105242_10021992
663 Ga0105242_12007922
664 Ga0105242_12913741
665 Ga0105248_13410054
666 Ga0105237_10493297
667 Ga0105237_12248646
668 Ga0105238_10028077
669 Ga0105238_12712147
670 Ga0105249_10171392
671 Ga0105249_10771257
672 Ga0105239_10022538
673 Ga0105239_10948760
674 Ga0105239_11238603
675 Ga0105239_12203856
676 Ga0105246_10833357
677 Ga0157371_11043791
678 Ga0157370_11555741
679 Ga0157369_10144876
680 Ga0157369_11483539
681 Ga0157374_10358400
682 Ga0157378_10011850
683 Ga0157378_11721203
684 Ga0163162_10239764
685 Ga0157372_10188885
686 Ga0157372_10281703
687 Ga0157372_11338792
688 Ga0157372_12512350
689 Ga0157372_12539661
690 Ga0157380_12054556
691 Ga0157377_11427104
692 Ga0163161_10329889
693 Ga0197907_10246229
694 Ga0197907_11483307
695 Ga0206356_10746936
696 Ga0206355_1277436
697 Ga0206350_10670759
698 Ga0206354_10795596
699 Ga0206353_10151340
700 Ga0206353_10543439
701 Ga0213875_10013075
702 Ga0213875_10038640
703 Ga0224712_10093734
704 Ga0224712_10329721
705 Ga0224712_10552008
706 Ga0224712_10575512
707 Ga0207656_10422596
708 Ga0207692_10002689
709 Ga0207692_10033633
710 Ga0207692_10254093
711 Ga0207642_10621516
712 Ga0207710_10786712
713 Ga0207688_10246385
714 Ga0207647_10100032
715 Ga0207685_10019066
716 Ga0207699_10001858
717 Ga0207699_10016827
718 Ga0207699_10440810
719 Ga0207699_10623190
720 Ga0207705_10213836
721 Ga0207684_10000569
722 Ga0207684_10042931
723 Ga0207684_10156683
724 Ga0207684_10352743
725 Ga0207695_10006941
726 Ga0207671_10001306
727 Ga0207693_10010051
728 Ga0207693_10088618
729 Ga0207693_10358387
730 Ga0207693_10394832
731 Ga0207693_10489957
732 Ga0207663_10044045
733 Ga0207663_10100013
734 Ga0207663_10149745
735 Ga0207663_10695770
736 Ga0207663_11036887
737 Ga0207660_11019337
738 Ga0207657_10397595
739 Ga0207646_10000193
740 Ga0207646_10039879
741 Ga0207646_10074114
742 Ga0207646_10075944
743 Ga0207646_10207480
744 Ga0207646_10240638
745 Ga0207694_10067394
746 Ga0207694_10080914
747 Ga0207687_10104096
748 Ga0207687_10463812
749 Ga0207687_10719011
750 Ga0207700_10003244
751 Ga0207700_10005936
752 Ga0207700_10070886
753 Ga0207700_10263749
754 Ga0207700_10454620
755 Ga0207700_10601437
756 Ga0207700_11797869
757 Ga0207664_10005967
758 Ga0207664_10009023
759 Ga0207664_10051212
760 Ga0207664_10073509
761 Ga0207664_10466982
762 Ga0207664_10537878
763 Ga0207664_10920100
764 Ga0207644_11422173
765 Ga0207690_10982253
766 Ga0207686_10252011
767 Ga0207686_11393736
768 Ga0207709_10310760
769 Ga0207669_10221928
770 Ga0207704_10388148
771 Ga0207665_10003624
772 Ga0207665_10271329
773 Ga0207665_10920551
774 Ga0207711_11232289
775 Ga0207661_10367097
776 Ga0207661_12166987
777 Ga0207679_10839556
778 Ga0207667_10043091
779 Ga0207668_10427014
780 Ga0207668_11497614
781 Ga0207640_10814085
782 Ga0207640_10865783
783 Ga0207640_11125184
784 Ga0207677_11301168
785 Ga0207677_12247226
786 Ga0207639_10437165
787 Ga0207678_10015819
788 Ga0207678_10040762
789 Ga0207678_10963169
790 Ga0207702_10039988
791 Ga0207702_10187167
792 Ga0207702_10627513
793 Ga0207702_11192297
794 Ga0207702_11919460
795 Ga0207648_10228510
796 Ga0207648_11052900
797 Ga0207676_10274852
798 Ga0207676_11132334
799 Ga0207683_11534843
800 Ga0207698_10127567
801 Ga0207698_10286926
802 Ga0207698_10339858
803 Ga0207698_10715696
804 Ga0207698_12096357
805 Ga0209588_1253983
806 Ga0268266_10165702
807 Ga0268266_10696454
808 Ga0268266_11803244
809 Ga0268264_12074465
810 Ga0265336_10004704
811 Ga0307517_10151827
812 Ga0307517_10441106
813 Ga0265338_10000175
814 Ga0265760_10137040
815 Ga0307410_11291564
816 Ga0373945_0189533
817 Ga0373945_0199699
818 Ga0373953_0022381
819 Ga0373943_0086560
