F461731
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 544 | 297 | 528 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10350668|Ga0157369_103506682 |
| Length | 367 |
| Sequence | MSCHIENCTRPVNLYSAFRTAAHQLGFQGGRRDGGDVLAATAVSQSAADPLSGLVLSEMAQPRPKPGWAVVQVVSSSLNMHDLWTLRGVGHPAEQLPIVLGCDAAGYDEDGNAVIVYPVIGDYDAGRGDETLDPNRALLSERHDGAFAEYLTVPRRNLVPKPDWLSFDEAACLPVAWTTAYRMLFTQANIRAGDRVLVQGAGGGVTSAAIKLAVAAGAVVYATSRSESKRAQAMSWGARVALPPGERLPERVDLVIETVGEATWSHSLKALRPGGTVVIAGATTGMNPPADLGRIFYLQQRILGSTGSTRAELVAMLRMLEATGVRPVIDRTLSLSEIHKGFQLMIDGSLTGKVVVHPAAPDDQGMS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 3 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 4 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 5 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 6 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 7 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 8 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 9 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 10 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 11 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 12 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 13 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 205 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 206 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 207 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 273 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 296 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 297 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.69 |
| Metatranscriptomes | 0.37 |
| Isolates | 2.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.74 |
| Nodule | 0.55 |
| Rhizoplane | 7.17 |
| Rhizosphere | 87.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10021259 | 3300001989 | Bacteria | 2311 |
| 2 | JGI24750J21931_1003454 | 3300002070 | Bacteria | 1891 |
| 3 | JGI24745J21846_1001714 | 3300002073 | Bacteria | 2158 |
| 4 | JGI24744J21845_10000214 | 3300002077 | Bacteria | 9078 |
| 5 | JGI24742J22300_10005898 | 3300002244 | Bacteria | 2017 |
| 6 | rootH2_10015800 | 3300003320 | Bacteria | 13608 |
| 7 | rootL2_10002683 | 3300003322 | Bacteria | 7243 |
| 8 | rootH1_10018354 | 3300003323 | Bacteria | 16678 |
| 9 | rootH1_10031413 | 3300003323 | Bacteria | 4429 |
| 10 | Ga0055540_1000104 | 3300003792 | Bacteria | 93795 |
| 11 | Ga0070658_10109080 | 3300005327 | Bacteria | 2291 |
| 12 | Ga0070676_10267502 | 3300005328 | Bacteria | 1147 |
| 13 | Ga0070683_100289167 | 3300005329 | Bacteria | 1559 |
| 14 | Ga0070690_100051518 | 3300005330 | Bacteria | 2628 |
| 15 | Ga0070670_100102437 | 3300005331 | Bacteria | 2465 |
| 16 | Ga0068869_100259676 | 3300005334 | Bacteria | 1390 |
| 17 | Ga0068868_100013706 | 3300005338 | Bacteria | 5955 |
| 18 | Ga0068868_100017998 | 3300005338 | Bacteria | 5273 |
