F461770

General Info

Members Datasets Scaffolds Average Seq Length
544 303 1088 115

Family's Representative Sequence

Representative Sequence 3300046473|Ga0495582_0112058|Ga0495582_0112058_442_861
Length 139
Sequence MTMSDCLFCKIISRDIPASIVYEDDQLVAVNDINPPAPTHVLVIPKRHIATLADVRPEDDQLVGEMVRRAAAIAKERGLSAGGFRTVFNTNRDAGQTVFHIHLHLLGGRPMHWPPGYPGRARQRTSRHATVARMNWVSG

Samples

Sample ID Description Type Environment
1 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
170 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
175 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
176 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
177 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
180 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
301 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 4.23
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495582_0112058 3300046473 Unclassified 1533
2 JGI25406J46586_10011128 3300003203 Bacteria 3956
3 JGI25407J50210_10019143 3300003373 Bacteria 1779
4 JGI25407J50210_10025016 3300003373 Bacteria 1548
5 JGI25407J50210_10120895 3300003373 Bacteria 645
6 JGI25407J50210_10146150 3300003373 Bacteria 582
7 Ga0065712_10037756 3300005290 Bacteria 1005
8 Ga0065715_10152577 3300005293 Bacteria 1712
9 Ga0065707_10217439 3300005295 Bacteria 1211
10 Ga0070676_10499603 3300005328 Unclassified 863
11 Ga0070689_100473494 3300005340 Bacteria 1069
12 Ga0070687_100762126 3300005343 Bacteria 682
13 Ga0070668_100036944 3300005347 Bacteria 3728
14 Ga0070669_100676823 3300005353 Bacteria 870
15 Ga0070669_101768234 3300005353 Bacteria 539
16 Ga0070675_100166799 3300005354 Bacteria 1897
17 Ga0070671_100003230 3300005355 Bacteria 12709
18 Ga0070671_101299736 3300005355 Bacteria 641
19 Ga0070688_100844282 3300005365 Bacteria 719
20 Ga0070667_100440242 3300005367 Bacteria 1190
21 Ga0070709_11615352 3300005434 Bacteria 528
22 Ga0070713_100009539 3300005436 Bacteria 6957
23 Ga0070713_100192121 3300005436 Unclassified 1840
24 Ga0070701_10200925 3300005438 Bacteria 1178
25 Ga0070711_100010241 3300005439 Bacteria 5797
26 Ga0070705_100541247 3300005440 Bacteria 891
27 Ga0070700_100698832 3300005441 Unclassified 806
28 Ga0070694_100006883 3300005444 Bacteria 6908
29 Ga0070694_100027500 3300005444 Bacteria 3694
30 Ga0070663_100350131 3300005455 Bacteria 1196
31 Ga0070662_100020527 3300005457 Bacteria 4499
32 Ga0070681_10025861 3300005458 Bacteria 5901
33 Ga0070681_10566944 3300005458 Bacteria 1049
34 Ga0070707_100047499 3300005468 Bacteria 4110
35 Ga0070707_100048543 3300005468 Bacteria 4066
36 Ga0070707_101743454 3300005468 Bacteria 590
37 Ga0070698_100696254 3300005471 Bacteria 958
38 Ga0070699_100823387 3300005518 Bacteria 850
39 Ga0070679_100017101 3300005530 Bacteria 7011
40 Ga0070679_100884448 3300005530 Unclassified 837
41 Ga0070697_102028002 3300005536 Bacteria 515
42 Ga0070686_100150369 3300005544 Bacteria 1630
43 Ga0070695_100005839 3300005545 Bacteria 7261
44 Ga0070695_100034857 3300005545 Bacteria 3159
45 Ga0070696_100050215 3300005546 Bacteria 2899
46 Ga0070665_100292974 3300005548 Bacteria 1630
47 Ga0070704_100004225 3300005549 Bacteria 8296
48 Ga0070704_100223376 3300005549 Bacteria 1532
49 Ga0068854_100189650 3300005578 Bacteria 1610
50 Ga0068852_100671529 3300005616 Bacteria 1045
51 Ga0068852_101035925 3300005616 Bacteria 840
52 Ga0068859_100012469 3300005617 Bacteria 8550
53 Ga0068864_101780357 3300005618 Bacteria 621
54 Ga0068861_100098440 3300005719 Bacteria 2321
55 Ga0068861_100278850 3300005719 Bacteria 1438
56 Ga0068863_100346708 3300005841 Bacteria 1445
57 Ga0068858_100000970 3300005842 Bacteria 29675
58 Ga0068860_100482655 3300005843 Bacteria 1235
59 Ga0068860_102417481 3300005843 Bacteria 545
60 Ga0081455_10017711 3300005937 Bacteria 6816
61 Ga0081455_10167521 3300005937 Bacteria 1677
62 Ga0081455_10385438 3300005937 Bacteria 978
63 Ga0081538_10003944 3300005981 Bacteria 13835
64 Ga0081538_10009055 3300005981 Bacteria 8355
65 Ga0081538_10014534 3300005981 Bacteria 6155
66 Ga0081538_10015010 3300005981 Bacteria 6026
67 Ga0081538_10021953 3300005981 Bacteria 4640
68 Ga0081538_10025381 3300005981 Bacteria 4182
69 Ga0081538_10056576 3300005981 Bacteria 2296
70 Ga0081538_10061295 3300005981 Bacteria 2154
71 Ga0081538_10074014 3300005981 Bacteria 1857
72 Ga0081538_10128950 3300005981 Bacteria 1194
73 Ga0081538_10142537 3300005981 Bacteria 1102
74 Ga0081538_10278943 3300005981 Bacteria 622
75 Ga0081540_1019861 3300005983 Bacteria 4065
76 Ga0081539_10003396 3300005985 Bacteria 19663
77 Ga0081539_10010793 3300005985 Bacteria 7350
78 Ga0081539_10064639 3300005985 Bacteria 1990
79 Ga0081539_10434026 3300005985 Bacteria 545
80 Ga0070717_10091420 3300006028 Bacteria 2570
81 Ga0075365_10000564 3300006038 Bacteria 14367
82 Ga0075368_10185464 3300006042 Bacteria 878
83 Ga0075363_100050508 3300006048 Bacteria 2216
84 Ga0075364_10018720 3300006051 Bacteria 4340
85 Ga0075364_10394873 3300006051 Bacteria 944
86 Ga0075432_10022471 3300006058 Bacteria 2157
87 Ga0070716_100105514 3300006173 Unclassified 1736
88 Ga0070712_100256938 3300006175 Bacteria 1398
89 Ga0070712_100362321 3300006175 Bacteria 1189
90 Ga0075367_10001454 3300006178 Bacteria 10207
91 Ga0075427_10006498 3300006194 Bacteria 1695
92 Ga0075370_10000155 3300006353 Bacteria 23294
93 Ga0068871_100006190 3300006358 Bacteria 8436
94 Ga0075428_100398848 3300006844 Bacteria 1474
95 Ga0075430_100014244 3300006846 Bacteria 6780
96 Ga0075430_100346148 3300006846 Bacteria 1228
97 Ga0075431_100144199 3300006847 Bacteria 2454
98 Ga0075431_100342937 3300006847 Unclassified 1503
99 Ga0075433_10307764 3300006852 Bacteria 1403
100 Ga0075433_11492989 3300006852 Bacteria 584
