F461745

General Info

Members Datasets Scaffolds Average Seq Length
544 248 1088 337

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10053975|Ga0265338_100539753
Length 392
Sequence MLVAAFSRDLCDSWGSSVKIRAVPWLVLIFLQTDDCRLTTAGYNWRIKSKAPKRTRAGATGPPVPEKTDVRLGRIVRLLTQHATVVVSGTKIAEEIGTSRSEVWRLVQQLRGLGVEIAGHPATGYRLKSVPDLLLPDMLASLIKRTIFSKNIHHYYKIGSTNLAAMEAAAGGAAEGTVFLAEQQTAGRGRGAHTWESPQSTGIYCSVVLRPVLPPSDALILSLAAGLAVHAAVQEVDARIDPDLKWPNDPLIDGKKFCGILTEMNAEATRVRYVVVGIGINVNQASFPAELREVATSLRLATGTEWSRVELCAALLKSLDREYRDLLDKPGAHASILERFQEHSTWAQGRPVRIEENGGFEGVTEGLDTRGFLLVRTAQGMRTVLSGTVRAK

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.25
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 20.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10053975 3300028800 Bacteria 3589
2 LJNas_1000461 3300000546 Bacteria 7151
3 Ga0070676_10024735 3300005328 Bacteria 3387
4 Ga0070676_10030576 3300005328 Bacteria 3072
5 Ga0070683_100026720 3300005329 Bacteria 5202
6 Ga0070683_100102581 3300005329 Bacteria 2695
7 Ga0070683_100149502 3300005329 Unclassified 2214
8 Ga0070690_100105213 3300005330 Unclassified 1876
9 Ga0070670_100001444 3300005331 Bacteria 19071
10 Ga0068869_100058599 3300005334 Bacteria 2816
11 Ga0070666_10006876 3300005335 Bacteria 7008
12 Ga0070680_100071324 3300005336 Bacteria 2854
13 Ga0070680_100171627 3300005336 Bacteria 1825
14 Ga0070682_100050669 3300005337 Bacteria 2593
15 Ga0068868_100000574 3300005338 Bacteria 24648
16 Ga0068868_100016657 3300005338 Bacteria 5465
17 Ga0068868_100021849 3300005338 Bacteria 4823
18 Ga0068868_100043127 3300005338 Unclassified 3523
19 Ga0070660_100024555 3300005339 Unclassified 4471
20 Ga0070689_100059632 3300005340 Unclassified 2966
21 Ga0070689_100085941 3300005340 Bacteria 2474
22 Ga0070687_100129169 3300005343 Unclassified 1457
23 Ga0070661_100016372 3300005344 Bacteria 5240
24 Ga0070661_100077498 3300005344 Bacteria 2450
25 Ga0070668_100009919 3300005347 Bacteria 7053
26 Ga0070668_100200671 3300005347 Unclassified 1637
27 Ga0070669_100003501 3300005353 Bacteria 11318
28 Ga0070669_100124785 3300005353 Unclassified 1969
29 Ga0070675_100057324 3300005354 Bacteria 3211
30 Ga0070688_100003742 3300005365 Bacteria 7874
31 Ga0070667_100099262 3300005367 Bacteria 2513
32 Ga0070709_10000932 3300005434 Bacteria 16213
33 Ga0070709_10190150 3300005434 Unclassified 1447
34 Ga0070714_100000388 3300005435 Bacteria 32780
35 Ga0070714_100094698 3300005435 Unclassified 2621
36 Ga0070714_100212805 3300005435 Bacteria 1772
37 Ga0070713_100001111 3300005436 Bacteria 17146
38 Ga0070713_100004058 3300005436 Bacteria 9752
39 Ga0070713_100068830 3300005436 Bacteria 2983
40 Ga0070713_100080917 3300005436 Bacteria 2771
41 Ga0070713_100098541 3300005436 Bacteria 2528
42 Ga0070710_10103006 3300005437 Unclassified 1703
43 Ga0070710_10112652 3300005437 Unclassified 1636
44 Ga0070710_10168066 3300005437 Bacteria 1365
45 Ga0070711_100000823 3300005439 Bacteria 16273
46 Ga0070711_100009146 3300005439 Bacteria 6089
47 Ga0070711_100014034 3300005439 Bacteria 5041
48 Ga0070711_100032132 3300005439 Bacteria 3488
49 Ga0070711_100035281 3300005439 Bacteria 3343
50 Ga0070705_100035289 3300005440 Unclassified 2802
51 Ga0070700_100090534 3300005441 Bacteria 1995
52 Ga0070700_100130771 3300005441 Unclassified 1694
53 Ga0070694_100181186 3300005444 Unclassified 1558
54 Ga0070708_100000233 3300005445 Bacteria 41575
55 Ga0070708_100004410 3300005445 Bacteria 11061
56 Ga0070708_100012490 3300005445 Bacteria 6932
57 Ga0070708_100014607 3300005445 Bacteria 6467
58 Ga0070708_100023418 3300005445 Bacteria 5252
59 Ga0070708_100062755 3300005445 Unclassified 3324
60 Ga0070708_100071802 3300005445 Bacteria 3117
61 Ga0070662_100003030 3300005457 Bacteria 10445
62 Ga0070662_100010913 3300005457 Bacteria 5986
63 Ga0070662_100049640 3300005457 Unclassified 3026
64 Ga0070681_10014252 3300005458 Bacteria 7913
65 Ga0070681_10084410 3300005458 Bacteria 3128
66 Ga0068867_100002427 3300005459 Bacteria 13097
67 Ga0068867_100065802 3300005459 Bacteria 2698
68 Ga0068867_100098291 3300005459 Bacteria 2232
69 Ga0070685_10006585 3300005466 Bacteria 5925
70 Ga0070706_100001512 3300005467 Bacteria 24397
71 Ga0070706_100005774 3300005467 Bacteria 11758
72 Ga0070706_100013563 3300005467 Bacteria 7534
73 Ga0070706_100031786 3300005467 Bacteria 4866
74 Ga0070706_100148188 3300005467 Unclassified 2191
75 Ga0070707_100001737 3300005468 Bacteria 21001
76 Ga0070707_100003795 3300005468 Bacteria 14258
77 Ga0070707_100006090 3300005468 Bacteria 11252
78 Ga0070707_100029169 3300005468 Bacteria 5252
79 Ga0070707_100160677 3300005468 Bacteria 2189
80 Ga0070707_100452882 3300005468 Unclassified 1244
81 Ga0070698_100005930 3300005471 Bacteria 13327
82 Ga0070698_100014991 3300005471 Bacteria 8194
83 Ga0070698_100024167 3300005471 Bacteria 6340
84 Ga0070698_100041061 3300005471 Bacteria 4751
85 Ga0070699_100000726 3300005518 Bacteria 30560
86 Ga0070699_100006013 3300005518 Bacteria 10610
87 Ga0070699_100008249 3300005518 Bacteria 9035
88 Ga0070699_100016113 3300005518 Bacteria 6416
89 Ga0070699_100023683 3300005518 Bacteria 5290
90 Ga0070699_100029179 3300005518 Unclassified 4757
91 Ga0070699_100113894 3300005518 Unclassified 2376
92 Ga0070679_100012961 3300005530 Bacteria 7987
93 Ga0070684_100016409 3300005535 Bacteria 6053
94 Ga0070684_100061701 3300005535 Bacteria 3282
95 Ga0070697_100001732 3300005536 Bacteria 16660
96 Ga0070697_100001839 3300005536 Bacteria 16220
97 Ga0070697_100002075 3300005536 Bacteria 15320
98 Ga0070697_100005046 3300005536 Bacteria 10137
99 Ga0070697_100006377 3300005536 Bacteria 9133
100 Ga0070697_100011689 3300005536 Bacteria 6865
101 Ga0070697_100022209 3300005536 Bacteria 5036
102 Ga0070697_100038130 3300005536 Bacteria 3883