| 19 | Ga0068868_100077977 | 3300005338 | Bacteria | 2651 |
| 20 | Ga0070689_100076306 | 3300005340 | Bacteria | 2625 |
| 21 | Ga0070689_100139206 | 3300005340 | Bacteria | 1951 |
| 22 | Ga0070668_100288935 | 3300005347 | Bacteria | 1372 |
| 23 | Ga0070675_100102732 | 3300005354 | Bacteria | 2409 |
| 24 | Ga0070671_100073012 | 3300005355 | Bacteria | 2866 |
| 25 | Ga0070671_100177293 | 3300005355 | Bacteria | 1804 |
| 26 | Ga0070674_100054217 | 3300005356 | Bacteria | 2772 |
| 27 | Ga0070674_100154890 | 3300005356 | Bacteria | 1733 |
| 28 | Ga0070673_100211266 | 3300005364 | Bacteria | 1676 |
| 29 | Ga0070659_100290470 | 3300005366 | Bacteria | 1362 |
| 30 | Ga0070667_100124386 | 3300005367 | Bacteria | 2246 |
| 31 | Ga0070703_10077238 | 3300005406 | Bacteria | 1126 |
| 32 | Ga0070709_10002658 | 3300005434 | Bacteria | 9653 |
| 33 | Ga0070709_10006128 | 3300005434 | Bacteria | 6543 |
| 34 | Ga0070709_10009034 | 3300005434 | Bacteria | 5489 |
| 35 | Ga0070714_100000050 | 3300005435 | Bacteria | 110823 |
| 36 | Ga0070714_100007913 | 3300005435 | Bacteria | 8278 |
| 37 | Ga0070713_100027813 | 3300005436 | Bacteria | 4458 |
| 38 | Ga0070713_100031034 | 3300005436 | Bacteria | 4251 |
| 39 | Ga0070713_100061131 | 3300005436 | Bacteria | 3151 |
| 40 | Ga0070713_100092741 | 3300005436 | Bacteria | 2601 |
| 41 | Ga0070713_100146567 | 3300005436 | Bacteria | 2096 |
| 42 | Ga0070713_100159271 | 3300005436 | Bacteria | 2014 |
| 43 | Ga0070710_10008764 | 3300005437 | Bacteria | 4933 |
| 44 | Ga0070711_100015764 | 3300005439 | Bacteria | 4786 |
| 45 | Ga0070711_100157550 | 3300005439 | Bacteria | 1718 |
| 46 | Ga0070711_100182641 | 3300005439 | Bacteria | 1606 |
| 47 | Ga0070705_100041053 | 3300005440 | Bacteria | 2635 |
| 48 | Ga0070705_100244608 | 3300005440 | Bacteria | 1256 |
| 49 | Ga0070700_100010564 | 3300005441 | Bacteria | 5100 |
| 50 | Ga0070708_100380935 | 3300005445 | Bacteria | 1330 |
| 51 | Ga0070663_100131412 | 3300005455 | Bacteria | 1901 |
| 52 | Ga0070678_100007402 | 3300005456 | Bacteria | 6508 |
| 53 | Ga0070662_100011728 | 3300005457 | Bacteria | 5787 |
| 54 | Ga0070681_10140115 | 3300005458 | Bacteria | 2349 |
| 55 | Ga0070681_10396519 | 3300005458 | Bacteria | 1291 |
| 56 | Ga0068867_100028304 | 3300005459 | Bacteria | 4035 |
| 57 | Ga0070707_100000127 | 3300005468 | Bacteria | 71273 |
| 58 | Ga0070707_100186135 | 3300005468 | Bacteria | 2025 |
| 59 | Ga0070698_100001111 | 3300005471 | Bacteria | 29683 |
| 60 | Ga0070698_100089512 | 3300005471 | Bacteria | 3061 |
| 61 | Ga0070684_100154423 | 3300005535 | Bacteria | 2081 |
| 62 | Ga0070672_100125728 | 3300005543 | Bacteria | 2103 |
| 63 | Ga0070695_100041282 | 3300005545 | Bacteria | 2923 |
| 64 | Ga0070695_100330088 | 3300005545 | Bacteria | 1137 |
| 65 | Ga0070696_100203662 | 3300005546 | Bacteria | 1478 |
| 66 | Ga0070665_100048971 | 3300005548 | Bacteria | 4241 |
