F461731

General Info

Members Datasets Scaffolds Average Seq Length
544 297 528 317

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10350668|Ga0157369_103506682
Length 367
Sequence MSCHIENCTRPVNLYSAFRTAAHQLGFQGGRRDGGDVLAATAVSQSAADPLSGLVLSEMAQPRPKPGWAVVQVVSSSLNMHDLWTLRGVGHPAEQLPIVLGCDAAGYDEDGNAVIVYPVIGDYDAGRGDETLDPNRALLSERHDGAFAEYLTVPRRNLVPKPDWLSFDEAACLPVAWTTAYRMLFTQANIRAGDRVLVQGAGGGVTSAAIKLAVAAGAVVYATSRSESKRAQAMSWGARVALPPGERLPERVDLVIETVGEATWSHSLKALRPGGTVVIAGATTGMNPPADLGRIFYLQQRILGSTGSTRAELVAMLRMLEATGVRPVIDRTLSLSEIHKGFQLMIDGSLTGKVVVHPAAPDDQGMS

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
4 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
5 2773857922 Frankia sp. CcI49 Isolate Nodule
6 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
7 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
8 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
9 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
10 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
11 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
12 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
13 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
205 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
206 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
207 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
296 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
297 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0.37
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0.55
Rhizoplane 7.17
Rhizosphere 87.68
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10021259 3300001989 Bacteria 2311
2 JGI24750J21931_1003454 3300002070 Bacteria 1891
3 JGI24745J21846_1001714 3300002073 Bacteria 2158
4 JGI24744J21845_10000214 3300002077 Bacteria 9078
5 JGI24742J22300_10005898 3300002244 Bacteria 2017
6 rootH2_10015800 3300003320 Bacteria 13608
7 rootL2_10002683 3300003322 Bacteria 7243
8 rootH1_10018354 3300003323 Bacteria 16678
9 rootH1_10031413 3300003323 Bacteria 4429
10 Ga0055540_1000104 3300003792 Bacteria 93795
11 Ga0070658_10109080 3300005327 Bacteria 2291
12 Ga0070676_10267502 3300005328 Bacteria 1147
13 Ga0070683_100289167 3300005329 Bacteria 1559
14 Ga0070690_100051518 3300005330 Bacteria 2628
15 Ga0070670_100102437 3300005331 Bacteria 2465
16 Ga0068869_100259676 3300005334 Bacteria 1390
17 Ga0068868_100013706 3300005338 Bacteria 5955
18 Ga0068868_100017998 3300005338 Bacteria 5273
19 Ga0068868_100077977 3300005338 Bacteria 2651
20 Ga0070689_100076306 3300005340 Bacteria 2625
21 Ga0070689_100139206 3300005340 Bacteria 1951
22 Ga0070668_100288935 3300005347 Bacteria 1372
23 Ga0070675_100102732 3300005354 Bacteria 2409
24 Ga0070671_100073012 3300005355 Bacteria 2866
25 Ga0070671_100177293 3300005355 Bacteria 1804
26 Ga0070674_100054217 3300005356 Bacteria 2772
27 Ga0070674_100154890 3300005356 Bacteria 1733
28 Ga0070673_100211266 3300005364 Bacteria 1676
29 Ga0070659_100290470 3300005366 Bacteria 1362
30 Ga0070667_100124386 3300005367 Bacteria 2246
31 Ga0070703_10077238 3300005406 Bacteria 1126
32 Ga0070709_10002658 3300005434 Bacteria 9653
33 Ga0070709_10006128 3300005434 Bacteria 6543
34 Ga0070709_10009034 3300005434 Bacteria 5489
35 Ga0070714_100000050 3300005435 Bacteria 110823
36 Ga0070714_100007913 3300005435 Bacteria 8278
37 Ga0070713_100027813 3300005436 Bacteria 4458
38 Ga0070713_100031034 3300005436 Bacteria 4251
39 Ga0070713_100061131 3300005436 Bacteria 3151
40 Ga0070713_100092741 3300005436 Bacteria 2601
41 Ga0070713_100146567 3300005436 Bacteria 2096
42 Ga0070713_100159271 3300005436 Bacteria 2014
43 Ga0070710_10008764 3300005437 Bacteria 4933
44 Ga0070711_100015764 3300005439 Bacteria 4786
45 Ga0070711_100157550 3300005439 Bacteria 1718
46 Ga0070711_100182641 3300005439 Bacteria 1606
47 Ga0070705_100041053 3300005440 Bacteria 2635
48 Ga0070705_100244608 3300005440 Bacteria 1256
49 Ga0070700_100010564 3300005441 Bacteria 5100
50 Ga0070708_100380935 3300005445 Bacteria 1330
51 Ga0070663_100131412 3300005455 Bacteria 1901
52 Ga0070678_100007402 3300005456 Bacteria 6508
53 Ga0070662_100011728 3300005457 Bacteria 5787
54 Ga0070681_10140115 3300005458 Bacteria 2349
55 Ga0070681_10396519 3300005458 Bacteria 1291
56 Ga0068867_100028304 3300005459 Bacteria 4035
57 Ga0070707_100000127 3300005468 Bacteria 71273
58 Ga0070707_100186135 3300005468 Bacteria 2025
59 Ga0070698_100001111 3300005471 Bacteria 29683
60 Ga0070698_100089512 3300005471 Bacteria 3061
61 Ga0070684_100154423 3300005535 Bacteria 2081
62 Ga0070672_100125728 3300005543 Bacteria 2103
63 Ga0070695_100041282 3300005545 Bacteria 2923
64 Ga0070695_100330088 3300005545 Bacteria 1137
65 Ga0070696_100203662 3300005546 Bacteria 1478
66 Ga0070665_100048971 3300005548 Bacteria 4241
67 Ga0070665_100120095 3300005548 Bacteria 2630
68 Ga0070704_100013524 3300005549 Bacteria 5066
69 Ga0068857_100096627 3300005577 Bacteria 2647
70 Ga0068856_100008985 3300005614 Bacteria 9722
71 Ga0068856_100128643 3300005614 Bacteria 2536
72 Ga0068856_100444354 3300005614 Bacteria 1317
73 Ga0070702_100014720 3300005615 Bacteria 3975
74 Ga0070702_100032009 3300005615 Bacteria 2883
75 Ga0070702_100055773 3300005615 Bacteria 2279
76 Ga0068852_100013804 3300005616 Bacteria 6194
77 Ga0068852_100032489 3300005616 Bacteria 4322
78 Ga0068859_100168620 3300005617 Bacteria 2270
79 Ga0068859_100246895 3300005617 Bacteria 1875
80 Ga0068864_100052883 3300005618 Bacteria 3501
81 Ga0068864_100276038 3300005618 Bacteria 1567
82 Ga0068863_100114972 3300005841 Bacteria 2564
83 Ga0068863_100420867 3300005841 Bacteria 1309
84 Ga0068858_100132645 3300005842 Bacteria 2336
85 Ga0068858_100213216 3300005842 Bacteria 1827
86 Ga0068858_100278544 3300005842 Bacteria 1592
87 Ga0068860_100075350 3300005843 Bacteria 3209
88 Ga0068860_100394694 3300005843 Bacteria 1368
89 Ga0068862_100215699 3300005844 Bacteria 1736
90 Ga0068862_100367355 3300005844 Bacteria 1338
91 Ga0081540_1000735 3300005983 Bacteria 30170
92 Ga0081540_1000803 3300005983 Bacteria 28862
93 Ga0081540_1071029 3300005983 Bacteria 1610
94 Ga0070717_10009814 3300006028 Bacteria 7208
95 Ga0070717_10038283 3300006028 Bacteria 3898
96 Ga0070717_10044593 3300006028 Bacteria 3622
97 Ga0070717_10122878 3300006028 Bacteria 2226
98 Ga0070715_10031756 3300006163 Bacteria 2146
99 Ga0070715_10031895 3300006163 Bacteria 2142
100 Ga0070715_10070264 3300006163 Bacteria 1562
101 Ga0070715_10098391 3300006163 Bacteria 1360
102 Ga0070716_100002471 3300006173 Bacteria 8534
103 Ga0070716_100007180 3300006173 Bacteria 5477
104 Ga0070716_100146002 3300006173 Bacteria 1515
105 Ga0070712_100015940 3300006175 Bacteria 4847
106 Ga0070712_100061822 3300006175 Bacteria 2647
107 Ga0070712_100170276 3300006175 Bacteria 1689