103 Ga0070697_100043636 3300005536 Bacteria 3631
104 Ga0068853_100153583 3300005539 Bacteria 2073
105 Ga0070686_100045350 3300005544 Bacteria 2769
106 Ga0070696_100020413 3300005546 Bacteria 4490
107 Ga0070696_100097608 3300005546 Bacteria 2101
108 Ga0070696_100241653 3300005546 Unclassified 1362
109 Ga0070665_100000462 3300005548 Bacteria 59040
110 Ga0068855_100000935 3300005563 Bacteria 36342
111 Ga0068855_100004923 3300005563 Bacteria 16298
112 Ga0068855_100022403 3300005563 Bacteria 7571
113 Ga0068855_100037492 3300005563 Bacteria 5764
114 Ga0068855_100110169 3300005563 Bacteria 3161
115 Ga0070664_100006160 3300005564 Bacteria 9696
116 Ga0070664_100123210 3300005564 Unclassified 2271
117 Ga0068857_100000081 3300005577 Bacteria 55561
118 Ga0068857_100060245 3300005577 Bacteria 3372
119 Ga0068854_100046491 3300005578 Bacteria 3090
120 Ga0068854_100139417 3300005578 Bacteria 1859
121 Ga0068856_100000153 3300005614 Bacteria 70644
122 Ga0068856_100001083 3300005614 Bacteria 28733
123 Ga0068856_100008399 3300005614 Bacteria 10059
124 Ga0068856_100043427 3300005614 Bacteria 4423
125 Ga0068856_100048789 3300005614 Bacteria 4173
126 Ga0068856_100210388 3300005614 Bacteria 1960
127 Ga0068852_100044687 3300005616 Unclassified 3764
128 Ga0068852_100054371 3300005616 Bacteria 3451
129 Ga0068852_100058864 3300005616 Bacteria 3330
130 Ga0068852_100060362 3300005616 Bacteria 3291
131 Ga0068859_100000124 3300005617 Bacteria 73706
132 Ga0068859_100021644 3300005617 Bacteria 6453
133 Ga0068859_100144382 3300005617 Bacteria 2454
134 Ga0068859_100180219 3300005617 Bacteria 2195
135 Ga0068864_100000790 3300005618 Bacteria 26566
136 Ga0068866_10002929 3300005718 Bacteria 7040
137 Ga0068866_10004251 3300005718 Bacteria 5879
138 Ga0068861_100080282 3300005719 Bacteria 2552
139 Ga0068861_100410132 3300005719 Unclassified 1205
140 Ga0068870_10011981 3300005840 Unclassified 4037
141 Ga0068863_100001470 3300005841 Bacteria 23346
142 Ga0068863_100075461 3300005841 Bacteria 3190
143 Ga0068858_100000985 3300005842 Bacteria 29388
144 Ga0068858_100013171 3300005842 Bacteria 7794
145 Ga0068858_100058828 3300005842 Bacteria 3553
146 Ga0068858_100095748 3300005842 Bacteria 2766
147 Ga0068858_100100424 3300005842 Bacteria 2698
148 Ga0068860_100033246 3300005843 Bacteria 4950
149 Ga0068860_100090102 3300005843 Bacteria 2921
150 Ga0068860_100108102 3300005843 Bacteria 2658
151 Ga0068862_100012592 3300005844 Bacteria 7003
152 Ga0068862_100327254 3300005844 Unclassified 1416
153 Ga0070717_10004066 3300006028 Bacteria 10545
154 Ga0070717_10019232 3300006028 Bacteria 5354
155 Ga0070717_10047172 3300006028 Bacteria 3528
156 Ga0070715_10008636 3300006163 Bacteria 3558
157 Ga0070716_100004605 3300006173 Bacteria 6612
158 Ga0070716_100007207 3300006173 Bacteria 5467
159 Ga0070716_100145911 3300006173 Unclassified 1516
160 Ga0070712_100300761 3300006175 Unclassified 1298
161 Ga0097621_100002836 3300006237 Bacteria 11891
162 Ga0097621_100006364 3300006237 Bacteria 8379
163 Ga0097621_100017987 3300006237 Bacteria 5386
164 Ga0097621_100028230 3300006237 Bacteria 4422
165 Ga0097621_100032299 3300006237 Bacteria 4160
166 Ga0097621_100212414 3300006237 Unclassified 1683
167 Ga0068871_100000245 3300006358 Bacteria 37712
168 Ga0068871_100007073 3300006358 Bacteria 8000
169 Ga0068871_100007158 3300006358 Bacteria 7959
170 Ga0068871_100007552 3300006358 Bacteria 7778
171 Ga0068871_100083842 3300006358 Unclassified 2644
172 Ga0068871_100105554 3300006358 Bacteria 2364
173 Ga0075433_10011598 3300006852 Bacteria 7098
174 Ga0075433_10487849 3300006852 Unclassified 1085
175 Ga0075434_100001749 3300006871 Bacteria 18665
176 Ga0075434_100011482 3300006871 Bacteria 8359
177 Ga0075434_100017770 3300006871 Bacteria 6858
178 Ga0075434_100021755 3300006871 Bacteria 6238
179 Ga0068865_100013646 3300006881 Bacteria 5143
180 Ga0068865_100124412 3300006881 Bacteria 1922
181 Ga0068865_100268152 3300006881 Unclassified 1354
182 Ga0075436_100023451 3300006914 Unclassified 4238
183 Ga0097620_100000124 3300006931 Bacteria 73706
184 Ga0097620_100021644 3300006931 Bacteria 6453
185 Ga0097620_100144366 3300006931 Bacteria 2454
186 Ga0097620_100180203 3300006931 Bacteria 2195
187 Ga0075435_100214083 3300007076 Bacteria 1635
188 Ga0075435_100256981 3300007076 Bacteria 1488
189 Ga0099794_10055167 3300007265 Unclassified 1920
190 Ga0099795_10010006 3300007788 Bacteria 2775
191 Ga0105240_10021292 3300009093 Bacteria 8625
192 Ga0105240_10026310 3300009093 Bacteria 7633
193 Ga0105240_10051822 3300009093 Bacteria 5162
194 Ga0105240_10059411 3300009093 Bacteria 4772
195 Ga0105240_10117657 3300009093 Bacteria 3204
196 Ga0105240_10280894 3300009093 Unclassified 1912
197 Ga0105240_10531537 3300009093 Bacteria 1303
198 Ga0105245_10000384 3300009098 Bacteria 41154
199 Ga0105247_10027486 3300009101 Bacteria 3440
200 Ga0105247_10117415 3300009101 Unclassified 1720
201 Ga0114129_10818787 3300009147 Bacteria 1186
202 Ga0105243_10046716 3300009148 Bacteria 3406
203 Ga0105241_10017693 3300009174 Bacteria 5240
204 Ga0105241_10056869 3300009174 Unclassified 3000
205 Ga0105241_10117665 3300009174 Bacteria 2136
206 Ga0105242_10007515 3300009176 Bacteria 8386
207 Ga0105242_10039850 3300009176 Bacteria 3783
208 Ga0105242_10054964 3300009176 Unclassified 3256
209 Ga0105242_10282955 3300009176 Unclassified 1507
210 Ga0105248_10002889 3300009177 Bacteria 19071
211 Ga0105237_10038085 3300009545 Unclassified 4857
212 Ga0105237_10070920 3300009545 Bacteria 3480
213 Ga0105237_10143740 3300009545 Unclassified 2380
214 Ga0105237_10198992 3300009545 Bacteria 2003
215 Ga0105238_10001138 3300009551 Bacteria 26819
216 Ga0105238_10032956 3300009551 Bacteria 5273
217 Ga0105238_10068078 3300009551 Unclassified 3561
218 Ga0105238_10069156 3300009551 Bacteria 3531