| 67 | Ga0070665_100120095 | 3300005548 | Bacteria | 2630 |
| 68 | Ga0070704_100013524 | 3300005549 | Bacteria | 5066 |
| 69 | Ga0068857_100096627 | 3300005577 | Bacteria | 2647 |
| 70 | Ga0068856_100008985 | 3300005614 | Bacteria | 9722 |
| 71 | Ga0068856_100128643 | 3300005614 | Bacteria | 2536 |
| 72 | Ga0068856_100444354 | 3300005614 | Bacteria | 1317 |
| 73 | Ga0070702_100014720 | 3300005615 | Bacteria | 3975 |
| 74 | Ga0070702_100032009 | 3300005615 | Bacteria | 2883 |
| 75 | Ga0070702_100055773 | 3300005615 | Bacteria | 2279 |
| 76 | Ga0068852_100013804 | 3300005616 | Bacteria | 6194 |
| 77 | Ga0068852_100032489 | 3300005616 | Bacteria | 4322 |
| 78 | Ga0068859_100168620 | 3300005617 | Bacteria | 2270 |
| 79 | Ga0068859_100246895 | 3300005617 | Bacteria | 1875 |
| 80 | Ga0068864_100052883 | 3300005618 | Bacteria | 3501 |
| 81 | Ga0068864_100276038 | 3300005618 | Bacteria | 1567 |
| 82 | Ga0068863_100114972 | 3300005841 | Bacteria | 2564 |
| 83 | Ga0068863_100420867 | 3300005841 | Bacteria | 1309 |
| 84 | Ga0068858_100132645 | 3300005842 | Bacteria | 2336 |
| 85 | Ga0068858_100213216 | 3300005842 | Bacteria | 1827 |
| 86 | Ga0068858_100278544 | 3300005842 | Bacteria | 1592 |
| 87 | Ga0068860_100075350 | 3300005843 | Bacteria | 3209 |
| 88 | Ga0068860_100394694 | 3300005843 | Bacteria | 1368 |
| 89 | Ga0068862_100215699 | 3300005844 | Bacteria | 1736 |
| 90 | Ga0068862_100367355 | 3300005844 | Bacteria | 1338 |
| 91 | Ga0081540_1000735 | 3300005983 | Bacteria | 30170 |
| 92 | Ga0081540_1000803 | 3300005983 | Bacteria | 28862 |
| 93 | Ga0081540_1071029 | 3300005983 | Bacteria | 1610 |
| 94 | Ga0070717_10009814 | 3300006028 | Bacteria | 7208 |
| 95 | Ga0070717_10038283 | 3300006028 | Bacteria | 3898 |
| 96 | Ga0070717_10044593 | 3300006028 | Bacteria | 3622 |
| 97 | Ga0070717_10122878 | 3300006028 | Bacteria | 2226 |
| 98 | Ga0070715_10031756 | 3300006163 | Bacteria | 2146 |
| 99 | Ga0070715_10031895 | 3300006163 | Bacteria | 2142 |
| 100 | Ga0070715_10070264 | 3300006163 | Bacteria | 1562 |
| 101 | Ga0070715_10098391 | 3300006163 | Bacteria | 1360 |
| 102 | Ga0070716_100002471 | 3300006173 | Bacteria | 8534 |
| 103 | Ga0070716_100007180 | 3300006173 | Bacteria | 5477 |
| 104 | Ga0070716_100146002 | 3300006173 | Bacteria | 1515 |
| 105 | Ga0070712_100015940 | 3300006175 | Bacteria | 4847 |
| 106 | Ga0070712_100061822 | 3300006175 | Bacteria | 2647 |
| 107 | Ga0070712_100170276 | 3300006175 | Bacteria | 1689 |
| 108 | Ga0070712_100184902 | 3300006175 | Bacteria | 1626 |
| 109 | Ga0075369_10004313 | 3300006186 | Bacteria | 5243 |
| 110 | Ga0075369_10011213 | 3300006186 | Bacteria | 3521 |
| 111 | Ga0097621_100010723 | 3300006237 | Bacteria | 6720 |
| 112 | Ga0097621_100013389 | 3300006237 | Bacteria | 6115 |
| 113 | Ga0068871_100037177 | 3300006358 | Bacteria | 3882 |