820 Ga0373943_0812472
821 Ga0373946_0340249
822 Ga0373955_0078434
823 Ga0373955_1027914
824 Ga0373924_0314218
825 Ga0373931_1216744
826 Ga0373935_0049682
827 Ga0373935_1499773
828 Ga0373927_0782619
829 Ga0373927_0878223
830 Ga0373933_0110537
831 Ga0373933_0168685
832 Ga0373947_1168604
833 Ga0373937_0230213
834 Ga0373937_0447320
835 Ga0372808_000547
836 Ga0373925_0015625
837 Ga0373925_1157691
838 Ga0373925_1536347
839 Ga0436364_1355369
840 Ga0439436_0048398
841 Ga0439438_181487
842 Ga0439439_0015540
843 Ga0451789_1064750
844 Ga0451791_0884675
845 Ga0451791_0921622
846 Ga0451791_0936142
847 Ga0451793_0473593
848 Ga0451797_1387150
849 Ga0451795_0817514
850 Ga0451800_1690863
851 Ga0451841_0768465
852 Ga0451843_1527834
853 Ga0451853_0347077
854 Ga0451853_2367374
855 Ga0451853_3225939
856 Ga0439433_0031965
857 Ga0439457_000023
858 Ga0450894_000744
859 Ga0450898_065177
860 Ga0450898_153708
861 Ga0450899_008901
862 Ga0450906_003375
863 Ga0466969_0040492
864 Ga0466969_0126513
865 Ga0466972_0030157
866 Ga0466965_0164923
867 Ga0466966_0009102
868 Ga0466966_0138636
869 Ga0466966_0289286
870 Ga0466961_0015286
871 Ga0466961_0048263
872 Ga0466961_0088511
873 Ga0466961_0903851
874 Ga0466963_0027366
875 Ga0466963_0085815
876 Ga0466963_0173941
877 Ga0466963_0279931
878 Ga0466963_0302107
879 Ga0466963_0334031
880 Ga0466963_0407156
881 Ga0466971_0004721
882 Ga0466971_0109115
883 Ga0466971_0235494
884 Ga0466968_0061201
885 Ga0466970_0070839
886 Ga0466970_0074155
887 Ga0466970_0219058
888 Ga0466970_0479826
889 Ga0466970_0554957
890 Ga0466970_0645696
891 Ga0466957_0251923
892 Ga0466957_0428074
893 Ga0466957_0505061
894 Ga0466957_1119385
895 Ga0466957_1129734
896 Ga0466957_1232501
897 Ga0466960_0020989
898 Ga0466960_0634493
899 Ga0466959_0045918
900 Ga0466959_0151950
901 Ga0466959_0164422
902 Ga0466959_0174840
903 Ga0466959_0392517
904 Ga0466958_0020703
905 Ga0466958_0021338
906 Ga0466958_0061599
907 Ga0466958_0242973
908 Ga0466958_0316905
909 Ga0466958_0334066
910 Ga0466958_0539211
911 Ga0466958_1022606
912 Ga0466958_1106731
913 Ga0466967_0014446
914 Ga0466967_0058935
915 Ga0466967_0187890
916 Ga0466967_0333494
917 Ga0466967_0788229
918 Ga0466967_0919813
919 Ga0466967_1171370
920 Ga0466967_1521941
921 Ga0466967_2260762
922 Ga0495592_0469720
923 Ga0495592_0588029
924 Ga0495592_0845921
925 Ga0495603_0341518
926 Ga0495629_0016288
927 Ga0495629_0160340
928 Ga0495651_0019981
929 Ga0495651_0042247
930 Ga0495653_0009846
931 Ga0495653_0191098
932 Ga0495664_0035678
933 Ga0495664_0063311
934 Ga0495664_0209293
935 Ga0495664_0686460
936 Ga0495594_0445039
937 Ga0495596_0194491
938 Ga0495606_0476310
939 Ga0495608_0250935
940 Ga0495618_0106797
941 Ga0495618_0554911
942 Ga0495628_0052047
943 Ga0495628_0157114
944 Ga0495628_0166825
945 Ga0495628_0379574
946 Ga0495628_0651379
947 Ga0495630_0416102
948 Ga0495630_1446170
949 Ga0495652_0013821
950 Ga0495652_0463014
951 Ga0495665_0014683
952 Ga0495665_0442315
953 Ga0495640_0044495
954 Ga0495640_0077661
955 Ga0495586_0101678
956 Ga0495587_0020078
957 Ga0495587_0747948
958 Ga0495645_0059876
959 Ga0495645_0373145
960 Ga0495645_0622459
961 Ga0495667_0002433
962 Ga0495634_0084256
963 Ga0495634_0290112
964 Ga0495634_0600421
965 Ga0495634_0706114
966 Ga0495635_0054716
967 Ga0495657_0014250
968 Ga0495657_0251870
969 Ga0495599_0010625
970 Ga0495599_0040558
971 Ga0495623_0099816
972 Ga0495646_0086787
973 Ga0495646_0097620
974 Ga0495646_0658708
975 Ga0495658_0062619
976 Ga0495613_0188002
977 Ga0495624_0034031
978 Ga0495624_0353195
979 Ga0495649_0280279
980 Ga0495600_0028755
981 Ga0495600_0178220
982 Ga0495604_0051517
983 Ga0495604_1025846
984 Ga0495674_0006942
985 Ga0495674_0043866