219 Ga0105249_10015793 3300009553 Bacteria 6688
220 Ga0105249_10104448 3300009553 Bacteria 2670
221 Ga0105239_10052721 3300010375 Unclassified 4461
222 Ga0105239_10208051 3300010375 Unclassified 2192
223 Ga0105239_10456757 3300010375 Unclassified 1450
224 Ga0105246_10001874 3300011119 Bacteria 12677
225 Ga0157373_10001807 3300013100 Bacteria 16275
226 Ga0157373_10003494 3300013100 Bacteria 11885
227 Ga0157373_10132561 3300013100 Bacteria 1752
228 Ga0157371_10079489 3300013102 Bacteria 2323
229 Ga0157370_10037817 3300013104 Bacteria 4673
230 Ga0157370_10232210 3300013104 Bacteria 1707
231 Ga0157369_10000520 3300013105 Bacteria 50721
232 Ga0157369_10033952 3300013105 Bacteria 5603
233 Ga0157369_10106866 3300013105 Unclassified 2978
234 Ga0157369_10108378 3300013105 Bacteria 2954
235 Ga0157369_10302898 3300013105 Bacteria 1662
236 Ga0157374_10000309 3300013296 Bacteria 45241
237 Ga0157374_10000438 3300013296 Bacteria 37746
238 Ga0157374_10003861 3300013296 Bacteria 12584
239 Ga0157374_10006278 3300013296 Bacteria 10077
240 Ga0157374_10027982 3300013296 Bacteria 5090
241 Ga0157374_10083218 3300013296 Bacteria 3040
242 Ga0157374_10151415 3300013296 Bacteria 2255
243 Ga0157378_10000014 3300013297 Bacteria 144214
244 Ga0157378_10000169 3300013297 Bacteria 62092
245 Ga0157378_10000776 3300013297 Bacteria 29694
246 Ga0157378_10005535 3300013297 Bacteria 11061
247 Ga0157378_10009977 3300013297 Bacteria 8280
248 Ga0157378_10106927 3300013297 Bacteria 2560
249 Ga0157378_10220202 3300013297 Bacteria 1804
250 Ga0163162_10000969 3300013306 Bacteria 26659
251 Ga0163162_10004993 3300013306 Bacteria 12784
252 Ga0157372_10001303 3300013307 Bacteria 26974
253 Ga0157372_10003212 3300013307 Bacteria 17641
254 Ga0157372_10012525 3300013307 Bacteria 9032
255 Ga0157372_10035595 3300013307 Bacteria 5482
256 Ga0157372_10036670 3300013307 Bacteria 5405
257 Ga0157372_10056758 3300013307 Bacteria 4375
258 Ga0157372_10249279 3300013307 Bacteria 2061
259 Ga0157372_10302767 3300013307 Bacteria 1860
260 Ga0157372_10504901 3300013307 Bacteria 1410
261 Ga0157375_10060205 3300013308 Bacteria 3765
262 Ga0163163_10232930 3300014325 Bacteria 1891
263 Ga0163163_10439942 3300014325 Bacteria 1363
264 Ga0157380_10067442 3300014326 Unclassified 2881
265 Ga0157377_10026879 3300014745 Unclassified 3084
266 Ga0157377_10099617 3300014745 Unclassified 1729
267 Ga0157379_10063411 3300014968 Bacteria 3304
268 Ga0157379_10097233 3300014968 Bacteria 2643
269 Ga0157379_10223394 3300014968 Unclassified 1707
270 Ga0157376_10000040 3300014969 Bacteria 121140
271 Ga0157376_10005964 3300014969 Bacteria 8559
272 Ga0157376_10038936 3300014969 Bacteria 3872
273 Ga0157376_10081876 3300014969 Bacteria 2772
274 Ga0157376_10120631 3300014969 Bacteria 2323
275 Ga0182007_10006869 3300015262 Unclassified 4837
276 Ga0182005_1008617 3300015265 Unclassified 3000
277 Ga0228598_1002463 3300024227 Bacteria 4033
278 Ga0228598_1004288 3300024227 Bacteria 3022
279 Ga0207692_10028339 3300025898 Bacteria 2648
280 Ga0207692_10041309 3300025898 Unclassified 2282
281 Ga0207692_10054023 3300025898 Bacteria 2049
282 Ga0207692_10150885 3300025898 Unclassified 1331
283 Ga0207642_10004689 3300025899 Bacteria 4417
284 Ga0207710_10052548 3300025900 Bacteria 1831
285 Ga0207680_10008400 3300025903 Bacteria 5066
286 Ga0207680_10043225 3300025903 Bacteria 2641
287 Ga0207680_10054975 3300025903 Bacteria 2397
288 Ga0207647_10022290 3300025904 Unclassified 4209
289 Ga0207647_10044593 3300025904 Bacteria 2770
290 Ga0207699_10001289 3300025906 Bacteria 11908
291 Ga0207699_10025598 3300025906 Bacteria 3241
292 Ga0207645_10002040 3300025907 Bacteria 16218
293 Ga0207645_10016895 3300025907 Bacteria 4821
294 Ga0207643_10004027 3300025908 Bacteria 7906
295 Ga0207643_10035764 3300025908 Bacteria 2786
296 Ga0207684_10000311 3300025910 Bacteria 69074
297 Ga0207684_10001916 3300025910 Bacteria 21577
298 Ga0207684_10064327 3300025910 Bacteria 3114
299 Ga0207654_10018174 3300025911 Bacteria 3686
300 Ga0207654_10234906 3300025911 Unclassified 1222
301 Ga0207707_10042466 3300025912 Bacteria 3968
302 Ga0207695_10009961 3300025913 Bacteria 11680
303 Ga0207695_10015754 3300025913 Bacteria 8887
304 Ga0207695_10055043 3300025913 Bacteria 4149
305 Ga0207695_10104731 3300025913 Bacteria 2817
306 Ga0207695_10271283 3300025913 Unclassified 1592
307 Ga0207671_10364765 3300025914 Bacteria 1147
308 Ga0207693_10000187 3300025915 Bacteria 56636
309 Ga0207693_10003898 3300025915 Bacteria 12705
310 Ga0207663_10005706 3300025916 Bacteria 6297
311 Ga0207663_10010292 3300025916 Bacteria 4972
312 Ga0207663_10091115 3300025916 Bacteria 2023
313 Ga0207663_10118684 3300025916 Bacteria 1807
314 Ga0207660_10069708 3300025917 Bacteria 2554
315 Ga0207660_10074344 3300025917 Bacteria 2480
316 Ga0207662_10163538 3300025918 Unclassified 1423
317 Ga0207657_10003283 3300025919 Bacteria 17308
318 Ga0207657_10103573 3300025919 Unclassified 2359
319 Ga0207649_10027593 3300025920 Bacteria 3334
320 Ga0207649_10059813 3300025920 Bacteria 2392
321 Ga0207652_10017715 3300025921 Bacteria 5834
322 Ga0207652_10071353 3300025921 Bacteria 3018
323 Ga0207646_10000019 3300025922 Bacteria 282855
324 Ga0207646_10001331 3300025922 Bacteria 30697
325 Ga0207646_10001452 3300025922 Bacteria 29352
326 Ga0207646_10201057 3300025922 Bacteria 1800
327 Ga0207681_10013023 3300025923 Bacteria 5142
328 Ga0207694_10073818 3300025924 Bacteria 2670
329 Ga0207687_10003488 3300025927 Bacteria 10583
330 Ga0207687_10181960 3300025927 Bacteria 1629
331 Ga0207687_10247117 3300025927 Unclassified 1416
332 Ga0207700_10008192 3300025928 Bacteria 6457
333 Ga0207700_10009334 3300025928 Bacteria 6123
334 Ga0207700_10236257 3300025928 Bacteria 1556
335 Ga0207664_10000076 3300025929 Bacteria 102019