108 Ga0070712_100184902 3300006175 Bacteria 1626
109 Ga0075369_10004313 3300006186 Bacteria 5243
110 Ga0075369_10011213 3300006186 Bacteria 3521
111 Ga0097621_100010723 3300006237 Bacteria 6720
112 Ga0097621_100013389 3300006237 Bacteria 6115
113 Ga0068871_100037177 3300006358 Bacteria 3882
114 Ga0068871_100159858 3300006358 Bacteria 1926
115 Ga0075428_100284936 3300006844 Bacteria 1777
116 Ga0075433_10065017 3300006852 Bacteria 3199
117 Ga0075434_100060751 3300006871 Bacteria 3759
118 Ga0075434_100160162 3300006871 Bacteria 2270
119 Ga0068865_100004759 3300006881 Bacteria 8206
120 Ga0068865_100072506 3300006881 Bacteria 2447
121 Ga0068865_100115625 3300006881 Bacteria 1986
122 Ga0075436_100003312 3300006914 Bacteria 11020
123 Ga0075436_100006552 3300006914 Bacteria 7970
124 Ga0097620_100168627 3300006931 Bacteria 2270
125 Ga0097620_100246899 3300006931 Bacteria 1875
126 Ga0075435_100035429 3300007076 Bacteria 3961
127 Ga0075435_100202456 3300007076 Bacteria 1682
128 Ga0075435_100296827 3300007076 Bacteria 1382
129 Ga0105240_10056625 3300009093 Bacteria 4905
130 Ga0105240_10094429 3300009093 Bacteria 3648
131 Ga0111539_10278811 3300009094 Bacteria 1945
132 Ga0105245_10004477 3300009098 Bacteria 12349
133 Ga0105245_10025969 3300009098 Bacteria 5153
134 Ga0105245_10082476 3300009098 Bacteria 2941
135 Ga0105245_10104583 3300009098 Bacteria 2625
136 Ga0105245_10105220 3300009098 Bacteria 2617
137 Ga0105245_10238289 3300009098 Bacteria 1762
138 Ga0105247_10056817 3300009101 Bacteria 2418
139 Ga0105243_10095716 3300009148 Bacteria 2454
140 Ga0105241_10122424 3300009174 Bacteria 2097
141 Ga0105241_10246984 3300009174 Bacteria 1511
142 Ga0105248_10265765 3300009177 Bacteria 1931
143 Ga0105237_10154041 3300009545 Bacteria 2295
144 Ga0105237_10206769 3300009545 Bacteria 1963
145 Ga0105237_10315820 3300009545 Bacteria 1566
146 Ga0105237_10422804 3300009545 Bacteria 1338
147 Ga0105238_10089225 3300009551 Bacteria 3070
148 Ga0105238_10265371 3300009551 Bacteria 1697
149 Ga0105249_10146861 3300009553 Bacteria 2266
150 Ga0105239_10024363 3300010375 Bacteria 6667
151 Ga0105239_10038218 3300010375 Bacteria 5260
152 Ga0105239_10109146 3300010375 Bacteria 3066
153 Ga0105246_10266640 3300011119 Bacteria 1367
154 Ga0157371_10076000 3300013102 Bacteria 2379
155 Ga0157370_10014832 3300013104 Bacteria 7951
156 Ga0157369_10088068 3300013105 Bacteria 3314
157 Ga0157369_10124106 3300013105 Bacteria 2739
158 Ga0157369_10168511 3300013105 Bacteria 2309
159 Ga0157369_10350668 3300013105 Bacteria 1533
160 Ga0157369_10660013 3300013105 Bacteria 1078
161 Ga0157374_10015824 3300013296 Bacteria 6627
162 Ga0157374_10020623 3300013296 Bacteria 5852
163 Ga0157378_10022158 3300013297 Bacteria 5590
164 Ga0157378_10361859 3300013297 Bacteria 1420
165 Ga0157378_10444189 3300013297 Bacteria 1286
166 Ga0163162_10007047 3300013306 Bacteria 10898
167 Ga0163162_10026165 3300013306 Bacteria 5766
168 Ga0163162_10210298 3300013306 Bacteria 2075
169 Ga0157372_10025001 3300013307 Bacteria 6490
170 Ga0157372_10112948 3300013307 Bacteria 3113
171 Ga0157372_10354380 3300013307 Bacteria 1710
172 Ga0157375_10080366 3300013308 Bacteria 3298
173 Ga0157375_10132538 3300013308 Bacteria 2613
174 Ga0163163_10180320 3300014325 Bacteria 2159
175 Ga0163163_10299067 3300014325 Bacteria 1662
176 Ga0163163_10343198 3300014325 Bacteria 1549
177 Ga0157380_10283366 3300014326 Bacteria 1518
178 Ga0157377_10075189 3300014745 Bacteria 1961
179 Ga0157379_10011804 3300014968 Bacteria 7631
180 Ga0157379_10012642 3300014968 Bacteria 7376
181 Ga0157379_10044971 3300014968 Bacteria 3941
182 Ga0157379_10104922 3300014968 Bacteria 2536
183 Ga0157379_10211929 3300014968 Bacteria 1754
184 Ga0157379_10290196 3300014968 Bacteria 1490
185 Ga0157376_10013931 3300014969 Bacteria 6013
186 Ga0163161_10027335 3300017792 Bacteria 4046
187 Ga0206356_10036690 3300020070 Bacteria 2437
188 Ga0206353_11782425 3300020082 Bacteria 1829
189 Ga0209051_1000231 3300025303 Bacteria 93859
190 Ga0207697_10012888 3300025315 Bacteria 3496
191 Ga0207653_10021709 3300025885 Bacteria 2036
192 Ga0207692_10005854 3300025898 Bacteria 4954
193 Ga0207692_10007217 3300025898 Bacteria 4542
194 Ga0207692_10023049 3300025898 Bacteria 2875
195 Ga0207692_10034515 3300025898 Bacteria 2450
196 Ga0207692_10087651 3300025898 Bacteria 1680
197 Ga0207642_10015743 3300025899 Bacteria 2828
198 Ga0207642_10130742 3300025899 Bacteria 1310
199 Ga0207710_10018144 3300025900 Bacteria 2991
200 Ga0207710_10090267 3300025900 Bacteria 1433
201 Ga0207688_10039963 3300025901 Bacteria 2606
202 Ga0207688_10054315 3300025901 Bacteria 2247
203 Ga0207688_10059170 3300025901 Bacteria 2157
204 Ga0207688_10110902 3300025901 Bacteria 1592
205 Ga0207680_10057681 3300025903 Bacteria 2350
206 Ga0207647_10045073 3300025904 Bacteria 2753
207 Ga0207685_10001274 3300025905 Bacteria 5157
208 Ga0207685_10021614 3300025905 Bacteria 2159
209 Ga0207685_10060312 3300025905 Bacteria 1499
210 Ga0207699_10002383 3300025906 Bacteria 8868
211 Ga0207699_10005542 3300025906 Bacteria 6055
212 Ga0207699_10231087 3300025906 Bacteria 1267
213 Ga0207645_10006008 3300025907 Bacteria 8732
214 Ga0207643_10085777 3300025908 Bacteria 1829
215 Ga0207684_10018829 3300025910 Bacteria 5906
216 Ga0207654_10024231 3300025911 Bacteria 3260
217 Ga0207654_10102086 3300025911 Bacteria 1769
218 Ga0207695_10053990 3300025913 Bacteria 4199
219 Ga0207671_10014463 3300025914 Bacteria 6234
220 Ga0207671_10057096 3300025914 Bacteria 2893
221 Ga0207693_10005274 3300025915 Bacteria 10809
222 Ga0207693_10006705 3300025915 Bacteria 9508
223 Ga0207693_10016500 3300025915 Bacteria 5901
224 Ga0207693_10148036 3300025915 Bacteria 1846
225 Ga0207663_10037153 3300025916 Bacteria 2934
226 Ga0207663_10038546 3300025916 Bacteria 2890
227 Ga0207663_10139452 3300025916 Bacteria 1687
228 Ga0207663_10158364 3300025916 Bacteria 1596
229 Ga0207663_10289197 3300025916 Bacteria 1220
230 Ga0207662_10022858 3300025918 Bacteria 3589
231 Ga0207662_10034019 3300025918 Bacteria 2974
232 Ga0207657_10040850 3300025919 Bacteria 4106
233 Ga0207646_10000264 3300025922 Bacteria 71299
234 Ga0207646_10030324 3300025922 Bacteria 4904
235 Ga0207646_10074362 3300025922 Bacteria 3035
236 Ga0207681_10190018 3300025923 Bacteria 1571
237 Ga0207694_10303173 3300025924 Bacteria 1316
238 Ga0207659_10158253 3300025926 Bacteria 1775
239 Ga0207659_10213692 3300025926 Bacteria 1547
240 Ga0207687_10002019 3300025927 Bacteria 13915
241 Ga0207687_10005276 3300025927 Bacteria 8568
242 Ga0207687_10009296 3300025927 Bacteria 6429
243 Ga0207687_10061644 3300025927 Bacteria 2649
244 Ga0207687_10084176 3300025927 Bacteria 2305
245 Ga0207700_10015170 3300025928 Bacteria 5070
246 Ga0207700_10022164 3300025928 Bacteria 4352