101 Ga0075434_100027928 3300006871 Bacteria 5539
102 Ga0075434_100153201 3300006871 Bacteria 2325
103 Ga0075434_100425560 3300006871 Bacteria 1349
104 Ga0075434_100701612 3300006871 Bacteria 1029
105 Ga0075434_101489876 3300006871 Bacteria 686
106 Ga0075429_100005090 3300006880 Bacteria 11302
107 Ga0075429_100009371 3300006880 Bacteria 8500
108 Ga0075429_100171474 3300006880 Bacteria 1900
109 Ga0068865_100555981 3300006881 Bacteria 964
110 Ga0097620_100012469 3300006931 Bacteria 8550
111 Ga0075435_100298029 3300007076 Bacteria 1379
112 Ga0105240_10316671 3300009093 Bacteria 1779
113 Ga0105240_11034896 3300009093 Bacteria 877
114 Ga0111539_10031720 3300009094 Bacteria 6419
115 Ga0111539_11040768 3300009094 Bacteria 952
116 Ga0105245_11341323 3300009098 Bacteria 765
117 Ga0105247_10037625 3300009101 Bacteria 2952
118 Ga0114129_10036820 3300009147 Bacteria 6909
119 Ga0114129_10248506 3300009147 Bacteria 2389
120 Ga0114129_10376143 3300009147 Bacteria 1877
121 Ga0114129_10690835 3300009147 Bacteria 1312
122 Ga0114129_10800752 3300009147 Bacteria 1202
123 Ga0105242_10120271 3300009176 Bacteria 2252
124 Ga0105248_10047293 3300009177 Bacteria 4825
125 Ga0105248_10412003 3300009177 Unclassified 1522
126 Ga0105248_10475307 3300009177 Bacteria 1409
127 Ga0105248_11069527 3300009177 Bacteria 912
128 Ga0105248_11673361 3300009177 Bacteria 721
129 Ga0105238_10509411 3300009551 Bacteria 1205
130 Ga0105238_10590891 3300009551 Bacteria 1117
131 Ga0105249_10132069 3300009553 Bacteria 2385
132 Ga0105249_10649495 3300009553 Unclassified 1112
133 Ga0157371_11274754 3300013102 Bacteria 568
134 Ga0157369_12238168 3300013105 Bacteria 554
135 Ga0157374_11359897 3300013296 Bacteria 733
136 Ga0157378_10523686 3300013297 Unclassified 1187
137 Ga0157378_12577359 3300013297 Bacteria 561
138 Ga0163162_10397172 3300013306 Bacteria 1511
139 Ga0163162_11489436 3300013306 Bacteria 771
140 Ga0157375_10519019 3300013308 Bacteria 1355
141 Ga0163163_11073793 3300014325 Bacteria 868
142 Ga0182008_10095764 3300014497 Bacteria 1465
143 Ga0157379_10009057 3300014968 Bacteria 8675
144 Ga0157376_10037468 3300014969 Bacteria 3937
145 Ga0157376_10333255 3300014969 Bacteria 1447
146 Ga0157376_10490030 3300014969 Bacteria 1206
147 Ga0182007_10223766 3300015262 Bacteria 666
148 Ga0163161_10057678 3300017792 Bacteria 2821
149 Ga0206356_10407286 3300020070 Bacteria 544
150 Ga0213872_10132319 3300021361 Bacteria 1098
151 Ga0213872_10132923 3300021361 Bacteria 1095
152 Ga0213876_10000466 3300021384 Bacteria 32338
153 Ga0213875_10304522 3300021388 Bacteria 754
154 Ga0207710_10019725 3300025900 Bacteria 2878
155 Ga0207688_10404293 3300025901 Unclassified 847
156 Ga0207699_10236457 3300025906 Bacteria 1253
157 Ga0207645_10322766 3300025907 Unclassified 1030
158 Ga0207684_11062940 3300025910 Bacteria 675
159 Ga0207707_10005860 3300025912 Bacteria 10743
160 Ga0207707_10447418 3300025912 Unclassified 1106
161 Ga0207695_10106825 3300025913 Bacteria 2785
162 Ga0207695_10171596 3300025913 Bacteria 2094
163 Ga0207695_10801290 3300025913 Bacteria 822
164 Ga0207693_10234141 3300025915 Bacteria 1442
165 Ga0207693_10385117 3300025915 Bacteria 1096
166 Ga0207663_10010465 3300025916 Bacteria 4939
167 Ga0207663_10333059 3300025916 Unclassified 1144
168 Ga0207660_10022438 3300025917 Bacteria 4253
169 Ga0207649_10417639 3300025920 Bacteria 1007
170 Ga0207652_10056775 3300025921 Bacteria 3371
171 Ga0207652_10684905 3300025921 Unclassified 915
172 Ga0207646_10014032 3300025922 Bacteria 7626
173 Ga0207646_10095548 3300025922 Bacteria 2662
174 Ga0207694_10568403 3300025924 Bacteria 952
175 Ga0207659_10396966 3300025926 Unclassified 1153
176 Ga0207700_10662805 3300025928 Bacteria 930
177 Ga0207644_10002172 3300025931 Bacteria 12720
178 Ga0207706_10019671 3300025933 Bacteria 6074
179 Ga0207704_10535086 3300025938 Bacteria 950
180 Ga0207665_10137284 3300025939 Unclassified 1741
181 Ga0207691_10004581 3300025940 Bacteria 13388
182 Ga0207711_10461217 3300025941 Unclassified 1183
183 Ga0207661_10079949 3300025944 Bacteria 2696
184 Ga0207667_10825408 3300025949 Bacteria 922
185 Ga0207712_10187586 3300025961 Bacteria 1630
186 Ga0207712_10572094 3300025961 Bacteria 974
187 Ga0207640_10599687 3300025981 Bacteria 932
188 Ga0207703_10074147 3300026035 Bacteria 2817
189 Ga0207703_10259259 3300026035 Bacteria 1571
190 Ga0207708_10685724 3300026075 Unclassified 875
191 Ga0207702_11695896 3300026078 Bacteria 625
192 Ga0207641_10411775 3300026088 Bacteria 1300
193 Ga0207648_10036249 3300026089 Bacteria 4344
194 Ga0207675_100007284 3300026118 Bacteria 10457
195 Ga0207675_100135456 3300026118 Bacteria 2337
196 Ga0207675_102058244 3300026118 Unclassified 588
197 Ga0207698_10403779 3300026142 Bacteria 1307
198 Ga0209813_10011028 3300027866 Unclassified 2353
199 Ga0207428_10000576 3300027907 Bacteria 43310
200 Ga0207428_10001646 3300027907 Bacteria 23248
201 Ga0268266_10110954 3300028379 Bacteria 2430
202 Ga0268265_10129606 3300028380 Unclassified 2094
203 Ga0268264_10188246 3300028381 Bacteria 1879
204 Ga0268264_10273000 3300028381 Bacteria 1580
205 Ga0268264_10378686 3300028381 Bacteria 1355
206 Ga0307408_100038611 3300031548 Bacteria 3370
207 Ga0307408_100326519 3300031548 Bacteria 1294
208 Ga0307408_100504623 3300031548 Bacteria 1059
209 Ga0307408_101242243 3300031548 Bacteria 696
210 Ga0307405_10026465 3300031731 Bacteria 3346
211 Ga0307405_10051908 3300031731 Bacteria 2547
212 Ga0307405_10082213 3300031731 Bacteria 2107
213 Ga0307405_10087995 3300031731 Bacteria 2048
214 Ga0307405_10148341 3300031731 Bacteria 1646
215 Ga0307405_10485074 3300031731 Bacteria 987
216 Ga0307405_10614970 3300031731 Bacteria 889