| 114 | Ga0068871_100159858 | 3300006358 | Bacteria | 1926 |
| 115 | Ga0075428_100284936 | 3300006844 | Bacteria | 1777 |
| 116 | Ga0075433_10065017 | 3300006852 | Bacteria | 3199 |
| 117 | Ga0075434_100060751 | 3300006871 | Bacteria | 3759 |
| 118 | Ga0075434_100160162 | 3300006871 | Bacteria | 2270 |
| 119 | Ga0068865_100004759 | 3300006881 | Bacteria | 8206 |
| 120 | Ga0068865_100072506 | 3300006881 | Bacteria | 2447 |
| 121 | Ga0068865_100115625 | 3300006881 | Bacteria | 1986 |
| 122 | Ga0075436_100003312 | 3300006914 | Bacteria | 11020 |
| 123 | Ga0075436_100006552 | 3300006914 | Bacteria | 7970 |
| 124 | Ga0097620_100168627 | 3300006931 | Bacteria | 2270 |
| 125 | Ga0097620_100246899 | 3300006931 | Bacteria | 1875 |
| 126 | Ga0075435_100035429 | 3300007076 | Bacteria | 3961 |
| 127 | Ga0075435_100202456 | 3300007076 | Bacteria | 1682 |
| 128 | Ga0075435_100296827 | 3300007076 | Bacteria | 1382 |
| 129 | Ga0105240_10056625 | 3300009093 | Bacteria | 4905 |
| 130 | Ga0105240_10094429 | 3300009093 | Bacteria | 3648 |
| 131 | Ga0111539_10278811 | 3300009094 | Bacteria | 1945 |
| 132 | Ga0105245_10004477 | 3300009098 | Bacteria | 12349 |
| 133 | Ga0105245_10025969 | 3300009098 | Bacteria | 5153 |
| 134 | Ga0105245_10082476 | 3300009098 | Bacteria | 2941 |
| 135 | Ga0105245_10104583 | 3300009098 | Bacteria | 2625 |
| 136 | Ga0105245_10105220 | 3300009098 | Bacteria | 2617 |
| 137 | Ga0105245_10238289 | 3300009098 | Bacteria | 1762 |
| 138 | Ga0105247_10056817 | 3300009101 | Bacteria | 2418 |
| 139 | Ga0105243_10095716 | 3300009148 | Bacteria | 2454 |
| 140 | Ga0105241_10122424 | 3300009174 | Bacteria | 2097 |
| 141 | Ga0105241_10246984 | 3300009174 | Bacteria | 1511 |
| 142 | Ga0105248_10265765 | 3300009177 | Bacteria | 1931 |
| 143 | Ga0105237_10154041 | 3300009545 | Bacteria | 2295 |
| 144 | Ga0105237_10206769 | 3300009545 | Bacteria | 1963 |
| 145 | Ga0105237_10315820 | 3300009545 | Bacteria | 1566 |
| 146 | Ga0105237_10422804 | 3300009545 | Bacteria | 1338 |
| 147 | Ga0105238_10089225 | 3300009551 | Bacteria | 3070 |
| 148 | Ga0105238_10265371 | 3300009551 | Bacteria | 1697 |
| 149 | Ga0105249_10146861 | 3300009553 | Bacteria | 2266 |
| 150 | Ga0105239_10024363 | 3300010375 | Bacteria | 6667 |
| 151 | Ga0105239_10038218 | 3300010375 | Bacteria | 5260 |
| 152 | Ga0105239_10109146 | 3300010375 | Bacteria | 3066 |
| 153 | Ga0105246_10266640 | 3300011119 | Bacteria | 1367 |
| 154 | Ga0157371_10076000 | 3300013102 | Bacteria | 2379 |
| 155 | Ga0157370_10014832 | 3300013104 | Bacteria | 7951 |
| 156 | Ga0157369_10088068 | 3300013105 | Bacteria | 3314 |
| 157 | Ga0157369_10124106 | 3300013105 | Bacteria | 2739 |
| 158 | Ga0157369_10168511 | 3300013105 | Bacteria | 2309 |
| 159 | Ga0157369_10350668 | 3300013105 | Bacteria | 1533 |
| 160 | Ga0157369_10660013 | 3300013105 | Bacteria | 1078 |
| 161 | Ga0157374_10015824 | 3300013296 | Bacteria | 6627 |