247 Ga0207700_10097823 3300025928 Bacteria 2333
248 Ga0207700_10102344 3300025928 Bacteria 2287
249 Ga0207700_10108680 3300025928 Bacteria 2227
250 Ga0207700_10127229 3300025928 Bacteria 2074
251 Ga0207664_10000003 3300025929 Bacteria 510966
252 Ga0207664_10005800 3300025929 Bacteria 8444
253 Ga0207664_10007882 3300025929 Bacteria 7399
254 Ga0207664_10051797 3300025929 Bacteria 3243
255 Ga0207664_10326843 3300025929 Bacteria 1354
256 Ga0207690_10033566 3300025932 Bacteria 3300
257 Ga0207690_10216803 3300025932 Bacteria 1462
258 Ga0207706_10009290 3300025933 Bacteria 9027
259 Ga0207706_10055687 3300025933 Bacteria 3487
260 Ga0207686_10003225 3300025934 Bacteria 8768
261 Ga0207670_10014471 3300025936 Bacteria 4684
262 Ga0207669_10001321 3300025937 Bacteria 10554
263 Ga0207669_10045916 3300025937 Bacteria 2578
264 Ga0207704_10002679 3300025938 Bacteria 8031
265 Ga0207665_10001585 3300025939 Bacteria 15313
266 Ga0207665_10002957 3300025939 Bacteria 11387
267 Ga0207665_10004349 3300025939 Bacteria 9410
268 Ga0207665_10024693 3300025939 Bacteria 3963
269 Ga0207691_10075955 3300025940 Bacteria 3028
270 Ga0207711_10055152 3300025941 Bacteria 3412
271 Ga0207689_10036830 3300025942 Bacteria 4060
272 Ga0207689_10041548 3300025942 Bacteria 3805
273 Ga0207661_10111482 3300025944 Bacteria 2315
274 Ga0207661_10550677 3300025944 Bacteria 1057
275 Ga0207667_10142323 3300025949 Bacteria 2469
276 Ga0207651_10103645 3300025960 Bacteria 2118
277 Ga0207712_10275996 3300025961 Bacteria 1370
278 Ga0207668_10016111 3300025972 Bacteria 4658
279 Ga0207668_10029057 3300025972 Bacteria 3621
280 Ga0207668_10147315 3300025972 Bacteria 1818
281 Ga0207640_10007110 3300025981 Bacteria 6169
282 Ga0207658_10113299 3300025986 Bacteria 2148
283 Ga0207677_10025854 3300026023 Bacteria 3670
284 Ga0207677_10030618 3300026023 Bacteria 3438
285 Ga0207677_10054186 3300026023 Bacteria 2735
286 Ga0207703_10095112 3300026035 Bacteria 2513
287 Ga0207703_10142981 3300026035 Bacteria 2078
288 Ga0207639_10045451 3300026041 Bacteria 3307
289 Ga0207678_10003358 3300026067 Bacteria 14438
290 Ga0207678_10062430 3300026067 Bacteria 3202
291 Ga0207678_10393252 3300026067 Bacteria 1199
292 Ga0207708_10024554 3300026075 Bacteria 4560
293 Ga0207708_10253639 3300026075 Bacteria 1418
294 Ga0207702_10005898 3300026078 Bacteria 10652
295 Ga0207702_10031862 3300026078 Bacteria 4397
296 Ga0207702_10468076 3300026078 Bacteria 1225
297 Ga0207641_10149872 3300026088 Bacteria 2112
298 Ga0207648_10002868 3300026089 Bacteria 18243
299 Ga0207676_10285715 3300026095 Bacteria 1500
300 Ga0207674_10065361 3300026116 Bacteria 3666
301 Ga0207674_10161330 3300026116 Bacteria 2196
302 Ga0207674_10235346 3300026116 Bacteria 1779
303 Ga0207675_100078752 3300026118 Bacteria 3088
304 Ga0207675_100174264 3300026118 Bacteria 2057
305 Ga0207683_10007428 3300026121 Bacteria 9398
306 Ga0207683_10007593 3300026121 Bacteria 9287
307 Ga0207683_10008953 3300026121 Bacteria 8525
308 Ga0207698_10005519 3300026142 Bacteria 7823
309 Ga0207698_10115932 3300026142 Bacteria 2257
310 Ga0268266_10151042 3300028379 Bacteria 2093
311 Ga0268264_10030845 3300028381 Bacteria 4395
312 Ga0307515_10038820 3300028794 Bacteria 7601
313 Ga0307512_10009462 3300030522 Bacteria 9380
314 Ga0265340_10009214 3300031247 Bacteria 5304
315 Ga0307509_10328992 3300031507 Bacteria 1261
316 Ga0307508_10229282 3300031616 Bacteria 1456
317 Ga0316576_10007524 3300031727 Bacteria 6869
318 Ga0307516_10038046 3300031730 Bacteria 4804
319 Ga0326468_10001155 3300031889 Bacteria 2423
320 Ga0307407_10041417 3300031903 Bacteria 2576
321 Ga0307409_100077091 3300031995 Bacteria 2676
322 Ga0307416_100000412 3300032002 Bacteria 21856
323 Ga0373944_0014792 3300035089 Bacteria 2182
324 Ga0373949_0012116 3300035090 Bacteria 1905
325 Ga0373951_0008445 3300035091 Bacteria 2327
326 Ga0373932_0047548 3300035112 Bacteria 1262
327 Ga0373932_0073400 3300035112 Bacteria 1066
328 Ga0373936_0098911 3300035113 Bacteria 1229
329 Ga0373939_0030354 3300035114 Bacteria 1554
330 Ga0373945_0031725 3300035116 Bacteria 1868
331 Ga0373953_0040450 3300035117 Bacteria 1851
332 Ga0373956_0005869 3300035119 Bacteria 4911
333 Ga0373956_0012474 3300035119 Bacteria 3524
334 Ga0373946_0044900 3300035171 Bacteria 1826
335 Ga0373946_0160756 3300035171 Bacteria 1054
336 Ga0373955_0010260 3300035172 Bacteria 4418
337 Ga0373955_0046504 3300035172 Bacteria 2346
338 Ga0373924_0013014 3300035410 Bacteria 3119
339 Ga0373924_0074537 3300035410 Bacteria 1435
340 Ga0373931_0021812 3300035691 Bacteria 3217
341 Ga0373931_0375249 3300035691 Bacteria 895
342 Ga0373935_0121365 3300035692 Bacteria 1746
343 Ga0373935_0139718 3300035692 Bacteria 1635
344 Ga0373933_0048030 3300035724 Bacteria 2540
345 Ga0373933_0188118 3300035724 Bacteria 1318
346 Ga0373933_0285626 3300035724 Bacteria 1066
347 Ga0373937_0002840 3300036401 Bacteria 14476
348 Ga0373937_0041616 3300036401 Bacteria 4190
349 Ga0373937_0124952 3300036401 Bacteria 2399
350 Ga0373925_0030571 3300037068 Bacteria 3953
351 Ga0373925_0055717 3300037068 Bacteria 2960
352 Ga0373925_0080038 3300037068 Bacteria 2483
353 Ga0373925_0415271 3300037068 Bacteria 1099
354 Ga0395900_0344194 3300037418 Bacteria 1466
355 Ga0395898_0025489 3300037466 Bacteria 5959
356 Ga0395901_0050611 3300038443 Bacteria 4315
357 Ga0395901_0055250 3300038443 Bacteria 4129
358 Ga0395901_0140690 3300038443 Bacteria 2536
359 Ga0395901_0251219 3300038443 Bacteria 1842
360 Ga0439457_000234 3300042014 Bacteria 14914
361 Ga0450896_000211 3300042133 Bacteria 5147
362 Ga0450898_003950 3300042134 Bacteria 2164
363 Ga0450899_001537 3300042135 Bacteria 2559
364 Ga0439464_0025186 3300042439 Bacteria 1647
365 Ga0466969_0008037 3300044656 Bacteria 5603
366 Ga0466969_0043916 3300044656 Bacteria 2226
367 Ga0466972_0007332 3300044658 Bacteria 5539
368 Ga0466965_0038183 3300044683 Bacteria 2358
369 Ga0466966_0001156 3300044684 Bacteria 16964
370 Ga0466966_0151062 3300044684 Bacteria 1416
371 Ga0466963_0015911 3300044694 Bacteria 4670
372 Ga0466963_0132197 3300044694 Bacteria 1725
373 Ga0466963_0152655 3300044694 Bacteria 1604
374 Ga0466971_0001070 3300044719 Bacteria 11373
375 Ga0466971_0004300 3300044719 Bacteria 6138
376 Ga0466968_0093500 3300044735 Bacteria 1336
377 Ga0466970_0001368 3300044765 Bacteria 11751
378 Ga0466957_0000029 3300044842 Bacteria 52517
379 Ga0466957_0068672 3300044842 Bacteria 2188
380 Ga0466958_0014944 3300045836 Bacteria 4439
381 Ga0466958_0134980 3300045836 Bacteria 1551
382 Ga0466967_0024490 3300045976 Bacteria 4964
383 Ga0466967_0080059 3300045976 Bacteria 2947
384 Ga0466967_0167561 3300045976 Bacteria 2065
385 Ga0466967_0287030 3300045976 Bacteria 1580
386 Ga0466967_0437433 3300045976 Bacteria 1277
387 Ga0495592_0017437 3300046454 Bacteria 5455