217 Ga0307413_10047497 3300031824 Bacteria 2560
218 Ga0307413_10054127 3300031824 Bacteria 2433
219 Ga0307413_10092134 3300031824 Bacteria 1977
220 Ga0307413_11819195 3300031824 Bacteria 545
221 Ga0307410_10005150 3300031852 Bacteria 6879
222 Ga0307410_10034779 3300031852 Bacteria 3267
223 Ga0307410_10040533 3300031852 Bacteria 3065
224 Ga0307410_10040743 3300031852 Bacteria 3059
225 Ga0307410_10453599 3300031852 Bacteria 1046
226 Ga0307406_10023583 3300031901 Bacteria 3663
227 Ga0307406_10026572 3300031901 Bacteria 3478
228 Ga0307406_10524518 3300031901 Bacteria 964
229 Ga0307406_11252494 3300031901 Bacteria 646
230 Ga0307407_10006178 3300031903 Bacteria 5291
231 Ga0307407_10029486 3300031903 Bacteria 2948
232 Ga0307407_10046424 3300031903 Bacteria 2459
233 Ga0307407_10119622 3300031903 Bacteria 1667
234 Ga0307407_10357947 3300031903 Bacteria 1035
235 Ga0307407_10463068 3300031903 Bacteria 922
236 Ga0307407_10602416 3300031903 Bacteria 818
237 Ga0307412_10103605 3300031911 Bacteria 2017
238 Ga0307412_10178068 3300031911 Bacteria 1596
239 Ga0307412_10267957 3300031911 Bacteria 1335
240 Ga0307412_10386805 3300031911 Bacteria 1134
241 Ga0307412_10471160 3300031911 Bacteria 1039
242 Ga0307409_100004803 3300031995 Bacteria 7667
243 Ga0307409_100008909 3300031995 Bacteria 6128
244 Ga0307409_100049110 3300031995 Bacteria 3215
245 Ga0307409_100094033 3300031995 Bacteria 2465
246 Ga0307409_100100905 3300031995 Bacteria 2393
247 Ga0307409_100136699 3300031995 Bacteria 2104
248 Ga0307409_100198815 3300031995 Bacteria 1791
249 Ga0307409_100201523 3300031995 Bacteria 1781
250 Ga0307409_101254198 3300031995 Bacteria 765
251 Ga0307409_101733617 3300031995 Bacteria 653
252 Ga0307416_100000432 3300032002 Bacteria 21359
253 Ga0307416_100069499 3300032002 Bacteria 2914
254 Ga0307416_100074878 3300032002 Bacteria 2830
255 Ga0307416_100120263 3300032002 Bacteria 2338
256 Ga0307416_100237610 3300032002 Bacteria 1762
257 Ga0307416_100546933 3300032002 Bacteria 1230
258 Ga0307416_101129997 3300032002 Bacteria 888
259 Ga0307416_102330567 3300032002 Bacteria 635
260 Ga0307416_102542252 3300032002 Bacteria 610
261 Ga0307414_10226894 3300032004 Bacteria 1537
262 Ga0307414_10428797 3300032004 Bacteria 1155
263 Ga0307414_10630935 3300032004 Bacteria 964
264 Ga0307414_10982108 3300032004 Bacteria 777
265 Ga0307414_11360965 3300032004 Bacteria 659
266 Ga0307411_10028389 3300032005 Bacteria 3401
267 Ga0307411_10035774 3300032005 Bacteria 3105
268 Ga0307411_10078119 3300032005 Bacteria 2268
269 Ga0307411_11592071 3300032005 Bacteria 602
270 Ga0307411_11827110 3300032005 Bacteria 564
271 Ga0307415_100000154 3300032126 Bacteria 30474
272 Ga0307415_100014846 3300032126 Bacteria 4593
273 Ga0307415_100022716 3300032126 Bacteria 3877
274 Ga0307415_100098826 3300032126 Bacteria 2134
275 Ga0307415_100143269 3300032126 Bacteria 1828
276 Ga0307415_100461040 3300032126 Bacteria 1101
277 Ga0307415_100637377 3300032126 Bacteria 953
278 Ga0307415_102116774 3300032126 Bacteria 549
279 Ga0373952_0266417 3300035092 Bacteria 523
280 Ga0373936_0012661 3300035113 Bacteria 3211
281 Ga0373936_0234530 3300035113 Bacteria 817
282 Ga0373945_0148997 3300035116 Unclassified 947
283 Ga0373945_0342197 3300035116 Bacteria 647
284 Ga0373953_0091074 3300035117 Bacteria 1276
285 Ga0373954_0238388 3300035118 Unclassified 895
286 Ga0373956_0182151 3300035119 Bacteria 993
287 Ga0373943_0001523 3300035170 Bacteria 10488
288 Ga0373943_0643633 3300035170 Bacteria 626
289 Ga0373946_0244422 3300035171 Unclassified 873
290 Ga0373955_0045755 3300035172 Bacteria 2363
291 Ga0373955_0120061 3300035172 Bacteria 1528
292 Ga0373924_0001310 3300035410 Bacteria 7995
293 Ga0373931_0554142 3300035691 Bacteria 747
294 Ga0373935_0045858 3300035692 Bacteria 2759
295 Ga0373935_0687144 3300035692 Bacteria 752
296 Ga0373925_0005126 3300037068 Bacteria 9815
297 Ga0373925_0169302 3300037068 Bacteria 1724
298 Ga0373925_0478479 3300037068 Bacteria 1021
299 Ga0395899_0873403 3300037312 Bacteria 550
300 Ga0395898_0948504 3300037466 Bacteria 797
301 Ga0436365_0206678 3300039437 Bacteria 20594
302 Ga0436365_0732453 3300039437 Bacteria 1122
303 Ga0436360_0014424 3300039438 Bacteria 4899
304 Ga0436361_0079302 3300039447 Bacteria 2153
305 Ga0436361_0256919 3300039447 Bacteria 1167
306 Ga0436361_0866378 3300039447 Unclassified 1182
307 Ga0436362_1169304 3300039453 Bacteria 2226
308 Ga0439447_151418 3300041407 Bacteria 534
309 Ga0439465_0070127 3300041413 Bacteria 1174
310 Ga0451800_0784528 3300041459 Bacteria 687
311 Ga0439443_012852 3300042003 Bacteria 1244
312 Ga0439443_036280 3300042003 Bacteria 829
313 Ga0439448_0023296 3300042005 Bacteria 1930
314 Ga0439448_0084984 3300042005 Bacteria 1065
315 Ga0439448_0152452 3300042005 Bacteria 802
316 Ga0439448_0160397 3300042005 Bacteria 782
317 Ga0439450_000023 3300042008 Bacteria 12066
318 Ga0439450_012406 3300042008 Bacteria 1690
319 Ga0439450_022458 3300042008 Bacteria 1362
320 Ga0439450_033629 3300042008 Bacteria 1163
321 Ga0439450_124084 3300042008 Bacteria 666
322 Ga0439451_078782 3300042009 Bacteria 661
323 Ga0439454_001407 3300042011 Bacteria 2305
324 Ga0439454_028496 3300042011 Bacteria 863
325 Ga0439455_0011783 3300042012 Bacteria 1951
326 Ga0439455_0088317 3300042012 Bacteria 848
327 Ga0439456_010420 3300042013 Bacteria 1921
328 Ga0439463_006779 3300042016 Bacteria 2832
329 Ga0439463_050167 3300042016 Bacteria 1064
330 Ga0439463_131969 3300042016 Bacteria 646
331 Ga0439463_151798 3300042016 Bacteria 600
332 Ga0450913_000335 3300042117 Bacteria 1842
333 Ga0450915_011179 3300042119 Bacteria 635
334 Ga0450917_031547 3300042120 Bacteria 509
335 Ga0450900_000117 3300042136 Bacteria 4530