| 162 | Ga0157374_10020623 | 3300013296 | Bacteria | 5852 |
| 163 | Ga0157378_10022158 | 3300013297 | Bacteria | 5590 |
| 164 | Ga0157378_10361859 | 3300013297 | Bacteria | 1420 |
| 165 | Ga0157378_10444189 | 3300013297 | Bacteria | 1286 |
| 166 | Ga0163162_10007047 | 3300013306 | Bacteria | 10898 |
| 167 | Ga0163162_10026165 | 3300013306 | Bacteria | 5766 |
| 168 | Ga0163162_10210298 | 3300013306 | Bacteria | 2075 |
| 169 | Ga0157372_10025001 | 3300013307 | Bacteria | 6490 |
| 170 | Ga0157372_10112948 | 3300013307 | Bacteria | 3113 |
| 171 | Ga0157372_10354380 | 3300013307 | Bacteria | 1710 |
| 172 | Ga0157375_10080366 | 3300013308 | Bacteria | 3298 |
| 173 | Ga0157375_10132538 | 3300013308 | Bacteria | 2613 |
| 174 | Ga0163163_10180320 | 3300014325 | Bacteria | 2159 |
| 175 | Ga0163163_10299067 | 3300014325 | Bacteria | 1662 |
| 176 | Ga0163163_10343198 | 3300014325 | Bacteria | 1549 |
| 177 | Ga0157380_10283366 | 3300014326 | Bacteria | 1518 |
| 178 | Ga0157377_10075189 | 3300014745 | Bacteria | 1961 |
| 179 | Ga0157379_10011804 | 3300014968 | Bacteria | 7631 |
| 180 | Ga0157379_10012642 | 3300014968 | Bacteria | 7376 |
| 181 | Ga0157379_10044971 | 3300014968 | Bacteria | 3941 |
| 182 | Ga0157379_10104922 | 3300014968 | Bacteria | 2536 |
| 183 | Ga0157379_10211929 | 3300014968 | Bacteria | 1754 |
| 184 | Ga0157379_10290196 | 3300014968 | Bacteria | 1490 |
| 185 | Ga0157376_10013931 | 3300014969 | Bacteria | 6013 |
| 186 | Ga0163161_10027335 | 3300017792 | Bacteria | 4046 |
| 187 | Ga0206356_10036690 | 3300020070 | Bacteria | 2437 |
| 188 | Ga0206353_11782425 | 3300020082 | Bacteria | 1829 |
| 189 | Ga0209051_1000231 | 3300025303 | Bacteria | 93859 |
| 190 | Ga0207697_10012888 | 3300025315 | Bacteria | 3496 |
| 191 | Ga0207653_10021709 | 3300025885 | Bacteria | 2036 |
| 192 | Ga0207692_10005854 | 3300025898 | Bacteria | 4954 |
| 193 | Ga0207692_10007217 | 3300025898 | Bacteria | 4542 |
| 194 | Ga0207692_10023049 | 3300025898 | Bacteria | 2875 |
| 195 | Ga0207692_10034515 | 3300025898 | Bacteria | 2450 |
| 196 | Ga0207692_10087651 | 3300025898 | Bacteria | 1680 |
| 197 | Ga0207642_10015743 | 3300025899 | Bacteria | 2828 |
| 198 | Ga0207642_10130742 | 3300025899 | Bacteria | 1310 |
| 199 | Ga0207710_10018144 | 3300025900 | Bacteria | 2991 |
| 200 | Ga0207710_10090267 | 3300025900 | Bacteria | 1433 |
| 201 | Ga0207688_10039963 | 3300025901 | Bacteria | 2606 |
| 202 | Ga0207688_10054315 | 3300025901 | Bacteria | 2247 |
| 203 | Ga0207688_10059170 | 3300025901 | Bacteria | 2157 |
| 204 | Ga0207688_10110902 | 3300025901 | Bacteria | 1592 |
| 205 | Ga0207680_10057681 | 3300025903 | Bacteria | 2350 |
| 206 | Ga0207647_10045073 | 3300025904 | Bacteria | 2753 |
| 207 | Ga0207685_10001274 | 3300025905 | Bacteria | 5157 |
| 208 | Ga0207685_10021614 | 3300025905 | Bacteria | 2159 |