388 Ga0495592_0082251 3300046454 Bacteria 2327
389 Ga0495592_0126673 3300046454 Bacteria 1791
390 Ga0495629_0000833 3300046459 Bacteria 25000
391 Ga0495641_0059213 3300046461 Bacteria 1731
392 Ga0495651_0002846 3300046462 Bacteria 13395
393 Ga0495651_0004104 3300046462 Bacteria 11144
394 Ga0495651_0048475 3300046462 Bacteria 3281
395 Ga0495653_0008849 3300046463 Bacteria 8239
396 Ga0495653_0017889 3300046463 Bacteria 5762
397 Ga0495653_0125417 3300046463 Bacteria 1824
398 Ga0495650_0002221 3300046471 Bacteria 16296
399 Ga0495582_0010310 3300046473 Bacteria 5141
400 Ga0495662_0013525 3300046476 Bacteria 3973
401 Ga0495662_0043248 3300046476 Bacteria 2174
402 Ga0495608_0002213 3300046511 Bacteria 14039
403 Ga0495618_0028444 3300046514 Bacteria 3483
404 Ga0495618_0040465 3300046514 Bacteria 2933
405 Ga0495618_0099943 3300046514 Bacteria 1856
406 Ga0495628_0053682 3300046516 Bacteria 3179
407 Ga0495628_0054758 3300046516 Bacteria 3144
408 Ga0495630_0156685 3300046517 Bacteria 1733
409 Ga0495666_0037652 3300046526 Bacteria 2353
410 Ga0495652_0000003 3300046529 Bacteria 597094
411 Ga0495652_0017137 3300046529 Bacteria 6468
412 Ga0495652_0060716 3300046529 Bacteria 3194
413 Ga0495652_0174315 3300046529 Bacteria 1657
414 Ga0495640_0008096 3300046533 Bacteria 8255
415 Ga0495640_0031765 3300046533 Bacteria 3767
416 Ga0495587_0016048 3300046536 Bacteria 4661
417 Ga0495587_0072323 3300046536 Bacteria 2004
418 Ga0495645_0025199 3300046543 Bacteria 4315
419 Ga0495645_0114908 3300046543 Bacteria 1901
420 Ga0495667_0001558 3300046559 Bacteria 15223
421 Ga0495667_0021361 3300046559 Bacteria 4368
422 Ga0495667_0028275 3300046559 Bacteria 3774
423 Ga0495634_0017505 3300046642 Bacteria 5111
424 Ga0495635_0002448 3300046663 Bacteria 12668
425 Ga0495657_0006601 3300046675 Bacteria 9062
426 Ga0495657_0015228 3300046675 Bacteria 5630
427 Ga0495599_0144204 3300046678 Bacteria 1476
428 Ga0495646_0017382 3300046680 Bacteria 4562
429 Ga0495647_0103931 3300046681 Bacteria 1179
430 Ga0495658_0047487 3300046683 Bacteria 2418
431 Ga0495613_0082259 3300046689 Bacteria 2338
432 Ga0495624_0020201 3300046690 Bacteria 4436
433 Ga0495624_0034215 3300046690 Bacteria 3288
434 Ga0495600_0011476 3300046809 Bacteria 5521
435 Ga0495581_0120133 3300047315 Bacteria 1529
436 Ga0495604_0009903 3300047317 Bacteria 7545
437 Ga0495604_0076004 3300047317 Bacteria 2527
438 Ga0495604_0117829 3300047317 Bacteria 1925
439 Ga0495674_0000027 3300047319 Bacteria 132744
440 Ga0495674_0006976 3300047319 Bacteria 10810
441 Ga0495674_0033483 3300047319 Bacteria 4653
442 Ga0495674_0038984 3300047319 Bacteria 4260
443 Ga0495676_0052369 3300047321 Bacteria 3259
444 Ga0495680_0001471 3300047322 Bacteria 25414
445 Ga0495680_0002413 3300047322 Bacteria 19130
446 Ga0495680_0008463 3300047322 Bacteria 9346
447 Ga0495680_0036487 3300047322 Bacteria 3945
448 Ga0495680_0127466 3300047322 Bacteria 1873
449 Ga0495675_0031844 3300047444 Bacteria 3367
450 Ga0495675_0164927 3300047444 Bacteria 1363
451 Ga0495684_0014821 3300047471 Bacteria 6003
452 Ga0495684_0022601 3300047471 Bacteria 4835
453 Ga0495684_0114706 3300047471 Bacteria 2031
454 Ga0495686_0080431 3300047472 Bacteria 1992
455 Ga0495593_0010695 3300047673 Bacteria 5290
456 Ga0495602_0033825 3300048088 Bacteria 4790
457 Ga0495602_0153040 3300048088 Bacteria 1810
458 Ga0495602_0300229 3300048088 Bacteria 1175
459 Ga0496100_0047636 3300048903 Bacteria 2763
460 Ga0496103_0011959 3300048906 Bacteria 5154
461 Ga0496104_0015124 3300048907 Bacteria 6985
462 Ga0496104_0021514 3300048907 Bacteria 5922
463 Ga0496104_0079745 3300048907 Bacteria 3120
464 Ga0496104_0084968 3300048907 Bacteria 3020
465 Ga0496105_0019141 3300048908 Bacteria 5519
466 Ga0496105_0020825 3300048908 Bacteria 5302
467 Ga0496105_0041668 3300048908 Bacteria 3784
468 Ga0496105_0050900 3300048908 Bacteria 3422
469 Ga0496105_0064350 3300048908 Bacteria 3026
470 Ga0496106_0197953 3300048909 Bacteria 1599
471 Ga0496107_0041415 3300048910 Bacteria 3306
472 Ga0496108_0021210 3300048911 Bacteria 5339
473 Ga0496108_0064217 3300048911 Bacteria 3092
474 Ga0496108_0071244 3300048911 Bacteria 2932
475 Ga0496108_0078208 3300048911 Bacteria 2799
476 Ga0496108_0260015 3300048911 Bacteria 1511
477 Ga0496109_0021953 3300048912 Bacteria 5652
478 Ga0496109_0222869 3300048912 Bacteria 1773
479 Ga0496110_0014956 3300048913 Bacteria 6451
480 Ga0496110_0103442 3300048913 Bacteria 2554
481 Ga0496110_0392301 3300048913 Bacteria 1265
482 Ga0496111_0027452 3300048914 Bacteria 4027
483 Ga0496111_0101828 3300048914 Bacteria 2110
484 Ga0496112_0060511 3300048915 Bacteria 3732
485 Ga0496112_0095954 3300048915 Bacteria 2936
486 Ga0496112_0141781 3300048915 Bacteria 2372
487 Ga0496112_0236749 3300048915 Bacteria 1779
488 Ga0496112_0380097 3300048915 Bacteria 1353
489 Ga0496113_0002878 3300048916 Bacteria 10133
490 Ga0496113_0087912 3300048916 Bacteria 2390
491 Ga0496113_0163825 3300048916 Bacteria 1759
492 Ga0496113_0293403 3300048916 Bacteria 1301
493 Ga0496114_0223705 3300048917 Bacteria 1652
494 Ga0496115_0005891 3300048918 Bacteria 8935
495 Ga0496115_0065751 3300048918 Bacteria 2929
496 Ga0496115_0278892 3300048918 Bacteria 1372
497 Ga0496115_0452786 3300048918 Bacteria 1036
498 Ga0496119_0000153 3300048922 Bacteria 95945
499 Ga0496120_0002595 3300048923 Bacteria 17940
500 Ga0496126_0000013 3300048929 Bacteria 690046
501 Ga0496126_0040136 3300048929 Bacteria 4340
502 Ga0501032_0080904 3300049569 Bacteria 2162
503 Ga0501034_0005678 3300049571 Bacteria 13574
504 Ga0501036_0015195 3300049572 Bacteria 6427
505 Ga0501038_0024602 3300049574 Bacteria 5370
506 Ga0501039_0065616 3300049575 Bacteria 2816
507 Ga0501042_0002796 3300049578 Bacteria 10794
508 Ga0501043_0008422 3300049579 Bacteria 8120
509 Ga0501046_0346964 3300049580 Bacteria 1078
510 Ga0501047_0230820 3300049581 Bacteria 1704
511 Ga0501083_0000073 3300049744 Bacteria 66532
512 Ga0501083_0006257 3300049744 Bacteria 8448
513 Ga0501044_0016021 3300049823 Bacteria 8063
514 nmdc:mga0qj67_286880_c1 3300050509 Bacteria 1334
515 nmdc:mga0n895_264115_c1 3300050512 Bacteria 1746
516 nmdc:mga0n895_374715_c1 3300050512 Bacteria 1441
517 nmdc:mga0rr50_204446_c1 3300050513 Bacteria 1624
518 nmdc:mga0a205_12459_c1 3300050515 Bacteria 7868
519 Ga0495601_0025141 3300053077 Bacteria 3670
520 Ga0495601_0044595 3300053077 Bacteria 2787
521 Ga0495612_0013607 3300053078 Bacteria 3277
522 Ga0495612_0033459 3300053078 Bacteria 2080
523 Ga0495595_0008547 3300053084 Bacteria 4209
524 Ga0495595_0014580 3300053084 Bacteria 3338
525 Ga0495619_0023859 3300053085 Bacteria 3921
526 Ga0495619_0043442 3300053085 Bacteria 2946
527 Ga0466962_0000570 3300061719 Bacteria 16211
528 Ga0466962_0002590 3300061719 Bacteria 8589