336 Ga0450902_001467 3300042137 Bacteria 3219
337 Ga0450904_003494 3300042139 Bacteria 1697
338 Ga0450905_007303 3300042142 Bacteria 1503
339 Ga0450905_020591 3300042142 Bacteria 971
340 Ga0439458_0057415 3300042157 Bacteria 968
341 Ga0439458_0061279 3300042157 Bacteria 940
342 Ga0439434_0037986 3300042435 Unclassified 1475
343 Ga0439435_0012757 3300042436 Bacteria 2044
344 Ga0439459_0017830 3300042438 Bacteria 1328
345 Ga0439464_0000170 3300042439 Bacteria 11006
346 Ga0439464_0026422 3300042439 Bacteria 1610
347 Ga0439464_0074532 3300042439 Bacteria 1007
348 Ga0439464_0081897 3300042439 Bacteria 965
349 Ga0439460_0001700 3300042461 Bacteria 5213
350 Ga0439460_0009439 3300042461 Bacteria 2478
351 Ga0439460_0025114 3300042461 Bacteria 1657
352 Ga0439460_0091488 3300042461 Bacteria 967
353 Ga0439460_0125619 3300042461 Bacteria 842
354 Ga0450916_000010 3300042530 Bacteria 9684
355 Ga0450916_023011 3300042530 Bacteria 867
356 Ga0451577_1636581 3300042876 Bacteria 567
357 Ga0439440_0000135 3300042993 Bacteria 10554
358 Ga0439440_0003746 3300042993 Bacteria 2957
359 Ga0439440_0048373 3300042993 Bacteria 1056
360 Ga0495603_0324309 3300046455 Bacteria 884
361 Ga0495641_0043465 3300046461 Bacteria 2078
362 Ga0495651_0666735 3300046462 Bacteria 651
363 Ga0495653_0369993 3300046463 Bacteria 918
364 Ga0495580_0158062 3300046472 Bacteria 1569
365 Ga0495580_0789026 3300046472 Bacteria 616
366 Ga0495582_0226589 3300046473 Bacteria 1070
367 Ga0495662_0131705 3300046476 Bacteria 1230
368 Ga0495584_0245950 3300046491 Bacteria 909
369 Ga0495584_0351901 3300046491 Bacteria 748
370 Ga0495596_0106474 3300046500 Bacteria 1089
371 Ga0495608_0207263 3300046511 Bacteria 1233
372 Ga0495618_0345045 3300046514 Bacteria 918
373 Ga0495628_0047500 3300046516 Bacteria 3405
374 Ga0495630_0009677 3300046517 Bacteria 6933
375 Ga0495631_0374396 3300046518 Bacteria 606
376 Ga0495663_0124857 3300046525 Bacteria 864
377 Ga0495652_0052318 3300046529 Bacteria 3484
378 Ga0495665_0419142 3300046531 Bacteria 678
379 Ga0495640_0249895 3300046533 Bacteria 1111
380 Ga0495640_0621061 3300046533 Bacteria 652
381 Ga0495586_0267506 3300046535 Bacteria 977
382 Ga0495587_0186078 3300046536 Bacteria 1176
383 Ga0495609_0305306 3300046538 Bacteria 648
384 Ga0495645_0384344 3300046543 Bacteria 897
385 Ga0495667_0049484 3300046559 Bacteria 2775
386 Ga0495667_0752189 3300046559 Bacteria 602
387 Ga0495668_0636965 3300046616 Bacteria 589
388 Ga0495634_0563407 3300046642 Bacteria 664
389 Ga0495635_0243384 3300046663 Bacteria 1213
390 Ga0495635_0446928 3300046663 Unclassified 855
391 Ga0495659_0511097 3300046664 Bacteria 527
392 Ga0495661_0120467 3300046665 Bacteria 1450
393 Ga0495599_0216185 3300046678 Bacteria 1174
394 Ga0495623_0096892 3300046679 Bacteria 1802
395 Ga0495658_0197959 3300046683 Bacteria 1251
396 Ga0495613_0004711 3300046689 Bacteria 10237
397 Ga0495670_0050645 3300046691 Bacteria 2079
398 Ga0495589_0134893 3300046794 Bacteria 1184
399 Ga0495600_0498821 3300046809 Bacteria 748
400 Ga0495600_0509032 3300046809 Bacteria 739
401 Ga0495600_0780767 3300046809 Bacteria 570
402 Ga0495581_0111167 3300047315 Bacteria 1594
403 Ga0495604_0012812 3300047317 Bacteria 6677
404 Ga0495604_0307479 3300047317 Bacteria 1063
405 Ga0495636_0199742 3300047318 Bacteria 913
406 Ga0495674_0023051 3300047319 Bacteria 5737
407 Ga0495674_0659053 3300047319 Unclassified 825
408 Ga0495674_1029299 3300047319 Bacteria 630
409 Ga0495676_0451275 3300047321 Bacteria 848
410 Ga0495680_0127130 3300047322 Bacteria 1876
411 Ga0495684_0001088 3300047471 Bacteria 21917
412 Ga0495684_0228766 3300047471 Unclassified 1361
413 Ga0495684_0261271 3300047471 Bacteria 1256
414 Ga0495686_0003301 3300047472 Bacteria 14084
415 Ga0495602_0231367 3300048088 Bacteria 1388
416 Ga0495614_0644027 3300048089 Bacteria 511
417 Ga0496100_0216092 3300048903 Bacteria 1405
418 Ga0496100_1007142 3300048903 Bacteria 656
419 Ga0496101_0009274 3300048904 Bacteria 6462
420 Ga0496101_0312468 3300048904 Bacteria 1232
421 Ga0496102_0147912 3300048905 Bacteria 2205
422 Ga0496102_0666460 3300048905 Bacteria 963
423 Ga0496104_0018582 3300048907 Bacteria 6345
424 Ga0496105_0480816 3300048908 Bacteria 977
425 Ga0496106_0031075 3300048909 Bacteria 3980
426 Ga0496106_0194552 3300048909 Bacteria 1613
427 Ga0496106_0843091 3300048909 Bacteria 726
428 Ga0496107_0374697 3300048910 Bacteria 1059
429 Ga0496108_1170383 3300048911 Bacteria 651
430 Ga0496109_1370387 3300048912 Bacteria 643
431 Ga0496110_0382611 3300048913 Bacteria 1282
432 Ga0496110_0816943 3300048913 Bacteria 837
433 Ga0496111_0218761 3300048914 Bacteria 1415
434 Ga0496113_1177223 3300048916 Bacteria 599
435 Ga0496114_0001465 3300048917 Bacteria 17949
436 Ga0496115_0291402 3300048918 Bacteria 1339
437 Ga0496115_0293792 3300048918 Bacteria 1332
438 Ga0496115_0596648 3300048918 Bacteria 878
439 Ga0496117_0000278 3300048920 Bacteria 95496
440 Ga0501031_0001477 3300049568 Bacteria 14611
441 Ga0501031_0074001 3300049568 Bacteria 2218
442 Ga0501032_0087841 3300049569 Bacteria 2064
443 Ga0501032_0273909 3300049569 Bacteria 1093
444 Ga0501033_0027885 3300049570 Bacteria 4244
445 Ga0501033_0061110 3300049570 Bacteria 2777
446 Ga0501034_0606485 3300049571 Bacteria 1000
447 Ga0501034_0720707 3300049571 Bacteria 895
448 Ga0501036_0000965 3300049572 Bacteria 21685
449 Ga0501036_0001271 3300049572 Bacteria 19342
450 Ga0501037_0035249 3300049573 Bacteria 3691
451 Ga0501037_0232709 3300049573 Bacteria 1293
452 Ga0501038_0003740 3300049574 Bacteria 14169
453 Ga0501038_0069206 3300049574 Bacteria 2998
454 Ga0501039_0004586 3300049575 Bacteria 10446
455 Ga0501039_0015002 3300049575 Bacteria 5927
456 Ga0501040_0000497 3300049576 Bacteria 23480