| 209 | Ga0207685_10060312 | 3300025905 | Bacteria | 1499 |
| 210 | Ga0207699_10002383 | 3300025906 | Bacteria | 8868 |
| 211 | Ga0207699_10005542 | 3300025906 | Bacteria | 6055 |
| 212 | Ga0207699_10231087 | 3300025906 | Bacteria | 1267 |
| 213 | Ga0207645_10006008 | 3300025907 | Bacteria | 8732 |
| 214 | Ga0207643_10085777 | 3300025908 | Bacteria | 1829 |
| 215 | Ga0207684_10018829 | 3300025910 | Bacteria | 5906 |
| 216 | Ga0207654_10024231 | 3300025911 | Bacteria | 3260 |
| 217 | Ga0207654_10102086 | 3300025911 | Bacteria | 1769 |
| 218 | Ga0207695_10053990 | 3300025913 | Bacteria | 4199 |
| 219 | Ga0207671_10014463 | 3300025914 | Bacteria | 6234 |
| 220 | Ga0207671_10057096 | 3300025914 | Bacteria | 2893 |
| 221 | Ga0207693_10005274 | 3300025915 | Bacteria | 10809 |
| 222 | Ga0207693_10006705 | 3300025915 | Bacteria | 9508 |
| 223 | Ga0207693_10016500 | 3300025915 | Bacteria | 5901 |
| 224 | Ga0207693_10148036 | 3300025915 | Bacteria | 1846 |
| 225 | Ga0207663_10037153 | 3300025916 | Bacteria | 2934 |
| 226 | Ga0207663_10038546 | 3300025916 | Bacteria | 2890 |
| 227 | Ga0207663_10139452 | 3300025916 | Bacteria | 1687 |
| 228 | Ga0207663_10158364 | 3300025916 | Bacteria | 1596 |
| 229 | Ga0207663_10289197 | 3300025916 | Bacteria | 1220 |
| 230 | Ga0207662_10022858 | 3300025918 | Bacteria | 3589 |
| 231 | Ga0207662_10034019 | 3300025918 | Bacteria | 2974 |
| 232 | Ga0207657_10040850 | 3300025919 | Bacteria | 4106 |
| 233 | Ga0207646_10000264 | 3300025922 | Bacteria | 71299 |
| 234 | Ga0207646_10030324 | 3300025922 | Bacteria | 4904 |
| 235 | Ga0207646_10074362 | 3300025922 | Bacteria | 3035 |
| 236 | Ga0207681_10190018 | 3300025923 | Bacteria | 1571 |
| 237 | Ga0207694_10303173 | 3300025924 | Bacteria | 1316 |
| 238 | Ga0207659_10158253 | 3300025926 | Bacteria | 1775 |
| 239 | Ga0207659_10213692 | 3300025926 | Bacteria | 1547 |
| 240 | Ga0207687_10002019 | 3300025927 | Bacteria | 13915 |
| 241 | Ga0207687_10005276 | 3300025927 | Bacteria | 8568 |
| 242 | Ga0207687_10009296 | 3300025927 | Bacteria | 6429 |
| 243 | Ga0207687_10061644 | 3300025927 | Bacteria | 2649 |
| 244 | Ga0207687_10084176 | 3300025927 | Bacteria | 2305 |
| 245 | Ga0207700_10015170 | 3300025928 | Bacteria | 5070 |
| 246 | Ga0207700_10022164 | 3300025928 | Bacteria | 4352 |
| 247 | Ga0207700_10097823 | 3300025928 | Bacteria | 2333 |
| 248 | Ga0207700_10102344 | 3300025928 | Bacteria | 2287 |
| 249 | Ga0207700_10108680 | 3300025928 | Bacteria | 2227 |
| 250 | Ga0207700_10127229 | 3300025928 | Bacteria | 2074 |
| 251 | Ga0207664_10000003 | 3300025929 | Bacteria | 510966 |
| 252 | Ga0207664_10005800 | 3300025929 | Bacteria | 8444 |
| 253 | Ga0207664_10007882 | 3300025929 | Bacteria | 7399 |
| 254 | Ga0207664_10051797 | 3300025929 | Bacteria | 3243 |
| 255 | Ga0207664_10326843 | 3300025929 | Bacteria | 1354 |
| 256 | Ga0207690_10033566 | 3300025932 | Bacteria | 3300 |