336 Ga0207664_10000767 3300025929 Bacteria 21745
337 Ga0207664_10103180 3300025929 Unclassified 2359
338 Ga0207664_10192187 3300025929 Bacteria 1758
339 Ga0207644_10291865 3300025931 Unclassified 1312
340 Ga0207690_10130992 3300025932 Bacteria 1835
341 Ga0207706_10000314 3300025933 Bacteria 52222
342 Ga0207706_10095721 3300025933 Unclassified 2611
343 Ga0207686_10163297 3300025934 Unclassified 1563
344 Ga0207670_10066715 3300025936 Bacteria 2473
345 Ga0207704_10096424 3300025938 Unclassified 1958
346 Ga0207665_10000998 3300025939 Bacteria 19108
347 Ga0207665_10004774 3300025939 Bacteria 9016
348 Ga0207665_10007290 3300025939 Bacteria 7317
349 Ga0207665_10018194 3300025939 Unclassified 4617
350 Ga0207665_10018426 3300025939 Bacteria 4588
351 Ga0207691_10012353 3300025940 Bacteria 8184
352 Ga0207711_10003765 3300025941 Bacteria 13059
353 Ga0207711_10052300 3300025941 Bacteria 3500
354 Ga0207711_10136323 3300025941 Unclassified 2205
355 Ga0207711_10188966 3300025941 Bacteria 1876
356 Ga0207689_10001495 3300025942 Bacteria 22315
357 Ga0207689_10004313 3300025942 Bacteria 12951
358 Ga0207689_10041640 3300025942 Bacteria 3801
359 Ga0207661_10227236 3300025944 Bacteria 1651
360 Ga0207679_10007461 3300025945 Bacteria 6939
361 Ga0207679_10191531 3300025945 Bacteria 1701
362 Ga0207667_10008285 3300025949 Bacteria 12366
363 Ga0207667_10008519 3300025949 Bacteria 12178
364 Ga0207667_10033050 3300025949 Bacteria 5566
365 Ga0207667_10082053 3300025949 Bacteria 3340
366 Ga0207667_10418033 3300025949 Unclassified 1364
367 Ga0207712_10017270 3300025961 Bacteria 4684
368 Ga0207712_10217604 3300025961 Bacteria 1525
369 Ga0207668_10033866 3300025972 Unclassified 3387
370 Ga0207640_10086961 3300025981 Bacteria 2154
371 Ga0207640_10122210 3300025981 Bacteria 1868
372 Ga0207658_10338104 3300025986 Unclassified 1308
373 Ga0207677_10005384 3300026023 Bacteria 6941
374 Ga0207677_10025287 3300026023 Bacteria 3702
375 Ga0207677_10058370 3300026023 Bacteria 2656
376 Ga0207703_10001379 3300026035 Bacteria 22200
377 Ga0207703_10006413 3300026035 Bacteria 9403
378 Ga0207703_10037492 3300026035 Bacteria 3862
379 Ga0207703_10252692 3300026035 Unclassified 1590
380 Ga0207703_10311459 3300026035 Unclassified 1439
381 Ga0207639_10123263 3300026041 Bacteria 2133
382 Ga0207678_10015761 3300026067 Bacteria 6644
383 Ga0207708_10353966 3300026075 Unclassified 1205
384 Ga0207702_10001839 3300026078 Bacteria 20886
385 Ga0207702_10003214 3300026078 Bacteria 15088
386 Ga0207702_10013854 3300026078 Bacteria 6698
387 Ga0207702_10015657 3300026078 Bacteria 6276
388 Ga0207702_10016781 3300026078 Bacteria 6061
389 Ga0207702_10138951 3300026078 Bacteria 2196
390 Ga0207641_10014722 3300026088 Bacteria 6412
391 Ga0207641_10024059 3300026088 Bacteria 5019
392 Ga0207641_10042933 3300026088 Bacteria 3795
393 Ga0207641_10120639 3300026088 Bacteria 2339
394 Ga0207648_10016933 3300026089 Bacteria 6641
395 Ga0207648_10049889 3300026089 Bacteria 3660
396 Ga0207648_10052272 3300026089 Unclassified 3572
397 Ga0207676_10015489 3300026095 Bacteria 5501
398 Ga0207676_10033150 3300026095 Bacteria 3900
399 Ga0207674_10001598 3300026116 Bacteria 29172
400 Ga0207674_10103205 3300026116 Bacteria 2831
401 Ga0207674_10142732 3300026116 Bacteria 2354
402 Ga0207675_100057723 3300026118 Bacteria 3622
403 Ga0207675_100062066 3300026118 Unclassified 3489
404 Ga0207683_10004093 3300026121 Bacteria 12592
405 Ga0207683_10084995 3300026121 Unclassified 2813
406 Ga0207698_10044289 3300026142 Bacteria 3342
407 Ga0207698_10224853 3300026142 Unclassified 1699
408 Ga0265356_1001632 3300028017 Bacteria 3237
409 Ga0265356_1003440 3300028017 Bacteria 2002
410 Ga0268266_10000645 3300028379 Bacteria 47339
411 Ga0268266_10069956 3300028379 Bacteria 3042
412 Ga0268266_10083957 3300028379 Unclassified 2780
413 Ga0268265_10082457 3300028380 Bacteria 2543
414 Ga0268264_10026623 3300028381 Bacteria 4726
415 Ga0268264_10031077 3300028381 Bacteria 4378
416 Ga0268264_10072784 3300028381 Bacteria 2915
417 Ga0268264_10195886 3300028381 Bacteria 1845
418 Ga0265762_1006618 3300030760 Bacteria 2071
419 Ga0265760_10002147 3300031090 Bacteria 5774
420 Ga0265330_10013869 3300031235 Bacteria 3748
421 Ga0265328_10027172 3300031239 Bacteria 2146
422 Ga0265328_10055715 3300031239 Unclassified 1451
423 Ga0265339_10010281 3300031249 Bacteria 5821
424 Ga0265331_10065944 3300031250 Bacteria 1701
425 Ga0265331_10092441 3300031250 Unclassified 1397
426 Ga0265316_10000914 3300031344 Bacteria 32110
427 Ga0265316_10067530 3300031344 Bacteria 2765
428 Ga0265314_10000915 3300031711 Bacteria 34762
429 Ga0265342_10187068 3300031712 Unclassified 1132
430 Ga0373930_0034795 3300034816 Unclassified 1051
431 Ga0373926_0055948 3300035083 Bacteria 1430
432 Ga0373940_0018826 3300035088 Unclassified 1737
433 Ga0373923_0001981 3300035111 Bacteria 6148
434 Ga0373936_0000360 3300035113 Bacteria 15449
435 Ga0373945_0006194 3300035116 Bacteria 3849
436 Ga0373960_0006851 3300035121 Bacteria 2684
437 Ga0373943_0000174 3300035170 Bacteria 25338
438 Ga0373946_0033435 3300035171 Bacteria 2070
439 Ga0373955_0018260 3300035172 Bacteria 3485
440 Ga0373961_0041393 3300035241 Unclassified 1331
441 Ga0373931_0038906 3300035691 Bacteria 2490
442 Ga0373931_0057501 3300035691 Bacteria 2086
443 Ga0373931_0108233 3300035691 Bacteria 1573
444 Ga0373931_0179368 3300035691 Bacteria 1253
445 Ga0373935_0008839 3300035692 Bacteria 6030
446 Ga0373927_0001175 3300035695 Bacteria 19832
447 Ga0373933_0034237 3300035724 Bacteria 2959
448 Ga0373947_0000058 3300035725 Bacteria 55174
449 Ga0373947_0088481 3300035725 Unclassified 1928
450 Ga0373937_0058665 3300036401 Bacteria 3536
451 Ga0373925_0000219 3300037068 Bacteria 61084
452 Ga0373925_0001347 3300037068 Bacteria 21411
453 Ga0373925_0055821 3300037068 Bacteria 2958