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0375249 Ga0373931_0375249_18_881 287
2 3300025972 Ga0207668_10147315 Ga0207668_101473152 288
3 3300006844 Ga0075428_100284936 Ga0075428_1002849362 290
4 3300045976 Ga0466967_0437433 Ga0466967_0437433_241_1209 290
5 3300037418 Ga0395900_0344194 Ga0395900_0344194_522_1397 291
6 3300037466 Ga0395898_0025489 Ga0395898_0025489_3643_4518 291
7 3300038443 Ga0395901_0050611 Ga0395901_0050611_1655_2530 291
8 3300005471 Ga0070698_100089512 Ga0070698_1000895122 293
9 3300006871 Ga0075434_100060751 Ga0075434_1000607512 293
10 3300007076 Ga0075435_100035429 Ga0075435_1000354293 293
11 3300025915 Ga0207693_10148036 Ga0207693_101480362 293
12 3300025929 Ga0207664_10326843 Ga0207664_103268432 293
13 3300005334 Ga0068869_100259676 Ga0068869_1002596762 294
14 3300005338 Ga0068868_100013706 Ga0068868_1000137061 294
15 3300005436 Ga0070713_100159271 Ga0070713_1001592711 294
16 3300005440 Ga0070705_100041053 Ga0070705_1000410531 294
17 3300005458 Ga0070681_10140115 Ga0070681_101401152 294
18 3300005535 Ga0070684_100154423 Ga0070684_1001544232 294
19 3300005545 Ga0070695_100330088 Ga0070695_1003300881 294
20 3300005577 Ga0068857_100096627 Ga0068857_1000966271 294
21 3300005615 Ga0070702_100032009 Ga0070702_1000320092 294
22 3300005841 Ga0068863_100420867 Ga0068863_1004208671 294
23 3300005843 Ga0068860_100394694 Ga0068860_1003946942 294
24 3300006163 Ga0070715_10070264 Ga0070715_100702641 294
25 3300006237 Ga0097621_100010723 Ga0097621_1000107232 294
26 3300009098 Ga0105245_10104583 Ga0105245_101045831 294
27 3300013296 Ga0157374_10015824 Ga0157374_100158246 294
28 3300013306 Ga0163162_10007047 Ga0163162_1000704710 294
29 3300014325 Ga0163163_10343198 Ga0163163_103431982 294
30 3300014968 Ga0157379_10011804 Ga0157379_100118047 294
31 3300025905 Ga0207685_10021614 Ga0207685_100216142 294
32 3300025906 Ga0207699_10231087 Ga0207699_102310871 294
33 3300025927 Ga0207687_10061644 Ga0207687_100616441 294
34 3300025928 Ga0207700_10097823 Ga0207700_100978232 294
35 3300025929 Ga0207664_10051797 Ga0207664_100517972 294
36 3300025939 Ga0207665_10024693 Ga0207665_100246935 294
37 3300025949 Ga0207667_10142323 Ga0207667_101423233 294
38 3300026023 Ga0207677_10030618 Ga0207677_100306185 294
39 3300026035 Ga0207703_10142981 Ga0207703_101429812 294
40 3300026116 Ga0207674_10065361 Ga0207674_100653612 294
41 3300035089 Ga0373944_0014792 Ga0373944_0014792_202_1170 294
42 3300035116 Ga0373945_0031725 Ga0373945_0031725_500_1468 294
43 3300035171 Ga0373946_0160756 Ga0373946_0160756_26_994 294
44 3300035410 Ga0373924_0074537 Ga0373924_0074537_281_1249 294
45 3300035691 Ga0373931_0021812 Ga0373931_0021812_1398_2366 294
46 3300035692 Ga0373935_0121365 Ga0373935_0121365_359_1327 294
47 3300035724 Ga0373933_0285626 Ga0373933_0285626_39_1007 294
48 3300046454 Ga0495592_0017437 Ga0495592_0017437_3570_4538 294
49 3300046461 Ga0495641_0059213 Ga0495641_0059213_474_1442 294
50 3300046462 Ga0495651_0004104 Ga0495651_0004104_7279_8247 294
51 3300046463 Ga0495653_0017889 Ga0495653_0017889_4390_5358 294
52 3300046476 Ga0495662_0013525 Ga0495662_0013525_547_1515 294
53 3300046514 Ga0495618_0099943 Ga0495618_0099943_487_1455 294
54 3300046536 Ga0495587_0072323 Ga0495587_0072323_227_1195 294
55 3300046543 Ga0495645_0025199 Ga0495645_0025199_2118_3086 294
56 3300046642 Ga0495634_0017505 Ga0495634_0017505_1968_2936 294
57 3300046675 Ga0495657_0015228 Ga0495657_0015228_4406_5374 294
58 3300046690 Ga0495624_0020201 Ga0495624_0020201_3099_4067 294
59 3300047315 Ga0495581_0120133 Ga0495581_0120133_513_1481 294
60 3300047317 Ga0495604_0076004 Ga0495604_0076004_768_1736 294
61 3300047319 Ga0495674_0033483 Ga0495674_0033483_2290_3258 294
62 3300047322 Ga0495680_0036487 Ga0495680_0036487_2122_3090 294
63 3300047471 Ga0495684_0022601 Ga0495684_0022601_449_1417 294
64 3300048907 Ga0496104_0021514 Ga0496104_0021514_983_1951 294
65 3300048908 Ga0496105_0019141 Ga0496105_0019141_3658_4626 294
66 3300048909 Ga0496106_0197953 Ga0496106_0197953_357_1325 294
67 3300048912 Ga0496109_0021953 Ga0496109_0021953_3294_4262 294
68 3300048913 Ga0496110_0014956 Ga0496110_0014956_1848_2816 294
69 3300048914 Ga0496111_0027452 Ga0496111_0027452_2735_3703 294
70 3300048915 Ga0496112_0095954 Ga0496112_0095954_182_1150 294
71 3300048916 Ga0496113_0293403 Ga0496113_0293403_37_1005 294
72 3300053077 Ga0495601_0025141 Ga0495601_0025141_303_1271 294
73 3300053078 Ga0495612_0033459 Ga0495612_0033459_207_1175 294
74 3300053084 Ga0495595_0014580 Ga0495595_0014580_1851_2819 294
75 3300006163 Ga0070715_10098391 Ga0070715_100983912 295
76 3300025905 Ga0207685_10060312 Ga0207685_100603122 295
77 3300030522 Ga0307512_10009462 Ga0307512_100094622 295
78 3300050512 nmdc:mga0n895_374715_c1 nmdc:mga0n895_374715_c1_34_1068 295
79 3300005355 Ga0070671_100177293 Ga0070671_1001772932 296
80 3300005434 Ga0070709_10006128 Ga0070709_100061286 296
81 3300005436 Ga0070713_100031034 Ga0070713_1000310342 296
82 3300005614 Ga0068856_100008985 Ga0068856_1000089856 296
83 3300005841 Ga0068863_100114972 Ga0068863_1001149722 296
84 3300005844 Ga0068862_100215699 Ga0068862_1002156992 296
85 3300006175 Ga0070712_100061822 Ga0070712_1000618224 296
86 3300014968 Ga0157379_10044971 Ga0157379_100449713 296
87 3300014969 Ga0157376_10013931 Ga0157376_100139313 296
88 3300025898 Ga0207692_10034515 Ga0207692_100345153 296
89 3300025906 Ga0207699_10005542 Ga0207699_100055424 296
90 3300025928 Ga0207700_10022164 Ga0207700_100221644 296
91 3300025972 Ga0207668_10029057 Ga0207668_100290574 296
92 3300026078 Ga0207702_10031862 Ga0207702_100318622 296
93 3300005614 Ga0068856_100444354 Ga0068856_1004443542 298
94 3300009174 Ga0105241_10122424 Ga0105241_101224242 298
95 3300009551 Ga0105238_10265371 Ga0105238_102653712 298
96 3300011119 Ga0105246_10266640 Ga0105246_102666402 298
97 3300013105 Ga0157369_10124106 Ga0157369_101241062 298
98 3300013297 Ga0157378_10022158 Ga0157378_100221585 298
99 3300013306 Ga0163162_10210298 Ga0163162_102102982 298
100 3300031247 Ga0265340_10009214 Ga0265340_100092146 298
101 3300035112 Ga0373932_0073400 Ga0373932_0073400_12_908 298
102 3300048903 Ga0496100_0047636 Ga0496100_0047636_214_1110 298
103 3300048906 Ga0496103_0011959 Ga0496103_0011959_3107_4003 298
104 3300048910 Ga0496107_0041415 Ga0496107_0041415_600_1496 298
105 3300048918 Ga0496115_0065751 Ga0496115_0065751_1805_2701 298
106 3300003792 Ga0055540_1000104 Ga0055540_100010416 299
107 3300025303 Ga0209051_1000231 Ga0209051_100023115 299
108 3300035113 Ga0373936_0098911 Ga0373936_0098911_221_1189 299
109 3300003320 rootH2_10015800 rootH2_100158004 300
110 3300003322 rootL2_10002683 rootL2_100026835 300
111 3300003323 rootH1_10018354 rootH1_100183543 300
112 3300003323 rootH1_10031413 rootH1_100314132 300
113 3300005615 Ga0070702_100055773 Ga0070702_1000557732 301
114 3300006173 Ga0070716_100146002 Ga0070716_1001460022 301
115 3300025961 Ga0207712_10275996 Ga0207712_102759961 301
116 3300031507 Ga0307509_10328992 Ga0307509_103289921 301
117 3300031730 Ga0307516_10038046 Ga0307516_100380464 301
118 3300048908 Ga0496105_0020825 Ga0496105_0020825_4184_5179 301
119 3300048908 Ga0496105_0064350 Ga0496105_0064350_1268_2236 301
120 3300005436 Ga0070713_100061131 Ga0070713_1000611313 304
121 3300006163 Ga0070715_10031895 Ga0070715_100318952 304
122 3300006173 Ga0070716_100007180 Ga0070716_1000071801 304
123 3300025898 Ga0207692_10007217 Ga0207692_100072173 304
124 3300025905 Ga0207685_10001274 Ga0207685_100012744 304
125 3300025906 Ga0207699_10002383 Ga0207699_100023836 304
126 3300025915 Ga0207693_10016500 Ga0207693_100165003 304
127 3300025916 Ga0207663_10139452 Ga0207663_101394522 304
128 3300025916 Ga0207663_10289197 Ga0207663_102891972 304
129 3300025929 Ga0207664_10007882 Ga0207664_100078823 304
130 3300025939 Ga0207665_10004349 Ga0207665_100043492 304
131 3300046471 Ga0495650_0002221 Ga0495650_0002221_4259_5230 304
132 3300048907 Ga0496104_0084968 Ga0496104_0084968_263_1231 304
133 3300048911 Ga0496108_0078208 Ga0496108_0078208_1425_2393 304
134 3300048915 Ga0496112_0141781 Ga0496112_0141781_1220_2188 304
135 3300048916 Ga0496113_0087912 Ga0496113_0087912_1401_2369 304
136 3300048918 Ga0496115_0452786 Ga0496115_0452786_43_1011 304
137 3300050512 nmdc:mga0n895_264115_c1 nmdc:mga0n895_264115_c1_617_1585 304
138 3300005983 Ga0081540_1071029 Ga0081540_10710292 305
139 3300049744 Ga0501083_0006257 Ga0501083_0006257_5931_6899 306
140 3300009545 Ga0105237_10154041 Ga0105237_101540412 307
141 3300038443 Ga0395901_0055250 Ga0395901_0055250_1467_2432 307
142 3300005548 Ga0070665_100048971 Ga0070665_1000489712 308
143 3300005983 Ga0081540_1000803 Ga0081540_100080317 308