457 Ga0501040_0011059 3300049576 Bacteria 5899
458 Ga0501041_0001084 3300049577 Bacteria 14898
459 Ga0501041_0005334 3300049577 Bacteria 7522
460 Ga0501042_0000047 3300049578 Bacteria 41013
461 Ga0501042_0000104 3300049578 Bacteria 34416
462 Ga0501043_0032338 3300049579 Bacteria 4113
463 Ga0501043_0267001 3300049579 Bacteria 1314
464 Ga0501046_0000646 3300049580 Bacteria 34025
465 Ga0501046_0008345 3300049580 Bacteria 9035
466 Ga0501047_0119043 3300049581 Bacteria 2523
467 Ga0501048_0001440 3300049582 Bacteria 18055
468 Ga0501048_0005746 3300049582 Bacteria 9425
469 Ga0501068_0045261 3300049584 Bacteria 2651
470 Ga0501068_0097058 3300049584 Bacteria 1823
471 Ga0501070_0177924 3300049586 Bacteria 1751
472 Ga0501071_0001626 3300049587 Bacteria 13192
473 Ga0501071_0034038 3300049587 Bacteria 3623
474 Ga0501072_0001064 3300049588 Bacteria 20335
475 Ga0501073_0085678 3300049589 Bacteria 2192
476 Ga0501074_0001710 3300049590 Bacteria 14975
477 Ga0501074_0020341 3300049590 Bacteria 4824
478 Ga0501075_0000447 3300049591 Bacteria 24502
479 Ga0501075_0002337 3300049591 Bacteria 12584
480 Ga0501076_0000476 3300049592 Bacteria 25307
481 Ga0501076_0010693 3300049592 Bacteria 6820
482 Ga0501077_0000347 3300049593 Bacteria 27372
483 Ga0501077_0008099 3300049593 Bacteria 6496
484 Ga0501079_0001503 3300049741 Bacteria 16510
485 Ga0501079_0026764 3300049741 Bacteria 4421
486 Ga0501080_0002464 3300049742 Bacteria 16201
487 Ga0501080_0301417 3300049742 Bacteria 1453
488 Ga0501081_0003333 3300049743 Bacteria 10213
489 Ga0501083_0015355 3300049744 Bacteria 5365
490 Ga0501083_0075486 3300049744 Bacteria 2239
491 Ga0501035_0124564 3300049822 Bacteria 2250
492 Ga0501035_0492852 3300049822 Bacteria 1009
493 Ga0501044_1016810 3300049823 Bacteria 700
494 Ga0501045_0000239 3300049824 Bacteria 31902
495 Ga0501045_0000329 3300049824 Bacteria 27842
496 nmdc:mga03n38_4602_c1 3300050490 Bacteria 4591
497 nmdc:mga00v17_106_c1 3300050491 Bacteria 49674
498 nmdc:mga00v17_674_c1 3300050491 Bacteria 18819
499 nmdc:mga0yw44_165_c1 3300050492 Bacteria 22907
500 nmdc:mga06z11_409_c1 3300050494 Bacteria 16143
501 nmdc:mga04h51_1280_c1 3300050495 Bacteria 5808
502 nmdc:mga07m45_206_c1 3300050496 Bacteria 23304
503 nmdc:mga05p37_1348242_c1 3300050507 Bacteria 723
504 nmdc:mga05p37_32593_c1 3300050507 Bacteria 6373
505 nmdc:mga05p37_345256_c1 3300050507 Bacteria 1754
506 nmdc:mga05p37_6171_c1 3300050507 Bacteria 14110
507 nmdc:mga05p37_655338_c1 3300050507 Bacteria 1175
508 nmdc:mga09592_2075_c1 3300050508 Bacteria 16165
509 nmdc:mga09592_728489_c1 3300050508 Bacteria 843
510 nmdc:mga09592_868678_c1 3300050508 Bacteria 760
511 nmdc:mga0qj67_1279_c1 3300050509 Bacteria 17638
512 nmdc:mga0qj67_870999_c1 3300050509 Bacteria 711
513 nmdc:mga0qj67_969719_c1 3300050509 Bacteria 668
514 nmdc:mga06r32_39725_c1 3300050510 Bacteria 4466
515 nmdc:mga06r32_511964_c1 3300050510 Bacteria 1176
516 nmdc:mga08y16_12101_c1 3300050511 Bacteria 9067
517 nmdc:mga0n895_1226954_c1 3300050512 Bacteria 723
518 nmdc:mga0n895_127345_c1 3300050512 Bacteria 2570
519 nmdc:mga0n895_150171_c1 3300050512 Bacteria 2360
520 nmdc:mga0n895_1561569_c1 3300050512 Bacteria 625
521 nmdc:mga0n895_3986_c1 3300050512 Bacteria 12005
522 nmdc:mga0rr50_268841_c1 3300050513 Bacteria 1420
523 nmdc:mga0a205_124843_c1 3300050515 Bacteria 2474
524 nmdc:mga0a205_16803_c1 3300050515 Bacteria 6853
525 nmdc:mga0sz30_137_c1 3300050516 Bacteria 27068
526 Ga0495601_0004252 3300053077 Bacteria 8272
527 Ga0495601_0027806 3300053077 Bacteria 3499
528 Ga0495601_0572472 3300053077 Bacteria 726
529 Ga0495595_0016175 3300053084 Bacteria 3187
530 Ga0495595_0199967 3300053084 Bacteria 995
531 Ga0495619_0037659 3300053085 Bacteria 3153
532 Ga0495619_0079713 3300053085 Unclassified 2203
533 Ga0495619_0434542 3300053085 Bacteria 905
534 Ga0501084_0002806 3300054114 Bacteria 14067
535 Ga0501084_0004525 3300054114 Bacteria 11371
536 Ga0590071_025813 3300059421 Bacteria 1393
537 Ga0590075_016245 3300059424 Bacteria 1830
538 Ga0590075_060179 3300059424 Bacteria 978
539 Ga0590077_020280 3300059426 Bacteria 1411
540 Ga0590077_073905 3300059426 Bacteria 781
541 Ga0501082_0000636 3300060353 Bacteria 30982
542 Ga0501082_0004143 3300060353 Bacteria 12668
543 Ga0530510_0000640 3300061734 Bacteria 22515
544 Ga0530510_0010681 3300061734 Bacteria 6440
545 Ga0495582_0112058
546 JGI25406J46586_10011128
547 JGI25407J50210_10019143
548 JGI25407J50210_10025016
549 JGI25407J50210_10120895
550 JGI25407J50210_10146150
551 Ga0065712_10037756
552 Ga0065715_10152577
553 Ga0065707_10217439
554 Ga0070676_10499603
555 Ga0070689_100473494
556 Ga0070687_100762126
557 Ga0070668_100036944
558 Ga0070669_100676823
559 Ga0070669_101768234
560 Ga0070675_100166799
561 Ga0070671_100003230
562 Ga0070671_101299736
563 Ga0070688_100844282
564 Ga0070667_100440242
565 Ga0070709_11615352
566 Ga0070713_100009539
567 Ga0070713_100192121
568 Ga0070701_10200925
569 Ga0070711_100010241
570 Ga0070705_100541247
571 Ga0070700_100698832
572 Ga0070694_100006883
573 Ga0070694_100027500
574 Ga0070663_100350131
575 Ga0070662_100020527
576 Ga0070681_10025861
577 Ga0070681_10566944
578 Ga0070707_100047499
579 Ga0070707_100048543
580 Ga0070707_101743454
581 Ga0070698_100696254
582 Ga0070699_100823387
583 Ga0070679_100017101
584 Ga0070679_100884448
585 Ga0070697_102028002
586 Ga0070686_100150369
587 Ga0070695_100005839
588 Ga0070695_100034857
589 Ga0070696_100050215
590 Ga0070665_100292974
591 Ga0070704_100004225
592 Ga0070704_100223376
593 Ga0068854_100189650
594 Ga0068852_100671529
595 Ga0068852_101035925
596 Ga0068859_100012469
597 Ga0068864_101780357
598 Ga0068861_100098440
599 Ga0068861_100278850
600 Ga0068863_100346708