454 Ga0436364_1427836 3300037853 Bacteria 4213
455 Ga0436365_0705211 3300039437 Bacteria 1552
456 Ga0451577_0014343 3300042876 Bacteria 7388
457 Ga0453683_0004227 3300044673 Bacteria 10262
458 Ga0466961_0078766 3300044693 Unclassified 2087
459 Ga0466963_0036220 3300044694 Bacteria 3217
460 Ga0466964_0039073 3300044706 Unclassified 1910
461 Ga0453684_0034114 3300044712 Bacteria 7073
462 Ga0466957_0068347 3300044842 Unclassified 2193
463 Ga0451576_0014203 3300045051 Bacteria 8875
464 Ga0466967_0013612 3300045976 Bacteria 6295
465 Ga0466967_0096329 3300045976 Bacteria 2699
466 Ga0495603_0003069 3300046455 Bacteria 9913
467 Ga0495629_0052759 3300046459 Bacteria 2845
468 Ga0495641_0029924 3300046461 Bacteria 2618
469 Ga0495580_0002638 3300046472 Bacteria 15579
470 Ga0495580_0016783 3300046472 Bacteria 5494
471 Ga0495580_0029412 3300046472 Bacteria 3987
472 Ga0495580_0060611 3300046472 Unclassified 2658
473 Ga0495580_0162766 3300046472 Bacteria 1544
474 Ga0495582_0000630 3300046473 Bacteria 19417
475 Ga0495594_0073737 3300046499 Unclassified 1900
476 Ga0495618_0301302 3300046514 Unclassified 996
477 Ga0495628_0022122 3300046516 Bacteria 5226
478 Ga0495630_0033339 3300046517 Bacteria 3840
479 Ga0495666_0028956 3300046526 Unclassified 2725
480 Ga0495666_0044798 3300046526 Bacteria 2135
481 Ga0495665_0051258 3300046531 Unclassified 2186
482 Ga0495640_0051334 3300046533 Unclassified 2835
483 Ga0495586_0011413 3300046535 Bacteria 4727
484 Ga0495587_0044426 3300046536 Bacteria 2642
485 Ga0495622_0079066 3300046557 Bacteria 1514
486 Ga0495634_0299259 3300046642 Bacteria 973
487 Ga0495647_0002145 3300046681 Bacteria 6170
488 Ga0495658_0039826 3300046683 Unclassified 2609
489 Ga0495613_0006854 3300046689 Bacteria 8505
490 Ga0495624_0136719 3300046690 Unclassified 1502
491 Ga0495581_0021516 3300047315 Bacteria 3737
492 Ga0495674_0014612 3300047319 Bacteria 7348
493 Ga0495674_0014828 3300047319 Bacteria 7292
494 Ga0495676_0065161 3300047321 Unclassified 2829
495 Ga0495602_0075379 3300048088 Bacteria 2863
496 Ga0495602_0209713 3300048088 Bacteria 1480
497 Ga0495614_0011036 3300048089 Bacteria 3975
498 Ga0496100_0002894 3300048903 Bacteria 8806
499 Ga0496100_0043225 3300048903 Unclassified 2882
500 Ga0496101_0077629 3300048904 Bacteria 2448
501 Ga0496101_0204430 3300048904 Unclassified 1528
502 Ga0496101_0230278 3300048904 Unclassified 1440
503 Ga0496101_0287936 3300048904 Bacteria 1285
504 Ga0496102_0000827 3300048905 Bacteria 29910
505 Ga0496102_0080863 3300048905 Unclassified 2994
506 Ga0496102_0255265 3300048905 Bacteria 1653
507 Ga0496103_0005295 3300048906 Bacteria 7742
508 Ga0496103_0142177 3300048906 Bacteria 1535
509 Ga0496104_0073299 3300048907 Bacteria 3257
510 Ga0496104_0239177 3300048907 Unclassified 1728
511 Ga0496104_0407604 3300048907 Unclassified 1272
512 Ga0496105_0067310 3300048908 Bacteria 2957
513 Ga0496106_0139319 3300048909 Bacteria 1907
514 Ga0496106_0182358 3300048909 Unclassified 1667
515 Ga0496107_0253170 3300048910 Unclassified 1310
516 Ga0496108_0178125 3300048911 Unclassified 1841
517 Ga0496109_0062620 3300048912 Unclassified 3402
518 Ga0496110_0052784 3300048913 Unclassified 3572
519 Ga0496111_0263854 3300048914 Unclassified 1278
520 Ga0496112_0003006 3300048915 Bacteria 13793
521 Ga0496112_0030867 3300048915 Bacteria 5192
522 Ga0496112_0048364 3300048915 Bacteria 4170
523 Ga0496112_0105437 3300048915 Bacteria 2788
524 Ga0496112_0120582 3300048915 Bacteria 2592
525 Ga0496112_0129950 3300048915 Bacteria 2490
526 Ga0496112_0195933 3300048915 Bacteria 1981
527 Ga0496113_0211534 3300048916 Bacteria 1544
528 Ga0496114_0011363 3300048917 Bacteria 7112
529 Ga0496115_0026502 3300048918 Bacteria 4524
530 Ga0496115_0054173 3300048918 Bacteria 3220
531 Ga0496115_0072011 3300048918 Bacteria 2804
532 nmdc:mga0n895_13408_c1 3300050512 Bacteria 7392
533 nmdc:mga0n895_145631_c1 3300050512 Unclassified 2398
534 nmdc:mga0n895_204761_c1 3300050512 Bacteria 2004
535 nmdc:mga0n895_6801_c1 3300050512 Bacteria 9763
536 nmdc:mga0rr50_1154_c1 3300050513 Bacteria 14375
537 nmdc:mga0rr50_128560_c1 3300050513 Unclassified 2025
538 nmdc:mga0rr50_20476_c1 3300050513 Bacteria 4494
539 nmdc:mga08x19_10752_c1 3300050514 Bacteria 5500
540 nmdc:mga08x19_61884_c1 3300050514 Bacteria 2426
541 nmdc:mga0a205_4347_c2 3300050515 Bacteria 10363
542 nmdc:mga0a205_562_c1 3300050515 Bacteria 29493
543 Ga0495601_0130987 3300053077 Bacteria 1633
544 Ga0466962_0058608 3300061719 Unclassified 1838
545 Ga0265338_10053975
546 LJNas_1000461
547 Ga0070676_10024735
548 Ga0070676_10030576
549 Ga0070683_100026720
550 Ga0070683_100102581
551 Ga0070683_100149502
552 Ga0070690_100105213
553 Ga0070670_100001444
554 Ga0068869_100058599
555 Ga0070666_10006876
556 Ga0070680_100071324
557 Ga0070680_100171627
558 Ga0070682_100050669
559 Ga0068868_100000574
560 Ga0068868_100016657
561 Ga0068868_100021849
562 Ga0068868_100043127
563 Ga0070660_100024555
564 Ga0070689_100059632
565 Ga0070689_100085941
566 Ga0070687_100129169
567 Ga0070661_100016372
568 Ga0070661_100077498
569 Ga0070668_100009919
570 Ga0070668_100200671
571 Ga0070669_100003501
572 Ga0070669_100124785
573 Ga0070675_100057324
574 Ga0070688_100003742
575 Ga0070667_100099262
576 Ga0070709_10000932
577 Ga0070709_10190150
578 Ga0070714_100000388
579 Ga0070714_100094698
580 Ga0070714_100212805
581 Ga0070713_100001111
582 Ga0070713_100004058
583 Ga0070713_100068830
584 Ga0070713_100080917
585 Ga0070713_100098541
586 Ga0070710_10103006
587 Ga0070710_10112652
588 Ga0070710_10168066
589 Ga0070711_100000823
590 Ga0070711_100009146
591 Ga0070711_100014034
592 Ga0070711_100032132
593 Ga0070711_100035281
594 Ga0070705_100035289
595 Ga0070700_100090534
596 Ga0070700_100130771
597 Ga0070694_100181186
598 Ga0070708_100000233