986 Ga0495674_0069441
987 Ga0495674_0206666
988 Ga0495672_0297145
989 Ga0495676_0128255
990 Ga0495676_0284256
991 Ga0495680_0019121
992 Ga0495683_0418005
993 Ga0495675_0059553
994 Ga0495675_0423094
995 Ga0495675_0823183
996 Ga0495685_097793
997 Ga0495681_0253953
998 Ga0495684_0028271
999 Ga0495684_0223877
1000 Ga0495593_0047325
1001 Ga0495602_0064843
1002 Ga0495602_0128316
1003 Ga0496100_0308114
1004 Ga0496101_0234510
1005 Ga0496101_1040578
1006 Ga0496102_0087478
1007 Ga0496102_1470527
1008 Ga0496104_0000863
1009 Ga0496104_0510269
1010 Ga0496104_1425264
1011 Ga0496105_0004042
1012 Ga0496105_0946870
1013 Ga0496105_1063349
1014 Ga0496108_0035944
1015 Ga0496108_0123659
1016 Ga0496108_0553078
1017 Ga0496108_0826145
1018 Ga0496108_1088883
1019 Ga0496109_0009561
1020 Ga0496109_0091973
1021 Ga0496109_1401233
1022 Ga0496110_0364743
1023 Ga0496110_1511332
1024 Ga0496111_0440586
1025 Ga0496111_0564073
1026 Ga0496112_0015122
1027 Ga0496112_0019425
1028 Ga0496112_0147683
1029 Ga0496113_0036678
1030 Ga0496113_0523624
1031 Ga0496113_0750676
1032 Ga0496114_0380090
1033 Ga0496114_1601706
1034 Ga0496115_0311265
1035 Ga0501031_0009914
1036 Ga0501032_0010998
1037 Ga0501033_0028111
1038 Ga0501034_0025806
1039 Ga0501034_0158711
1040 Ga0501036_0005982
1041 Ga0501037_0002730
1042 Ga0501037_0108689
1043 Ga0501038_0008199
1044 Ga0501038_0609074
1045 Ga0501039_0106686
1046 Ga0501042_0018451
1047 Ga0501042_0085593
1048 Ga0501043_0001428
1049 Ga0501043_0066322
1050 Ga0501046_0051916
1051 Ga0501046_0337288
1052 Ga0501047_0000072
1053 Ga0501047_0009093
1054 Ga0501047_0318467
1055 Ga0501048_0009290
1056 Ga0501048_0028985
1057 Ga0501048_0716354
1058 Ga0501069_0342075
1059 Ga0501074_0038202
1060 Ga0501076_1460005
1061 Ga0501035_0029305
1062 Ga0501044_0083442
1063 Ga0501044_0140572
1064 Ga0501044_0197650
1065 nmdc:mga03n38_194404_c1
1066 nmdc:mga0qj67_48634_c1
1067 nmdc:mga0qj67_792456_c1
1068 nmdc:mga0n895_50057_c1
1069 nmdc:mga0rr50_761043_c1
1070 nmdc:mga0rr50_880542_c1
1071 nmdc:mga08x19_492224_c1
1072 nmdc:mga08x19_56176_c1
1073 nmdc:mga0a205_35534_c1
1074 Ga0495601_0001283
1075 Ga0495601_0301308
1076 Ga0495601_0452371
1077 Ga0495601_0503562
1078 Ga0495601_1062886
1079 Ga0495612_0015360
1080 Ga0495612_0139478
1081 Ga0495612_0191630
1082 Ga0495655_0093829
1083 Ga0495595_0315093
1084 Ga0495619_0168620
1085 Ga0500628_023320
1086 Ga0501084_0050155
1087 Ga0466962_0024547
1088 Ga0466962_0026543
1089 Ga0466962_0120947
1090 Ga0466962_0686817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

18

81

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9873 3 68
6ri3-assembly1.cif.gz_A dodecin from streptomyces davaonensis 0.9841 2 69
2cz8-assembly1.cif.gz_D crystal structure of tt0972 protein from thermus thermophilus 0.9743 4 69
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9728 3 68
2ux9-assembly1.cif.gz_C crystal structure of the t. thermophilus dodecin r65a mutant 0.9724 4 69
ID Description Score Start End Superfamily
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.966 1 69 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9473 5 68 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9396 1 69 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9328 5 68 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8415 5 72 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A2E6QJ45-F1-model_v4 Dodecin flavoprotein 1.004 3 69
AF-A0A081BEH8-F1-model_v4 Dodecin flavoprotein 1.003 3 68
AF-A0A6J7L1M2-F1-model_v4 Unannotated protein 1.002 3 70
AF-A0A2T5IU02-F1-model_v4 Flavin-binding protein dodecin 1 3 68
AF-A0A7V1APY1-F1-model_v4 Dodecin domain-containing protein 1 3 67

Map