601 Ga0068858_100000970
602 Ga0068860_100482655
603 Ga0068860_102417481
604 Ga0081455_10017711
605 Ga0081455_10167521
606 Ga0081455_10385438
607 Ga0081538_10003944
608 Ga0081538_10009055
609 Ga0081538_10014534
610 Ga0081538_10015010
611 Ga0081538_10021953
612 Ga0081538_10025381
613 Ga0081538_10056576
614 Ga0081538_10061295
615 Ga0081538_10074014
616 Ga0081538_10128950
617 Ga0081538_10142537
618 Ga0081538_10278943
619 Ga0081540_1019861
620 Ga0081539_10003396
621 Ga0081539_10010793
622 Ga0081539_10064639
623 Ga0081539_10434026
624 Ga0070717_10091420
625 Ga0075365_10000564
626 Ga0075368_10185464
627 Ga0075363_100050508
628 Ga0075364_10018720
629 Ga0075364_10394873
630 Ga0075432_10022471
631 Ga0070716_100105514
632 Ga0070712_100256938
633 Ga0070712_100362321
634 Ga0075367_10001454
635 Ga0075427_10006498
636 Ga0075370_10000155
637 Ga0068871_100006190
638 Ga0075428_100398848
639 Ga0075430_100014244
640 Ga0075430_100346148
641 Ga0075431_100144199
642 Ga0075431_100342937
643 Ga0075433_10307764
644 Ga0075433_11492989
645 Ga0075434_100027928
646 Ga0075434_100153201
647 Ga0075434_100425560
648 Ga0075434_100701612
649 Ga0075434_101489876
650 Ga0075429_100005090
651 Ga0075429_100009371
652 Ga0075429_100171474
653 Ga0068865_100555981
654 Ga0097620_100012469
655 Ga0075435_100298029
656 Ga0105240_10316671
657 Ga0105240_11034896
658 Ga0111539_10031720
659 Ga0111539_11040768
660 Ga0105245_11341323
661 Ga0105247_10037625
662 Ga0114129_10036820
663 Ga0114129_10248506
664 Ga0114129_10376143
665 Ga0114129_10690835
666 Ga0114129_10800752
667 Ga0105242_10120271
668 Ga0105248_10047293
669 Ga0105248_10412003
670 Ga0105248_10475307
671 Ga0105248_11069527
672 Ga0105248_11673361
673 Ga0105238_10509411
674 Ga0105238_10590891
675 Ga0105249_10132069
676 Ga0105249_10649495
677 Ga0157371_11274754
678 Ga0157369_12238168
679 Ga0157374_11359897
680 Ga0157378_10523686
681 Ga0157378_12577359
682 Ga0163162_10397172
683 Ga0163162_11489436
684 Ga0157375_10519019
685 Ga0163163_11073793
686 Ga0182008_10095764
687 Ga0157379_10009057
688 Ga0157376_10037468
689 Ga0157376_10333255
690 Ga0157376_10490030
691 Ga0182007_10223766
692 Ga0163161_10057678
693 Ga0206356_10407286
694 Ga0213872_10132319
695 Ga0213872_10132923
696 Ga0213876_10000466
697 Ga0213875_10304522
698 Ga0207710_10019725
699 Ga0207688_10404293
700 Ga0207699_10236457
701 Ga0207645_10322766
702 Ga0207684_11062940
703 Ga0207707_10005860
704 Ga0207707_10447418
705 Ga0207695_10106825
706 Ga0207695_10171596
707 Ga0207695_10801290
708 Ga0207693_10234141
709 Ga0207693_10385117
710 Ga0207663_10010465
711 Ga0207663_10333059
712 Ga0207660_10022438
713 Ga0207649_10417639
714 Ga0207652_10056775
715 Ga0207652_10684905
716 Ga0207646_10014032
717 Ga0207646_10095548
718 Ga0207694_10568403
719 Ga0207659_10396966
720 Ga0207700_10662805
721 Ga0207644_10002172
722 Ga0207706_10019671
723 Ga0207704_10535086
724 Ga0207665_10137284
725 Ga0207691_10004581
726 Ga0207711_10461217
727 Ga0207661_10079949
728 Ga0207667_10825408
729 Ga0207712_10187586
730 Ga0207712_10572094
731 Ga0207640_10599687
732 Ga0207703_10074147
733 Ga0207703_10259259
734 Ga0207708_10685724
735 Ga0207702_11695896
736 Ga0207641_10411775
737 Ga0207648_10036249
738 Ga0207675_100007284
739 Ga0207675_100135456
740 Ga0207675_102058244
741 Ga0207698_10403779
742 Ga0209813_10011028
743 Ga0207428_10000576
744 Ga0207428_10001646
745 Ga0268266_10110954
746 Ga0268265_10129606
747 Ga0268264_10188246
748 Ga0268264_10273000
749 Ga0268264_10378686
750 Ga0307408_100038611
751 Ga0307408_100326519
752 Ga0307408_100504623
753 Ga0307408_101242243
754 Ga0307405_10026465
755 Ga0307405_10051908
756 Ga0307405_10082213
757 Ga0307405_10087995
758 Ga0307405_10148341
759 Ga0307405_10485074
760 Ga0307405_10614970
761 Ga0307413_10047497
762 Ga0307413_10054127
763 Ga0307413_10092134
764 Ga0307413_11819195
765 Ga0307410_10005150
766 Ga0307410_10034779
767 Ga0307410_10040533
768 Ga0307410_10040743
769 Ga0307410_10453599
770 Ga0307406_10023583
771 Ga0307406_10026572
772 Ga0307406_10524518
773 Ga0307406_11252494
774 Ga0307407_10006178
775 Ga0307407_10029486
776 Ga0307407_10046424
777 Ga0307407_10119622
778 Ga0307407_10357947
779 Ga0307407_10463068
780 Ga0307407_10602416
781 Ga0307412_10103605
782 Ga0307412_10178068
783 Ga0307412_10267957
784 Ga0307412_10386805
785 Ga0307412_10471160
786 Ga0307409_100004803
787 Ga0307409_100008909
788 Ga0307409_100049110
789 Ga0307409_100094033
790 Ga0307409_100100905
791 Ga0307409_100136699
792 Ga0307409_100198815
793 Ga0307409_100201523
794 Ga0307409_101254198
795 Ga0307409_101733617
796 Ga0307416_100000432
797 Ga0307416_100069499
798 Ga0307416_100074878
799 Ga0307416_100120263
800 Ga0307416_100237610
801 Ga0307416_100546933
802 Ga0307416_101129997
803 Ga0307416_102330567
804 Ga0307416_102542252
805 Ga0307414_10226894
806 Ga0307414_10428797
807 Ga0307414_10630935
808 Ga0307414_10982108
809 Ga0307414_11360965
810 Ga0307411_10028389
811 Ga0307411_10035774
812 Ga0307411_10078119
813 Ga0307411_11592071
814 Ga0307411_11827110
815 Ga0307415_100000154
816 Ga0307415_100014846
817 Ga0307415_100022716
818 Ga0307415_100098826
819 Ga0307415_100143269
820 Ga0307415_100461040
821 Ga0307415_100637377
822 Ga0307415_102116774
823 Ga0373952_0266417
824 Ga0373936_0012661
825 Ga0373936_0234530
826 Ga0373945_0148997
827 Ga0373945_0342197
828 Ga0373953_0091074
829 Ga0373954_0238388
830 Ga0373956_0182151
831 Ga0373943_0001523
832 Ga0373943_0643633
833 Ga0373946_0244422
834 Ga0373955_0045755
835 Ga0373955_0120061
836 Ga0373924_0001310
837 Ga0373931_0554142
838 Ga0373935_0045858
839 Ga0373935_0687144
840 Ga0373925_0005126
841 Ga0373925_0169302
842 Ga0373925_0478479
843 Ga0395899_0873403