599 Ga0070708_100004410
600 Ga0070708_100012490
601 Ga0070708_100014607
602 Ga0070708_100023418
603 Ga0070708_100062755
604 Ga0070708_100071802
605 Ga0070662_100003030
606 Ga0070662_100010913
607 Ga0070662_100049640
608 Ga0070681_10014252
609 Ga0070681_10084410
610 Ga0068867_100002427
611 Ga0068867_100065802
612 Ga0068867_100098291
613 Ga0070685_10006585
614 Ga0070706_100001512
615 Ga0070706_100005774
616 Ga0070706_100013563
617 Ga0070706_100031786
618 Ga0070706_100148188
619 Ga0070707_100001737
620 Ga0070707_100003795
621 Ga0070707_100006090
622 Ga0070707_100029169
623 Ga0070707_100160677
624 Ga0070707_100452882
625 Ga0070698_100005930
626 Ga0070698_100014991
627 Ga0070698_100024167
628 Ga0070698_100041061
629 Ga0070699_100000726
630 Ga0070699_100006013
631 Ga0070699_100008249
632 Ga0070699_100016113
633 Ga0070699_100023683
634 Ga0070699_100029179
635 Ga0070699_100113894
636 Ga0070679_100012961
637 Ga0070684_100016409
638 Ga0070684_100061701
639 Ga0070697_100001732
640 Ga0070697_100001839
641 Ga0070697_100002075
642 Ga0070697_100005046
643 Ga0070697_100006377
644 Ga0070697_100011689
645 Ga0070697_100022209
646 Ga0070697_100038130
647 Ga0070697_100043636
648 Ga0068853_100153583
649 Ga0070686_100045350
650 Ga0070696_100020413
651 Ga0070696_100097608
652 Ga0070696_100241653
653 Ga0070665_100000462
654 Ga0068855_100000935
655 Ga0068855_100004923
656 Ga0068855_100022403
657 Ga0068855_100037492
658 Ga0068855_100110169
659 Ga0070664_100006160
660 Ga0070664_100123210
661 Ga0068857_100000081
662 Ga0068857_100060245
663 Ga0068854_100046491
664 Ga0068854_100139417
665 Ga0068856_100000153
666 Ga0068856_100001083
667 Ga0068856_100008399
668 Ga0068856_100043427
669 Ga0068856_100048789
670 Ga0068856_100210388
671 Ga0068852_100044687
672 Ga0068852_100054371
673 Ga0068852_100058864
674 Ga0068852_100060362
675 Ga0068859_100000124
676 Ga0068859_100021644
677 Ga0068859_100144382
678 Ga0068859_100180219
679 Ga0068864_100000790
680 Ga0068866_10002929
681 Ga0068866_10004251
682 Ga0068861_100080282
683 Ga0068861_100410132
684 Ga0068870_10011981
685 Ga0068863_100001470
686 Ga0068863_100075461
687 Ga0068858_100000985
688 Ga0068858_100013171
689 Ga0068858_100058828
690 Ga0068858_100095748
691 Ga0068858_100100424
692 Ga0068860_100033246
693 Ga0068860_100090102
694 Ga0068860_100108102
695 Ga0068862_100012592
696 Ga0068862_100327254
697 Ga0070717_10004066
698 Ga0070717_10019232
699 Ga0070717_10047172
700 Ga0070715_10008636
701 Ga0070716_100004605
702 Ga0070716_100007207
703 Ga0070716_100145911
704 Ga0070712_100300761
705 Ga0097621_100002836
706 Ga0097621_100006364
707 Ga0097621_100017987
708 Ga0097621_100028230
709 Ga0097621_100032299
710 Ga0097621_100212414
711 Ga0068871_100000245
712 Ga0068871_100007073
713 Ga0068871_100007158
714 Ga0068871_100007552
715 Ga0068871_100083842
716 Ga0068871_100105554
717 Ga0075433_10011598
718 Ga0075433_10487849
719 Ga0075434_100001749
720 Ga0075434_100011482
721 Ga0075434_100017770
722 Ga0075434_100021755
723 Ga0068865_100013646
724 Ga0068865_100124412
725 Ga0068865_100268152
726 Ga0075436_100023451
727 Ga0097620_100000124
728 Ga0097620_100021644
729 Ga0097620_100144366
730 Ga0097620_100180203
731 Ga0075435_100214083
732 Ga0075435_100256981
733 Ga0099794_10055167
734 Ga0099795_10010006
735 Ga0105240_10021292
736 Ga0105240_10026310
737 Ga0105240_10051822
738 Ga0105240_10059411
739 Ga0105240_10117657
740 Ga0105240_10280894
741 Ga0105240_10531537
742 Ga0105245_10000384
743 Ga0105247_10027486
744 Ga0105247_10117415
745 Ga0114129_10818787
746 Ga0105243_10046716
747 Ga0105241_10017693
748 Ga0105241_10056869
749 Ga0105241_10117665
750 Ga0105242_10007515
751 Ga0105242_10039850
752 Ga0105242_10054964
753 Ga0105242_10282955
754 Ga0105248_10002889
755 Ga0105237_10038085
756 Ga0105237_10070920
757 Ga0105237_10143740
758 Ga0105237_10198992
759 Ga0105238_10001138
760 Ga0105238_10032956
761 Ga0105238_10068078
762 Ga0105238_10069156
763 Ga0105249_10015793
764 Ga0105249_10104448
765 Ga0105239_10052721
766 Ga0105239_10208051
767 Ga0105239_10456757
768 Ga0105246_10001874
769 Ga0157373_10001807
770 Ga0157373_10003494
771 Ga0157373_10132561
772 Ga0157371_10079489
773 Ga0157370_10037817
774 Ga0157370_10232210
775 Ga0157369_10000520
776 Ga0157369_10033952
777 Ga0157369_10106866
778 Ga0157369_10108378
779 Ga0157369_10302898
780 Ga0157374_10000309
781 Ga0157374_10000438
782 Ga0157374_10003861
783 Ga0157374_10006278
784 Ga0157374_10027982
785 Ga0157374_10083218
786 Ga0157374_10151415
787 Ga0157378_10000014
788 Ga0157378_10000169
789 Ga0157378_10000776
790 Ga0157378_10005535
791 Ga0157378_10009977
792 Ga0157378_10106927
793 Ga0157378_10220202
794 Ga0163162_10000969
795 Ga0163162_10004993
796 Ga0157372_10001303
797 Ga0157372_10003212
798 Ga0157372_10012525
799 Ga0157372_10035595
800 Ga0157372_10036670
801 Ga0157372_10056758
802 Ga0157372_10249279
803 Ga0157372_10302767
804 Ga0157372_10504901
805 Ga0157375_10060205
806 Ga0163163_10232930
807 Ga0163163_10439942
808 Ga0157380_10067442
809 Ga0157377_10026879
810 Ga0157377_10099617
811 Ga0157379_10063411
812 Ga0157379_10097233
813 Ga0157379_10223394
814 Ga0157376_10000040
815 Ga0157376_10005964
816 Ga0157376_10038936
817 Ga0157376_10081876
818 Ga0157376_10120631
819 Ga0182007_10006869
820 Ga0182005_1008617
821 Ga0228598_1002463
822 Ga0228598_1004288
823 Ga0207692_10028339
824 Ga0207692_10041309
825 Ga0207692_10054023
826 Ga0207692_10150885
827 Ga0207642_10004689
828 Ga0207710_10052548
829 Ga0207680_10008400
830 Ga0207680_10043225
831 Ga0207680_10054975
832 Ga0207647_10022290
833 Ga0207647_10044593
834 Ga0207699_10001289
835 Ga0207699_10025598
836 Ga0207645_10002040
837 Ga0207645_10016895
838 Ga0207643_10004027
839 Ga0207643_10035764
840 Ga0207684_10000311
841 Ga0207684_10001916
842 Ga0207684_10064327