| 257 | Ga0207690_10216803 | 3300025932 | Bacteria | 1462 |
| 258 | Ga0207706_10009290 | 3300025933 | Bacteria | 9027 |
| 259 | Ga0207706_10055687 | 3300025933 | Bacteria | 3487 |
| 260 | Ga0207686_10003225 | 3300025934 | Bacteria | 8768 |
| 261 | Ga0207670_10014471 | 3300025936 | Bacteria | 4684 |
| 262 | Ga0207669_10001321 | 3300025937 | Bacteria | 10554 |
| 263 | Ga0207669_10045916 | 3300025937 | Bacteria | 2578 |
| 264 | Ga0207704_10002679 | 3300025938 | Bacteria | 8031 |
| 265 | Ga0207665_10001585 | 3300025939 | Bacteria | 15313 |
| 266 | Ga0207665_10002957 | 3300025939 | Bacteria | 11387 |
| 267 | Ga0207665_10004349 | 3300025939 | Bacteria | 9410 |
| 268 | Ga0207665_10024693 | 3300025939 | Bacteria | 3963 |
| 269 | Ga0207691_10075955 | 3300025940 | Bacteria | 3028 |
| 270 | Ga0207711_10055152 | 3300025941 | Bacteria | 3412 |
| 271 | Ga0207689_10036830 | 3300025942 | Bacteria | 4060 |
| 272 | Ga0207689_10041548 | 3300025942 | Bacteria | 3805 |
| 273 | Ga0207661_10111482 | 3300025944 | Bacteria | 2315 |
| 274 | Ga0207661_10550677 | 3300025944 | Bacteria | 1057 |
| 275 | Ga0207667_10142323 | 3300025949 | Bacteria | 2469 |
| 276 | Ga0207651_10103645 | 3300025960 | Bacteria | 2118 |
| 277 | Ga0207712_10275996 | 3300025961 | Bacteria | 1370 |
| 278 | Ga0207668_10016111 | 3300025972 | Bacteria | 4658 |
| 279 | Ga0207668_10029057 | 3300025972 | Bacteria | 3621 |
| 280 | Ga0207668_10147315 | 3300025972 | Bacteria | 1818 |
| 281 | Ga0207640_10007110 | 3300025981 | Bacteria | 6169 |
| 282 | Ga0207658_10113299 | 3300025986 | Bacteria | 2148 |
| 283 | Ga0207677_10025854 | 3300026023 | Bacteria | 3670 |
| 284 | Ga0207677_10030618 | 3300026023 | Bacteria | 3438 |
| 285 | Ga0207677_10054186 | 3300026023 | Bacteria | 2735 |
| 286 | Ga0207703_10095112 | 3300026035 | Bacteria | 2513 |
| 287 | Ga0207703_10142981 | 3300026035 | Bacteria | 2078 |
| 288 | Ga0207639_10045451 | 3300026041 | Bacteria | 3307 |
| 289 | Ga0207678_10003358 | 3300026067 | Bacteria | 14438 |
| 290 | Ga0207678_10062430 | 3300026067 | Bacteria | 3202 |
| 291 | Ga0207678_10393252 | 3300026067 | Bacteria | 1199 |
| 292 | Ga0207708_10024554 | 3300026075 | Bacteria | 4560 |
| 293 | Ga0207708_10253639 | 3300026075 | Bacteria | 1418 |
| 294 | Ga0207702_10005898 | 3300026078 | Bacteria | 10652 |
| 295 | Ga0207702_10031862 | 3300026078 | Bacteria | 4397 |
| 296 | Ga0207702_10468076 | 3300026078 | Bacteria | 1225 |
| 297 | Ga0207641_10149872 | 3300026088 | Bacteria | 2112 |
| 298 | Ga0207648_10002868 | 3300026089 | Bacteria | 18243 |
| 299 | Ga0207676_10285715 | 3300026095 | Bacteria | 1500 |
| 300 | Ga0207674_10065361 | 3300026116 | Bacteria | 3666 |
| 301 | Ga0207674_10161330 | 3300026116 | Bacteria | 2196 |
| 302 | Ga0207674_10235346 | 3300026116 | Bacteria | 1779 |
| 303 | Ga0207675_100078752 | 3300026118 | Bacteria | 3088 |