144 3300025315 Ga0207697_10012888 Ga0207697_100128884 308
145 3300025986 Ga0207658_10113299 Ga0207658_101132992 308
146 3300028379 Ga0268266_10151042 Ga0268266_101510422 308
147 3300028794 Ga0307515_10038820 Ga0307515_100388202 308
148 3300002070 JGI24750J21931_1003454 JGI24750J21931_10034542 309
149 3300005331 Ga0070670_100102437 Ga0070670_1001024372 309
150 3300005618 Ga0068864_100052883 Ga0068864_1000528832 309
151 3300006186 Ga0075369_10011213 Ga0075369_100112132 309
152 3300025972 Ga0207668_10016111 Ga0207668_100161112 309
153 3300048911 Ga0496108_0071244 Ga0496108_0071244_150_1145 309
154 3300048915 Ga0496112_0060511 Ga0496112_0060511_1385_2380 309
155 3300025944 Ga0207661_10111482 Ga0207661_101114823 312
156 3300005329 Ga0070683_100289167 Ga0070683_1002891671 313
157 3300005367 Ga0070667_100124386 Ga0070667_1001243862 313
158 3300005617 Ga0068859_100246895 Ga0068859_1002468952 313
159 3300006931 Ga0097620_100246899 Ga0097620_1002468992 313
160 3300009545 Ga0105237_10206769 Ga0105237_102067691 313
161 3300013105 Ga0157369_10660013 Ga0157369_106600131 313
162 3300013308 Ga0157375_10132538 Ga0157375_101325383 313
163 3300025908 Ga0207643_10085777 Ga0207643_100857773 313
164 3300038443 Ga0395901_0251219 Ga0395901_0251219_712_1698 313
165 3300048913 Ga0496110_0392301 Ga0496110_0392301_45_1010 313
166 3300049744 Ga0501083_0000073 Ga0501083_0000073_26636_27616 313
167 iso_pu_bacteria 2582581314 2585318082 314
168 3300005842 Ga0068858_100132645 Ga0068858_1001326452 315
169 3300013105 Ga0157369_10168511 Ga0157369_101685113 315
170 3300025932 Ga0207690_10216803 Ga0207690_102168031 315
171 3300025933 Ga0207706_10055687 Ga0207706_100556873 315
172 3300025944 Ga0207661_10550677 Ga0207661_105506771 315
173 3300026035 Ga0207703_10095112 Ga0207703_100951122 315
174 3300026067 Ga0207678_10393252 Ga0207678_103932522 315
175 3300026116 Ga0207674_10235346 Ga0207674_102353463 315
176 3300026142 Ga0207698_10115932 Ga0207698_101159323 315
177 3300042439 Ga0439464_0025186 Ga0439464_0025186_103_1068 315
178 iso_pu_bacteria 2808606700 2810364153 317
179 iso_pu_bacteria 2905926851 2905929121 317
180 iso_pu_bacteria 2946003308 2946005288 317
181 iso_pu_bacteria 2870782633 2870790892 318
182 iso_pu_bacteria 3002998708 3002999657 318
183 iso_pu_bacteria 8053945823 8053946540 318
184 iso_pu_bacteria 2738543005 2739202869 319
185 iso_pu_bacteria 2928142448 2928142912 319
186 3300049578 Ga0501042_0002796 Ga0501042_0002796_6282_7262 320
187 3300005327 Ga0070658_10109080 Ga0070658_101090803 321
188 3300005328 Ga0070676_10267502 Ga0070676_102675021 321
189 3300005338 Ga0068868_100017998 Ga0068868_1000179983 321
190 3300005338 Ga0068868_100077977 Ga0068868_1000779771 321
191 3300005340 Ga0070689_100139206 Ga0070689_1001392062 321
192 3300005354 Ga0070675_100102732 Ga0070675_1001027324 321
193 3300005355 Ga0070671_100073012 Ga0070671_1000730122 321
194 3300005356 Ga0070674_100154890 Ga0070674_1001548903 321
195 3300005364 Ga0070673_100211266 Ga0070673_1002112661 321
196 3300005406 Ga0070703_10077238 Ga0070703_100772381 321
197 3300005435 Ga0070714_100000050 Ga0070714_10000005045 321
198 3300005436 Ga0070713_100146567 Ga0070713_1001465672 321
199 3300005439 Ga0070711_100182641 Ga0070711_1001826412 321
200 3300005440 Ga0070705_100244608 Ga0070705_1002446082 321
201 3300005457 Ga0070662_100011728 Ga0070662_1000117281 321
202 3300005458 Ga0070681_10396519 Ga0070681_103965192 321
203 3300005545 Ga0070695_100041282 Ga0070695_1000412821 321
204 3300005548 Ga0070665_100120095 Ga0070665_1001200954 321
205 3300005614 Ga0068856_100128643 Ga0068856_1001286432 321
206 3300005616 Ga0068852_100013804 Ga0068852_1000138042 321
207 3300005616 Ga0068852_100032489 Ga0068852_1000324892 321
208 3300005617 Ga0068859_100168620 Ga0068859_1001686203 321
209 3300005618 Ga0068864_100276038 Ga0068864_1002760381 321
210 3300005842 Ga0068858_100213216 Ga0068858_1002132161 321
211 3300005843 Ga0068860_100075350 Ga0068860_1000753502 321
212 3300005983 Ga0081540_1000735 Ga0081540_100073515 321
213 3300006028 Ga0070717_10009814 Ga0070717_100098142 321
214 3300006175 Ga0070712_100170276 Ga0070712_1001702763 321
215 3300006358 Ga0068871_100037177 Ga0068871_1000371772 321
216 3300006852 Ga0075433_10065017 Ga0075433_100650173 321
217 3300006871 Ga0075434_100160162 Ga0075434_1001601622 321
218 3300006881 Ga0068865_100072506 Ga0068865_1000725064 321
219 3300006881 Ga0068865_100115625 Ga0068865_1001156253 321
220 3300006914 Ga0075436_100006552 Ga0075436_1000065522 321
221 3300006931 Ga0097620_100168627 Ga0097620_1001686273 321
222 3300007076 Ga0075435_100202456 Ga0075435_1002024563 321
223 3300009093 Ga0105240_10094429 Ga0105240_100944296 321
224 3300009094 Ga0111539_10278811 Ga0111539_102788113 321
225 3300009098 Ga0105245_10004477 Ga0105245_100044773 321
226 3300009098 Ga0105245_10082476 Ga0105245_100824765 321
227 3300009098 Ga0105245_10238289 Ga0105245_102382893 321
228 3300009174 Ga0105241_10246984 Ga0105241_102469842 321
229 3300009551 Ga0105238_10089225 Ga0105238_100892251 321
230 3300013102 Ga0157371_10076000 Ga0157371_100760003 321
231 3300013104 Ga0157370_10014832 Ga0157370_100148321 321
232 3300013105 Ga0157369_10088068 Ga0157369_100880682 321
233 3300013296 Ga0157374_10020623 Ga0157374_100206231 321
234 3300013297 Ga0157378_10444189 Ga0157378_104441892 321
235 3300013306 Ga0163162_10026165 Ga0163162_100261659 321
236 3300013307 Ga0157372_10112948 Ga0157372_101129485 321
237 3300013307 Ga0157372_10354380 Ga0157372_103543802 321
238 3300014325 Ga0163163_10180320 Ga0163163_101803203 321
239 3300014326 Ga0157380_10283366 Ga0157380_102833661 321
240 3300014745 Ga0157377_10075189 Ga0157377_100751891 321
241 3300014968 Ga0157379_10012642 Ga0157379_100126421 321
242 3300014968 Ga0157379_10211929 Ga0157379_102119292 321
243 3300014968 Ga0157379_10290196 Ga0157379_102901962 321
244 3300020070 Ga0206356_10036690 Ga0206356_100366904 321
245 3300020082 Ga0206353_11782425 Ga0206353_117824252 321
246 3300025899 Ga0207642_10130742 Ga0207642_101307422 321
247 3300025900 Ga0207710_10090267 Ga0207710_100902671 321
248 3300025901 Ga0207688_10039963 Ga0207688_100399634 321
249 3300025901 Ga0207688_10110902 Ga0207688_101109022 321
250 3300025904 Ga0207647_10045073 Ga0207647_100450731 321
251 3300025911 Ga0207654_10102086 Ga0207654_101020862 321
252 3300025914 Ga0207671_10057096 Ga0207671_100570963 321
253 3300025915 Ga0207693_10006705 Ga0207693_100067051 321
254 3300025918 Ga0207662_10034019 Ga0207662_100340194 321
255 3300025923 Ga0207681_10190018 Ga0207681_101900182 321
256 3300025926 Ga0207659_10213692 Ga0207659_102136922 321
257 3300025927 Ga0207687_10005276 Ga0207687_100052767 321
258 3300025927 Ga0207687_10084176 Ga0207687_100841764 321
259 3300025929 Ga0207664_10000003 Ga0207664_10000003270 321
260 3300025933 Ga0207706_10009290 Ga0207706_1000929013 321
261 3300025937 Ga0207669_10045916 Ga0207669_100459165 321
262 3300025939 Ga0207665_10001585 Ga0207665_100015858 321
263 3300025940 Ga0207691_10075955 Ga0207691_100759554 321
264 3300025942 Ga0207689_10041548 Ga0207689_100415482 321
265 3300025960 Ga0207651_10103645 Ga0207651_101036453 321
266 3300026023 Ga0207677_10025854 Ga0207677_100258543 321
267 3300026067 Ga0207678_10003358 Ga0207678_1000335812 321
268 3300026078 Ga0207702_10468076 Ga0207702_104680761 321
269 3300026088 Ga0207641_10149872 Ga0207641_101498721 321
270 3300026095 Ga0207676_10285715 Ga0207676_102857151 321
271 3300026116 Ga0207674_10161330 Ga0207674_101613302 321
272 3300026118 Ga0207675_100174264 Ga0207675_1001742641 321
273 3300026121 Ga0207683_10008953 Ga0207683_100089531 321
274 3300026142 Ga0207698_10005519 Ga0207698_100055199 321
275 3300031616 Ga0307508_10229282 Ga0307508_102292822 321
276 3300031889 Ga0326468_10001155 Ga0326468_100011553 321
277 3300031903 Ga0307407_10041417 Ga0307407_100414173 321
278 3300031995 Ga0307409_100077091 Ga0307409_1000770912 321
279 3300032002 Ga0307416_100000412 Ga0307416_1000004122 321
280 3300035090 Ga0373949_0012116 Ga0373949_0012116_554_1522 321
281 3300035091 Ga0373951_0008445 Ga0373951_0008445_71_1039 321
282 3300035112 Ga0373932_0047548 Ga0373932_0047548_178_1146 321
283 3300035114 Ga0373939_0030354 Ga0373939_0030354_217_1185 321
284 3300044656 Ga0466969_0043916 Ga0466969_0043916_979_1947 321
285 3300045976 Ga0466967_0080059 Ga0466967_0080059_1666_2631 321
286 3300045976 Ga0466967_0167561 Ga0466967_0167561_522_1487 321
287 3300045976 Ga0466967_0287030 Ga0466967_0287030_177_1145 321
288 3300046529 Ga0495652_0000003 Ga0495652_0000003_568336_569301 321
289 3300047319 Ga0495674_0000027 Ga0495674_0000027_54255_55220 321
290 3300047472 Ga0495686_0080431 Ga0495686_0080431_983_1948 321