843 Ga0207654_10018174
844 Ga0207654_10234906
845 Ga0207707_10042466
846 Ga0207695_10009961
847 Ga0207695_10015754
848 Ga0207695_10055043
849 Ga0207695_10104731
850 Ga0207695_10271283
851 Ga0207671_10364765
852 Ga0207693_10000187
853 Ga0207693_10003898
854 Ga0207663_10005706
855 Ga0207663_10010292
856 Ga0207663_10091115
857 Ga0207663_10118684
858 Ga0207660_10069708
859 Ga0207660_10074344
860 Ga0207662_10163538
861 Ga0207657_10003283
862 Ga0207657_10103573
863 Ga0207649_10027593
864 Ga0207649_10059813
865 Ga0207652_10017715
866 Ga0207652_10071353
867 Ga0207646_10000019
868 Ga0207646_10001331
869 Ga0207646_10001452
870 Ga0207646_10201057
871 Ga0207681_10013023
872 Ga0207694_10073818
873 Ga0207687_10003488
874 Ga0207687_10181960
875 Ga0207687_10247117
876 Ga0207700_10008192
877 Ga0207700_10009334
878 Ga0207700_10236257
879 Ga0207664_10000076
880 Ga0207664_10000767
881 Ga0207664_10103180
882 Ga0207664_10192187
883 Ga0207644_10291865
884 Ga0207690_10130992
885 Ga0207706_10000314
886 Ga0207706_10095721
887 Ga0207686_10163297
888 Ga0207670_10066715
889 Ga0207704_10096424
890 Ga0207665_10000998
891 Ga0207665_10004774
892 Ga0207665_10007290
893 Ga0207665_10018194
894 Ga0207665_10018426
895 Ga0207691_10012353
896 Ga0207711_10003765
897 Ga0207711_10052300
898 Ga0207711_10136323
899 Ga0207711_10188966
900 Ga0207689_10001495
901 Ga0207689_10004313
902 Ga0207689_10041640
903 Ga0207661_10227236
904 Ga0207679_10007461
905 Ga0207679_10191531
906 Ga0207667_10008285
907 Ga0207667_10008519
908 Ga0207667_10033050
909 Ga0207667_10082053
910 Ga0207667_10418033
911 Ga0207712_10017270
912 Ga0207712_10217604
913 Ga0207668_10033866
914 Ga0207640_10086961
915 Ga0207640_10122210
916 Ga0207658_10338104
917 Ga0207677_10005384
918 Ga0207677_10025287
919 Ga0207677_10058370
920 Ga0207703_10001379
921 Ga0207703_10006413
922 Ga0207703_10037492
923 Ga0207703_10252692
924 Ga0207703_10311459
925 Ga0207639_10123263
926 Ga0207678_10015761
927 Ga0207708_10353966
928 Ga0207702_10001839
929 Ga0207702_10003214
930 Ga0207702_10013854
931 Ga0207702_10015657
932 Ga0207702_10016781
933 Ga0207702_10138951
934 Ga0207641_10014722
935 Ga0207641_10024059
936 Ga0207641_10042933
937 Ga0207641_10120639
938 Ga0207648_10016933
939 Ga0207648_10049889
940 Ga0207648_10052272
941 Ga0207676_10015489
942 Ga0207676_10033150
943 Ga0207674_10001598
944 Ga0207674_10103205
945 Ga0207674_10142732
946 Ga0207675_100057723
947 Ga0207675_100062066
948 Ga0207683_10004093
949 Ga0207683_10084995
950 Ga0207698_10044289
951 Ga0207698_10224853
952 Ga0265356_1001632
953 Ga0265356_1003440
954 Ga0268266_10000645
955 Ga0268266_10069956
956 Ga0268266_10083957
957 Ga0268265_10082457
958 Ga0268264_10026623
959 Ga0268264_10031077
960 Ga0268264_10072784
961 Ga0268264_10195886
962 Ga0265762_1006618
963 Ga0265760_10002147
964 Ga0265330_10013869
965 Ga0265328_10027172
966 Ga0265328_10055715
967 Ga0265339_10010281
968 Ga0265331_10065944
969 Ga0265331_10092441
970 Ga0265316_10000914
971 Ga0265316_10067530
972 Ga0265314_10000915
973 Ga0265342_10187068
974 Ga0373930_0034795
975 Ga0373926_0055948
976 Ga0373940_0018826
977 Ga0373923_0001981
978 Ga0373936_0000360
979 Ga0373945_0006194
980 Ga0373960_0006851
981 Ga0373943_0000174
982 Ga0373946_0033435
983 Ga0373955_0018260
984 Ga0373961_0041393
985 Ga0373931_0038906
986 Ga0373931_0057501
987 Ga0373931_0108233
988 Ga0373931_0179368
989 Ga0373935_0008839
990 Ga0373927_0001175
991 Ga0373933_0034237
992 Ga0373947_0000058
993 Ga0373947_0088481
994 Ga0373937_0058665
995 Ga0373925_0000219
996 Ga0373925_0001347
997 Ga0373925_0055821
998 Ga0436364_1427836
999 Ga0436365_0705211
1000 Ga0451577_0014343
1001 Ga0453683_0004227
1002 Ga0466961_0078766
1003 Ga0466963_0036220
1004 Ga0466964_0039073
1005 Ga0453684_0034114
1006 Ga0466957_0068347
1007 Ga0451576_0014203
1008 Ga0466967_0013612
1009 Ga0466967_0096329
1010 Ga0495603_0003069
1011 Ga0495629_0052759
1012 Ga0495641_0029924
1013 Ga0495580_0002638
1014 Ga0495580_0016783
1015 Ga0495580_0029412
1016 Ga0495580_0060611
1017 Ga0495580_0162766
1018 Ga0495582_0000630
1019 Ga0495594_0073737
1020 Ga0495618_0301302
1021 Ga0495628_0022122
1022 Ga0495630_0033339
1023 Ga0495666_0028956
1024 Ga0495666_0044798
1025 Ga0495665_0051258
1026 Ga0495640_0051334
1027 Ga0495586_0011413
1028 Ga0495587_0044426
1029 Ga0495622_0079066
1030 Ga0495634_0299259
1031 Ga0495647_0002145
1032 Ga0495658_0039826
1033 Ga0495613_0006854
1034 Ga0495624_0136719
1035 Ga0495581_0021516
1036 Ga0495674_0014612
1037 Ga0495674_0014828
1038 Ga0495676_0065161
1039 Ga0495602_0075379
1040 Ga0495602_0209713
1041 Ga0495614_0011036
1042 Ga0496100_0002894
1043 Ga0496100_0043225
1044 Ga0496101_0077629
1045 Ga0496101_0204430
1046 Ga0496101_0230278
1047 Ga0496101_0287936
1048 Ga0496102_0000827
1049 Ga0496102_0080863
1050 Ga0496102_0255265
1051 Ga0496103_0005295
1052 Ga0496103_0142177
1053 Ga0496104_0073299
1054 Ga0496104_0239177
1055 Ga0496104_0407604
1056 Ga0496105_0067310
1057 Ga0496106_0139319
1058 Ga0496106_0182358
1059 Ga0496107_0253170
1060 Ga0496108_0178125
1061 Ga0496109_0062620
1062 Ga0496110_0052784
1063 Ga0496111_0263854
1064 Ga0496112_0003006
1065 Ga0496112_0030867
1066 Ga0496112_0048364
1067 Ga0496112_0105437
1068 Ga0496112_0120582
1069 Ga0496112_0129950
1070 Ga0496112_0195933
1071 Ga0496113_0211534
1072 Ga0496114_0011363
1073 Ga0496115_0026502
1074 Ga0496115_0054173
1075 Ga0496115_0072011
1076 nmdc:mga0n895_13408_c1
1077 nmdc:mga0n895_145631_c1
1078 nmdc:mga0n895_204761_c1
1079 nmdc:mga0n895_6801_c1
1080 nmdc:mga0rr50_1154_c1
1081 nmdc:mga0rr50_128560_c1
1082 nmdc:mga0rr50_20476_c1
1083 nmdc:mga08x19_10752_c1
1084 nmdc:mga08x19_61884_c1
1085 nmdc:mga0a205_4347_c2
1086 nmdc:mga0a205_562_c1
1087 Ga0495601_0130987
1088 Ga0466962_0058608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02237