844 Ga0395898_0948504
845 Ga0436365_0206678
846 Ga0436365_0732453
847 Ga0436360_0014424
848 Ga0436361_0079302
849 Ga0436361_0256919
850 Ga0436361_0866378
851 Ga0436362_1169304
852 Ga0439447_151418
853 Ga0439465_0070127
854 Ga0451800_0784528
855 Ga0439443_012852
856 Ga0439443_036280
857 Ga0439448_0023296
858 Ga0439448_0084984
859 Ga0439448_0152452
860 Ga0439448_0160397
861 Ga0439450_000023
862 Ga0439450_012406
863 Ga0439450_022458
864 Ga0439450_033629
865 Ga0439450_124084
866 Ga0439451_078782
867 Ga0439454_001407
868 Ga0439454_028496
869 Ga0439455_0011783
870 Ga0439455_0088317
871 Ga0439456_010420
872 Ga0439463_006779
873 Ga0439463_050167
874 Ga0439463_131969
875 Ga0439463_151798
876 Ga0450913_000335
877 Ga0450915_011179
878 Ga0450917_031547
879 Ga0450900_000117
880 Ga0450902_001467
881 Ga0450904_003494
882 Ga0450905_007303
883 Ga0450905_020591
884 Ga0439458_0057415
885 Ga0439458_0061279
886 Ga0439434_0037986
887 Ga0439435_0012757
888 Ga0439459_0017830
889 Ga0439464_0000170
890 Ga0439464_0026422
891 Ga0439464_0074532
892 Ga0439464_0081897
893 Ga0439460_0001700
894 Ga0439460_0009439
895 Ga0439460_0025114
896 Ga0439460_0091488
897 Ga0439460_0125619
898 Ga0450916_000010
899 Ga0450916_023011
900 Ga0451577_1636581
901 Ga0439440_0000135
902 Ga0439440_0003746
903 Ga0439440_0048373
904 Ga0495603_0324309
905 Ga0495641_0043465
906 Ga0495651_0666735
907 Ga0495653_0369993
908 Ga0495580_0158062
909 Ga0495580_0789026
910 Ga0495582_0226589
911 Ga0495662_0131705
912 Ga0495584_0245950
913 Ga0495584_0351901
914 Ga0495596_0106474
915 Ga0495608_0207263
916 Ga0495618_0345045
917 Ga0495628_0047500
918 Ga0495630_0009677
919 Ga0495631_0374396
920 Ga0495663_0124857
921 Ga0495652_0052318
922 Ga0495665_0419142
923 Ga0495640_0249895
924 Ga0495640_0621061
925 Ga0495586_0267506
926 Ga0495587_0186078
927 Ga0495609_0305306
928 Ga0495645_0384344
929 Ga0495667_0049484
930 Ga0495667_0752189
931 Ga0495668_0636965
932 Ga0495634_0563407
933 Ga0495635_0243384
934 Ga0495635_0446928
935 Ga0495659_0511097
936 Ga0495661_0120467
937 Ga0495599_0216185
938 Ga0495623_0096892
939 Ga0495658_0197959
940 Ga0495613_0004711
941 Ga0495670_0050645
942 Ga0495589_0134893
943 Ga0495600_0498821
944 Ga0495600_0509032
945 Ga0495600_0780767
946 Ga0495581_0111167
947 Ga0495604_0012812
948 Ga0495604_0307479
949 Ga0495636_0199742
950 Ga0495674_0023051
951 Ga0495674_0659053
952 Ga0495674_1029299
953 Ga0495676_0451275
954 Ga0495680_0127130
955 Ga0495684_0001088
956 Ga0495684_0228766
957 Ga0495684_0261271
958 Ga0495686_0003301
959 Ga0495602_0231367
960 Ga0495614_0644027
961 Ga0496100_0216092
962 Ga0496100_1007142
963 Ga0496101_0009274
964 Ga0496101_0312468
965 Ga0496102_0147912
966 Ga0496102_0666460
967 Ga0496104_0018582
968 Ga0496105_0480816
969 Ga0496106_0031075
970 Ga0496106_0194552
971 Ga0496106_0843091
972 Ga0496107_0374697
973 Ga0496108_1170383
974 Ga0496109_1370387
975 Ga0496110_0382611
976 Ga0496110_0816943
977 Ga0496111_0218761
978 Ga0496113_1177223
979 Ga0496114_0001465
980 Ga0496115_0291402
981 Ga0496115_0293792
982 Ga0496115_0596648
983 Ga0496117_0000278
984 Ga0501031_0001477
985 Ga0501031_0074001
986 Ga0501032_0087841
987 Ga0501032_0273909
988 Ga0501033_0027885
989 Ga0501033_0061110
990 Ga0501034_0606485
991 Ga0501034_0720707
992 Ga0501036_0000965
993 Ga0501036_0001271
994 Ga0501037_0035249
995 Ga0501037_0232709
996 Ga0501038_0003740
997 Ga0501038_0069206
998 Ga0501039_0004586
999 Ga0501039_0015002
1000 Ga0501040_0000497
1001 Ga0501040_0011059
1002 Ga0501041_0001084
1003 Ga0501041_0005334
1004 Ga0501042_0000047
1005 Ga0501042_0000104
1006 Ga0501043_0032338
1007 Ga0501043_0267001
1008 Ga0501046_0000646
1009 Ga0501046_0008345
1010 Ga0501047_0119043
1011 Ga0501048_0001440
1012 Ga0501048_0005746
1013 Ga0501068_0045261
1014 Ga0501068_0097058
1015 Ga0501070_0177924
1016 Ga0501071_0001626
1017 Ga0501071_0034038
1018 Ga0501072_0001064
1019 Ga0501073_0085678
1020 Ga0501074_0001710
1021 Ga0501074_0020341
1022 Ga0501075_0000447
1023 Ga0501075_0002337
1024 Ga0501076_0000476
1025 Ga0501076_0010693
1026 Ga0501077_0000347
1027 Ga0501077_0008099
1028 Ga0501079_0001503
1029 Ga0501079_0026764
1030 Ga0501080_0002464
1031 Ga0501080_0301417
1032 Ga0501081_0003333
1033 Ga0501083_0015355
1034 Ga0501083_0075486
1035 Ga0501035_0124564
1036 Ga0501035_0492852
1037 Ga0501044_1016810
1038 Ga0501045_0000239
1039 Ga0501045_0000329
1040 nmdc:mga03n38_4602_c1
1041 nmdc:mga00v17_106_c1
1042 nmdc:mga00v17_674_c1
1043 nmdc:mga0yw44_165_c1
1044 nmdc:mga06z11_409_c1
1045 nmdc:mga04h51_1280_c1
1046 nmdc:mga07m45_206_c1
1047 nmdc:mga05p37_1348242_c1
1048 nmdc:mga05p37_32593_c1
1049 nmdc:mga05p37_345256_c1
1050 nmdc:mga05p37_6171_c1
1051 nmdc:mga05p37_655338_c1
1052 nmdc:mga09592_2075_c1
1053 nmdc:mga09592_728489_c1
1054 nmdc:mga09592_868678_c1
1055 nmdc:mga0qj67_1279_c1
1056 nmdc:mga0qj67_870999_c1
1057 nmdc:mga0qj67_969719_c1
1058 nmdc:mga06r32_39725_c1
1059 nmdc:mga06r32_511964_c1
1060 nmdc:mga08y16_12101_c1
1061 nmdc:mga0n895_1226954_c1
1062 nmdc:mga0n895_127345_c1
1063 nmdc:mga0n895_150171_c1
1064 nmdc:mga0n895_1561569_c1
1065 nmdc:mga0n895_3986_c1
1066 nmdc:mga0rr50_268841_c1
1067 nmdc:mga0a205_124843_c1
1068 nmdc:mga0a205_16803_c1
1069 nmdc:mga0sz30_137_c1
1070 Ga0495601_0004252
1071 Ga0495601_0027806
1072 Ga0495601_0572472
1073 Ga0495595_0016175
1074 Ga0495595_0199967
1075 Ga0495619_0037659
1076 Ga0495619_0079713
1077 Ga0495619_0434542
1078 Ga0501084_0002806
1079 Ga0501084_0004525
1080 Ga0590071_025813
1081 Ga0590075_016245
1082 Ga0590075_060179
1083 Ga0590077_020280
1084 Ga0590077_073905
1085 Ga0501082_0000636
1086 Ga0501082_0004143
1087 Ga0530510_0000640
1088 Ga0530510_0010681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