291 3300048907 Ga0496104_0015124 Ga0496104_0015124_402_1370 321
292 3300048908 Ga0496105_0050900 Ga0496105_0050900_402_1370 321
293 3300048911 Ga0496108_0064217 Ga0496108_0064217_425_1393 321
294 3300048911 Ga0496108_0260015 Ga0496108_0260015_169_1134 321
295 3300048912 Ga0496109_0222869 Ga0496109_0222869_577_1545 321
296 3300048913 Ga0496110_0103442 Ga0496110_0103442_464_1432 321
297 3300048914 Ga0496111_0101828 Ga0496111_0101828_30_995 321
298 3300048915 Ga0496112_0236749 Ga0496112_0236749_405_1373 321
299 3300048916 Ga0496113_0002878 Ga0496113_0002878_1523_2491 321
300 3300048918 Ga0496115_0278892 Ga0496115_0278892_130_1098 321
301 3300048922 Ga0496119_0000153 Ga0496119_0000153_10115_11083 321
302 3300048923 Ga0496120_0002595 Ga0496120_0002595_6867_7835 321
303 3300048929 Ga0496126_0000013 Ga0496126_0000013_542920_543888 321
304 3300048929 Ga0496126_0040136 Ga0496126_0040136_2182_3150 321
305 3300050509 nmdc:mga0qj67_286880_c1 nmdc:mga0qj67_286880_c1_280_1245 321
306 3300050515 nmdc:mga0a205_12459_c1 nmdc:mga0a205_12459_c1_6024_6992 321
307 3300005434 Ga0070709_10009034 Ga0070709_100090345 322
308 3300005435 Ga0070714_100007913 Ga0070714_1000079135 322
309 3300005436 Ga0070713_100027813 Ga0070713_1000278133 322
310 3300005436 Ga0070713_100092741 Ga0070713_1000927412 322
311 3300005437 Ga0070710_10008764 Ga0070710_100087642 322
312 3300005439 Ga0070711_100015764 Ga0070711_1000157642 322
313 3300005468 Ga0070707_100000127 Ga0070707_10000012741 322
314 3300005468 Ga0070707_100186135 Ga0070707_1001861352 322
315 3300005471 Ga0070698_100001111 Ga0070698_10000111123 322
316 3300006028 Ga0070717_10038283 Ga0070717_100382834 322
317 3300006028 Ga0070717_10044593 Ga0070717_100445932 322
318 3300006028 Ga0070717_10122878 Ga0070717_101228784 322
319 3300006173 Ga0070716_100002471 Ga0070716_1000024717 322
320 3300006175 Ga0070712_100015940 Ga0070712_1000159404 322
321 3300006175 Ga0070712_100184902 Ga0070712_1001849022 322
322 3300006914 Ga0075436_100003312 Ga0075436_1000033122 322
323 3300007076 Ga0075435_100296827 Ga0075435_1002968272 322
324 3300025898 Ga0207692_10005854 Ga0207692_100058545 322
325 3300025898 Ga0207692_10023049 Ga0207692_100230492 322
326 3300025910 Ga0207684_10018829 Ga0207684_100188294 322
327 3300025916 Ga0207663_10038546 Ga0207663_100385461 322
328 3300025922 Ga0207646_10000264 Ga0207646_1000026425 322
329 3300025922 Ga0207646_10074362 Ga0207646_100743623 322
330 3300025928 Ga0207700_10015170 Ga0207700_100151705 322
331 3300025928 Ga0207700_10102344 Ga0207700_101023442 322
332 3300025928 Ga0207700_10108680 Ga0207700_101086802 322
333 3300025928 Ga0207700_10127229 Ga0207700_101272292 322
334 3300025929 Ga0207664_10005800 Ga0207664_100058004 322
335 3300025939 Ga0207665_10002957 Ga0207665_100029574 322
336 3300031727 Ga0316576_10007524 Ga0316576_100075243 322
337 3300035117 Ga0373953_0040450 Ga0373953_0040450_260_1228 322
338 3300035119 Ga0373956_0005869 Ga0373956_0005869_120_1088 322
339 3300035119 Ga0373956_0012474 Ga0373956_0012474_2099_3067 322
340 3300035171 Ga0373946_0044900 Ga0373946_0044900_734_1702 322
341 3300035172 Ga0373955_0010260 Ga0373955_0010260_2665_3633 322
342 3300035172 Ga0373955_0046504 Ga0373955_0046504_182_1150 322
343 3300035410 Ga0373924_0013014 Ga0373924_0013014_1577_2545 322
344 3300035692 Ga0373935_0139718 Ga0373935_0139718_22_990 322
345 3300035724 Ga0373933_0048030 Ga0373933_0048030_1438_2406 322
346 3300035724 Ga0373933_0188118 Ga0373933_0188118_38_1006 322
347 3300036401 Ga0373937_0002840 Ga0373937_0002840_5629_6597 322
348 3300036401 Ga0373937_0041616 Ga0373937_0041616_994_1962 322
349 3300036401 Ga0373937_0124952 Ga0373937_0124952_1262_2230 322
350 3300037068 Ga0373925_0030571 Ga0373925_0030571_1487_2455 322
351 3300037068 Ga0373925_0055717 Ga0373925_0055717_514_1482 322
352 3300037068 Ga0373925_0080038 Ga0373925_0080038_91_1059 322
353 3300037068 Ga0373925_0415271 Ga0373925_0415271_53_1021 322
354 3300044694 Ga0466963_0132197 Ga0466963_0132197_44_1012 322
355 3300044694 Ga0466963_0152655 Ga0466963_0152655_104_1072 322
356 3300044735 Ga0466968_0093500 Ga0466968_0093500_240_1208 322
357 3300044842 Ga0466957_0068672 Ga0466957_0068672_1065_2033 322
358 3300045836 Ga0466958_0134980 Ga0466958_0134980_420_1388 322
359 3300046454 Ga0495592_0082251 Ga0495592_0082251_1100_2068 322
360 3300046454 Ga0495592_0126673 Ga0495592_0126673_636_1604 322
361 3300046459 Ga0495629_0000833 Ga0495629_0000833_5821_6789 322
362 3300046462 Ga0495651_0002846 Ga0495651_0002846_9329_10297 322
363 3300046462 Ga0495651_0048475 Ga0495651_0048475_1863_2831 322
364 3300046463 Ga0495653_0008849 Ga0495653_0008849_1022_1990 322
365 3300046463 Ga0495653_0125417 Ga0495653_0125417_655_1623 322
366 3300046473 Ga0495582_0010310 Ga0495582_0010310_2757_3725 322
367 3300046476 Ga0495662_0043248 Ga0495662_0043248_507_1475 322
368 3300046511 Ga0495608_0002213 Ga0495608_0002213_11617_12585 322
369 3300046514 Ga0495618_0028444 Ga0495618_0028444_1345_2313 322
370 3300046514 Ga0495618_0040465 Ga0495618_0040465_260_1228 322
371 3300046516 Ga0495628_0053682 Ga0495628_0053682_999_1967 322
372 3300046516 Ga0495628_0054758 Ga0495628_0054758_1209_2177 322
373 3300046517 Ga0495630_0156685 Ga0495630_0156685_31_999 322
374 3300046526 Ga0495666_0037652 Ga0495666_0037652_1165_2172 322
375 3300046529 Ga0495652_0017137 Ga0495652_0017137_3453_4421 322
376 3300046529 Ga0495652_0060716 Ga0495652_0060716_544_1512 322
377 3300046529 Ga0495652_0174315 Ga0495652_0174315_518_1486 322
378 3300046533 Ga0495640_0008096 Ga0495640_0008096_4980_5948 322
379 3300046533 Ga0495640_0031765 Ga0495640_0031765_2706_3674 322
380 3300046536 Ga0495587_0016048 Ga0495587_0016048_350_1318 322
381 3300046543 Ga0495645_0114908 Ga0495645_0114908_647_1615 322
382 3300046559 Ga0495667_0001558 Ga0495667_0001558_846_1814 322
383 3300046559 Ga0495667_0021361 Ga0495667_0021361_3274_4242 322
384 3300046559 Ga0495667_0028275 Ga0495667_0028275_2478_3446 322
385 3300046663 Ga0495635_0002448 Ga0495635_0002448_4633_5601 322
386 3300046675 Ga0495657_0006601 Ga0495657_0006601_4941_5909 322
387 3300046678 Ga0495599_0144204 Ga0495599_0144204_282_1250 322
388 3300046680 Ga0495646_0017382 Ga0495646_0017382_1668_2636 322
389 3300046681 Ga0495647_0103931 Ga0495647_0103931_191_1159 322
390 3300046683 Ga0495658_0047487 Ga0495658_0047487_778_1749 322
391 3300046689 Ga0495613_0082259 Ga0495613_0082259_910_1878 322
392 3300046690 Ga0495624_0034215 Ga0495624_0034215_1854_2822 322
393 3300046809 Ga0495600_0011476 Ga0495600_0011476_3921_4889 322
394 3300047317 Ga0495604_0009903 Ga0495604_0009903_5485_6453 322
395 3300047317 Ga0495604_0117829 Ga0495604_0117829_95_1063 322
396 3300047319 Ga0495674_0006976 Ga0495674_0006976_5585_6553 322
397 3300047319 Ga0495674_0038984 Ga0495674_0038984_3127_4095 322
398 3300047321 Ga0495676_0052369 Ga0495676_0052369_58_1026 322
399 3300047322 Ga0495680_0001471 Ga0495680_0001471_7389_8357 322
400 3300047322 Ga0495680_0002413 Ga0495680_0002413_15930_16898 322
401 3300047322 Ga0495680_0008463 Ga0495680_0008463_7755_8723 322
402 3300047322 Ga0495680_0127466 Ga0495680_0127466_227_1195 322
403 3300047444 Ga0495675_0031844 Ga0495675_0031844_1751_2719 322
404 3300047444 Ga0495675_0164927 Ga0495675_0164927_342_1310 322
405 3300047471 Ga0495684_0014821 Ga0495684_0014821_1407_2375 322
406 3300047471 Ga0495684_0114706 Ga0495684_0114706_184_1152 322
407 3300047673 Ga0495593_0010695 Ga0495593_0010695_3472_4440 322
408 3300048088 Ga0495602_0033825 Ga0495602_0033825_2195_3163 322
409 3300048088 Ga0495602_0153040 Ga0495602_0153040_734_1702 322
410 3300048088 Ga0495602_0300229 Ga0495602_0300229_158_1126 322
411 3300049569 Ga0501032_0080904 Ga0501032_0080904_718_1686 322
412 3300049571 Ga0501034_0005678 Ga0501034_0005678_8695_9663 322
413 3300049572 Ga0501036_0015195 Ga0501036_0015195_3704_4672 322
414 3300049574 Ga0501038_0024602 Ga0501038_0024602_3379_4347 322
415 3300049575 Ga0501039_0065616 Ga0501039_0065616_869_1837 322
416 3300049579 Ga0501043_0008422 Ga0501043_0008422_2694_3662 322
417 3300049580 Ga0501046_0346964 Ga0501046_0346964_21_989 322
418 3300049581 Ga0501047_0230820 Ga0501047_0230820_522_1490 322
419 3300049823 Ga0501044_0016021 Ga0501044_0016021_3918_4886 322
420 3300050513 nmdc:mga0rr50_204446_c1 nmdc:mga0rr50_204446_c1_547_1515 322
421 3300053077 Ga0495601_0044595 Ga0495601_0044595_1326_2294 322
422 3300053078 Ga0495612_0013607 Ga0495612_0013607_590_1558 322
423 3300053084 Ga0495595_0008547 Ga0495595_0008547_1870_2838 322
424 3300053085 Ga0495619_0023859 Ga0495619_0023859_1315_2283 322
425 3300053085 Ga0495619_0043442 Ga0495619_0043442_841_1809 322
426 iso_pu_bacteria 2784746763 2785338948 323