BPL_C

Biotin protein ligase C terminal domain

348

390

0.98

PF08279

HTH_11

HTH domain

71

126

0.96

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

158

281

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e41-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with the reaction product analog biotinol-5'-amp, mutations r48a and k111a 0.9375 119 366
2djz-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111a mutation 0.936 119 367
2e65-assembly1.cif.gz_A crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a 0.9298 119 369
2e65-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a 0.9279 119 369
2dz9-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation d104a 0.9278 119 368
ID Description Score Start End Superfamily
2e65B01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9244 119 320 3.30.930.10
1bibA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.919 113 321 3.30.930.10
1biaA03 Mainly Beta;Roll;SH3 type barrels.; 0.9076 325 369 2.30.30.100
2eayB01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9076 126 318 3.30.930.10
3rkxA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9047 114 321 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A831JIS3-F1-model_v4 deleted 0.9569 123 366
AF-A0A661VH49-F1-model_v4 biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) 0.9555 170 370 GO:0004077
GO:0005737
GO:0036211
AF-A0A321LP20-F1-model_v4 biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) 0.9549 122 370 GO:0004077
GO:0005737
GO:0036211
AF-A0A523YPS8-F1-model_v4 biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) 0.9522 108 370 GO:0004077
GO:0005737
GO:0036211
AF-A0A1G0SHZ1-F1-model_v4 biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) 0.9475 109 370 GO:0004077
GO:0005737
GO:0036211

Map