5

113

0.97

PF01230

HIT

HIT domain

13

111

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9812 5 115
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9797 3 111
6ypr-assembly1.cif.gz_AAA-2 human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.26 a in h32 space group 0.9731 22 115
3qgz-assembly1.cif.gz_A re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine 0.9691 5 115
5waa-assembly1.cif.gz_B human histidine triad nucleotide binding protein 1 (hhint1) c84r mutant 0.969 5 115
ID Description Score Start End Superfamily
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9754 3 111 3.30.428.10
af_Q0DA95_1_91_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9746 28 115 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9651 5 115 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9567 5 115 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9565 1 111 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7C6Z898-F1-model_v4 Histidine triad nucleotide-binding protein 0.9917 5 115 GO:0003824
AF-A0A3C1ESP8-F1-model_v4 Histidine triad nucleotide-binding protein 0.9889 3 115 GO:0003824
AF-A0A7C2YI03-F1-model_v4 Histidine triad nucleotide-binding protein 0.9888 6 115 GO:0003824
AF-A0A2H0Z9Q7-F1-model_v4 Histidine triad nucleotide-binding protein 0.9877 5 115 GO:0003824
AF-A0A7W0JED7-F1-model_v4 Histidine triad nucleotide-binding protein 0.9874 6 111 GO:0003824

Map