427 3300009093 Ga0105240_10056625 Ga0105240_100566254 324
428 3300010375 Ga0105239_10024363 Ga0105239_100243634 324
429 3300025913 Ga0207695_10053990 Ga0207695_100539904 324
430 3300026078 Ga0207702_10005898 Ga0207702_100058985 324
431 iso_pu_bacteria 2862382967 2862387045 325
432 iso_pu_bacteria 8008558824 8008560447 325
433 3300038443 Ga0395901_0140690 Ga0395901_0140690_139_1122 327
434 iso_pu_bacteria 2738543034 2739363483 327
435 iso_pu_bacteria 8048406513 8048408701 327
436 3300045976 Ga0466967_0024490 Ga0466967_0024490_1456_2451 328
437 3300044656 Ga0466969_0008037 Ga0466969_0008037_2779_3768 329
438 3300044684 Ga0466966_0001156 Ga0466966_0001156_5224_6213 329
439 3300044719 Ga0466971_0001070 Ga0466971_0001070_4956_5945 329
440 3300061719 Ga0466962_0002590 Ga0466962_0002590_4972_5961 329
441 iso_pu_bacteria 2547132424 2548695162 329
442 3300009098 Ga0105245_10025969 Ga0105245_100259695 330
443 3300010375 Ga0105239_10109146 Ga0105239_101091462 330
444 3300025899 Ga0207642_10015743 Ga0207642_100157432 330
445 3300025927 Ga0207687_10009296 Ga0207687_100092965 330
446 3300001989 JGI24739J22299_10021259 JGI24739J22299_100212592 331
447 3300002073 JGI24745J21846_1001714 JGI24745J21846_10017142 331
448 3300002077 JGI24744J21845_10000214 JGI24744J21845_100002141 331
449 3300002244 JGI24742J22300_10005898 JGI24742J22300_100058982 331
450 3300005330 Ga0070690_100051518 Ga0070690_1000515182 331
451 3300005340 Ga0070689_100076306 Ga0070689_1000763061 331
452 3300005347 Ga0070668_100288935 Ga0070668_1002889351 331
453 3300005356 Ga0070674_100054217 Ga0070674_1000542172 331
454 3300005366 Ga0070659_100290470 Ga0070659_1002904701 331
455 3300005434 Ga0070709_10002658 Ga0070709_1000265810 331
456 3300005439 Ga0070711_100157550 Ga0070711_1001575502 331
457 3300005441 Ga0070700_100010564 Ga0070700_1000105642 331
458 3300005445 Ga0070708_100380935 Ga0070708_1003809352 331
459 3300005455 Ga0070663_100131412 Ga0070663_1001314122 331
460 3300005456 Ga0070678_100007402 Ga0070678_1000074021 331
461 3300005459 Ga0068867_100028304 Ga0068867_1000283044 331
462 3300005543 Ga0070672_100125728 Ga0070672_1001257282 331
463 3300005546 Ga0070696_100203662 Ga0070696_1002036622 331
464 3300005549 Ga0070704_100013524 Ga0070704_1000135246 331
465 3300005615 Ga0070702_100014720 Ga0070702_1000147202 331
466 3300005842 Ga0068858_100278544 Ga0068858_1002785442 331
467 3300005844 Ga0068862_100367355 Ga0068862_1003673551 331
468 3300006163 Ga0070715_10031756 Ga0070715_100317562 331
469 3300006186 Ga0075369_10004313 Ga0075369_100043134 331
470 3300006237 Ga0097621_100013389 Ga0097621_1000133893 331
471 3300006358 Ga0068871_100159858 Ga0068871_1001598582 331
472 3300006881 Ga0068865_100004759 Ga0068865_10000475910 331
473 3300009098 Ga0105245_10105220 Ga0105245_101052202 331
474 3300009101 Ga0105247_10056817 Ga0105247_100568172 331
475 3300009148 Ga0105243_10095716 Ga0105243_100957162 331
476 3300009177 Ga0105248_10265765 Ga0105248_102657652 331
477 3300009545 Ga0105237_10315820 Ga0105237_103158202 331
478 3300009545 Ga0105237_10422804 Ga0105237_104228042 331
479 3300009553 Ga0105249_10146861 Ga0105249_101468612 331
480 3300010375 Ga0105239_10038218 Ga0105239_100382182 331
481 3300013105 Ga0157369_10350668 Ga0157369_103506682 331
482 3300013297 Ga0157378_10361859 Ga0157378_103618592 331
483 3300013307 Ga0157372_10025001 Ga0157372_100250013 331
484 3300013308 Ga0157375_10080366 Ga0157375_100803664 331
485 3300014325 Ga0163163_10299067 Ga0163163_102990672 331
486 3300014968 Ga0157379_10104922 Ga0157379_101049222 331
487 3300017792 Ga0163161_10027335 Ga0163161_100273354 331
488 3300025885 Ga0207653_10021709 Ga0207653_100217092 331
489 3300025898 Ga0207692_10087651 Ga0207692_100876512 331
490 3300025900 Ga0207710_10018144 Ga0207710_100181442 331
491 3300025901 Ga0207688_10054315 Ga0207688_100543152 331
492 3300025901 Ga0207688_10059170 Ga0207688_100591702 331
493 3300025903 Ga0207680_10057681 Ga0207680_100576812 331
494 3300025907 Ga0207645_10006008 Ga0207645_100060088 331
495 3300025911 Ga0207654_10024231 Ga0207654_100242314 331
496 3300025914 Ga0207671_10014463 Ga0207671_100144635 331
497 3300025915 Ga0207693_10005274 Ga0207693_100052742 331
498 3300025916 Ga0207663_10037153 Ga0207663_100371533 331
499 3300025916 Ga0207663_10158364 Ga0207663_101583641 331
500 3300025918 Ga0207662_10022858 Ga0207662_100228583 331
501 3300025919 Ga0207657_10040850 Ga0207657_100408503 331
502 3300025922 Ga0207646_10030324 Ga0207646_100303242 331
503 3300025924 Ga0207694_10303173 Ga0207694_103031732 331
504 3300025926 Ga0207659_10158253 Ga0207659_101582532 331
505 3300025927 Ga0207687_10002019 Ga0207687_1000201911 331
506 3300025932 Ga0207690_10033566 Ga0207690_100335662 331
507 3300025934 Ga0207686_10003225 Ga0207686_100032252 331
508 3300025936 Ga0207670_10014471 Ga0207670_100144713 331
509 3300025937 Ga0207669_10001321 Ga0207669_100013216 331
510 3300025938 Ga0207704_10002679 Ga0207704_100026793 331
511 3300025941 Ga0207711_10055152 Ga0207711_100551524 331
512 3300025942 Ga0207689_10036830 Ga0207689_100368302 331
513 3300025981 Ga0207640_10007110 Ga0207640_100071105 331
514 3300026023 Ga0207677_10054186 Ga0207677_100541862 331
515 3300026041 Ga0207639_10045451 Ga0207639_100454514 331
516 3300026067 Ga0207678_10062430 Ga0207678_100624302 331
517 3300026075 Ga0207708_10024554 Ga0207708_100245542 331
518 3300026075 Ga0207708_10253639 Ga0207708_102536392 331
519 3300026089 Ga0207648_10002868 Ga0207648_1000286816 331
520 3300026118 Ga0207675_100078752 Ga0207675_1000787524 331
521 3300026121 Ga0207683_10007428 Ga0207683_100074282 331
522 3300026121 Ga0207683_10007593 Ga0207683_1000759311 331
523 3300028381 Ga0268264_10030845 Ga0268264_100308452 331
524 3300042014 Ga0439457_000234 Ga0439457_000234_6732_7733 331
525 3300042133 Ga0450896_000211 Ga0450896_000211_3501_4502 331
526 3300042134 Ga0450898_003950 Ga0450898_003950_121_1122 331
527 3300042135 Ga0450899_001537 Ga0450899_001537_1423_2424 331
528 3300044658 Ga0466972_0007332 Ga0466972_0007332_4116_5111 331
529 3300044683 Ga0466965_0038183 Ga0466965_0038183_1214_2209 331
530 3300044684 Ga0466966_0151062 Ga0466966_0151062_398_1393 331
531 3300044694 Ga0466963_0015911 Ga0466963_0015911_1737_2732 331
532 3300044719 Ga0466971_0004300 Ga0466971_0004300_2169_3164 331
533 3300044765 Ga0466970_0001368 Ga0466970_0001368_1737_2732 331
534 3300044842 Ga0466957_0000029 Ga0466957_0000029_11952_12947 331
535 3300045836 Ga0466958_0014944 Ga0466958_0014944_105_1100 331
536 3300048907 Ga0496104_0079745 Ga0496104_0079745_1680_2675 331
537 3300048908 Ga0496105_0041668 Ga0496105_0041668_2763_3758 331
538 3300048911 Ga0496108_0021210 Ga0496108_0021210_2189_3184 331
539 3300048915 Ga0496112_0380097 Ga0496112_0380097_192_1187 331
540 3300048916 Ga0496113_0163825 Ga0496113_0163825_222_1217 331
541 3300048917 Ga0496114_0223705 Ga0496114_0223705_151_1146 331
542 3300048918 Ga0496115_0005891 Ga0496115_0005891_2191_3186 331
543 3300061719 Ga0466962_0000570 Ga0466962_0000570_11745_12740 331
544 iso_pu_bacteria 2773857922 2774852447 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

204

322

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

65

163

0.81

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

238

356

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y0k-assembly1.cif.gz_A structure of crotonyl-coa carboxylase/reductase ante in complex with nadp 0.9134 2 321
6n7l-assembly3.cif.gz_K crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 0.9134 2 324
4y1b-assembly1.cif.gz_A structure of crotonyl-coa carboxylase/reductase ante v350a in complex with nadp 0.9127 2 321
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9094 1 321
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9086 2 321
ID Description Score Start End Superfamily
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 145 268 3.40.50.720
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9286 148 265 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 137 269 3.40.50.720
4rvuB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9228 141 268 3.40.50.720
3krtB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.92 152 269 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L6BV53-F1-model_v4 Zinc-binding dehydrogenase 0.9918 1 321 GO:0016491
AF-A0A6L6BV53-F1-model_v4 Zinc-binding dehydrogenase 0.9857 1 321 GO:0016491
AF-A0A4R4T618-F1-model_v4 Zn-dependent oxidoreductase 0.9823 158 324
AF-A0A4R4T618-F1-model_v4 Zn-dependent oxidoreductase 0.9765 158 324
AF-A0A4R5L2Q3-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9692 170 320

Feature Viewer

pLDDT pTM Quality
94.09 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map