| 304 | Ga0207675_100174264 | 3300026118 | Bacteria | 2057 |
| 305 | Ga0207683_10007428 | 3300026121 | Bacteria | 9398 |
| 306 | Ga0207683_10007593 | 3300026121 | Bacteria | 9287 |
| 307 | Ga0207683_10008953 | 3300026121 | Bacteria | 8525 |
| 308 | Ga0207698_10005519 | 3300026142 | Bacteria | 7823 |
| 309 | Ga0207698_10115932 | 3300026142 | Bacteria | 2257 |
| 310 | Ga0268266_10151042 | 3300028379 | Bacteria | 2093 |
| 311 | Ga0268264_10030845 | 3300028381 | Bacteria | 4395 |
| 312 | Ga0307515_10038820 | 3300028794 | Bacteria | 7601 |
| 313 | Ga0307512_10009462 | 3300030522 | Bacteria | 9380 |
| 314 | Ga0265340_10009214 | 3300031247 | Bacteria | 5304 |
| 315 | Ga0307509_10328992 | 3300031507 | Bacteria | 1261 |
| 316 | Ga0307508_10229282 | 3300031616 | Bacteria | 1456 |
| 317 | Ga0316576_10007524 | 3300031727 | Bacteria | 6869 |
| 318 | Ga0307516_10038046 | 3300031730 | Bacteria | 4804 |
| 319 | Ga0326468_10001155 | 3300031889 | Bacteria | 2423 |
| 320 | Ga0307407_10041417 | 3300031903 | Bacteria | 2576 |
| 321 | Ga0307409_100077091 | 3300031995 | Bacteria | 2676 |
| 322 | Ga0307416_100000412 | 3300032002 | Bacteria | 21856 |
| 323 | Ga0373944_0014792 | 3300035089 | Bacteria | 2182 |
| 324 | Ga0373949_0012116 | 3300035090 | Bacteria | 1905 |
| 325 | Ga0373951_0008445 | 3300035091 | Bacteria | 2327 |
| 326 | Ga0373932_0047548 | 3300035112 | Bacteria | 1262 |
| 327 | Ga0373932_0073400 | 3300035112 | Bacteria | 1066 |
| 328 | Ga0373936_0098911 | 3300035113 | Bacteria | 1229 |
| 329 | Ga0373939_0030354 | 3300035114 | Bacteria | 1554 |
| 330 | Ga0373945_0031725 | 3300035116 | Bacteria | 1868 |
| 331 | Ga0373953_0040450 | 3300035117 | Bacteria | 1851 |
| 332 | Ga0373956_0005869 | 3300035119 | Bacteria | 4911 |
| 333 | Ga0373956_0012474 | 3300035119 | Bacteria | 3524 |
| 334 | Ga0373946_0044900 | 3300035171 | Bacteria | 1826 |
| 335 | Ga0373946_0160756 | 3300035171 | Bacteria | 1054 |
| 336 | Ga0373955_0010260 | 3300035172 | Bacteria | 4418 |
| 337 | Ga0373955_0046504 | 3300035172 | Bacteria | 2346 |
| 338 | Ga0373924_0013014 | 3300035410 | Bacteria | 3119 |
| 339 | Ga0373924_0074537 | 3300035410 | Bacteria | 1435 |
| 340 | Ga0373931_0021812 | 3300035691 | Bacteria | 3217 |
| 341 | Ga0373931_0375249 | 3300035691 | Bacteria | 895 |
| 342 | Ga0373935_0121365 | 3300035692 | Bacteria | 1746 |
| 343 | Ga0373935_0139718 | 3300035692 | Bacteria | 1635 |
| 344 | Ga0373933_0048030 | 3300035724 | Bacteria | 2540 |
| 345 | Ga0373933_0188118 | 3300035724 | Bacteria | 1318 |
| 346 | Ga0373933_0285626 | 3300035724 | Bacteria | 1066 |
| 347 | Ga0373937_0002840 | 3300036401 | Bacteria | 14476 |
| 348 | Ga0373937_0041616 | 3300036401 | Bacteria | 4190 |
| 349 | Ga0373937_0124952 | 3300036401 | Bacteria | 2399 |
| 350 | Ga0373925_0030571 | 3300037068 | Bacteria | 3953 |
| 351 | Ga0373925_0055717 | 3300037068 | Bacteria | 2960 |
| 352 | Ga0373925_0080038 | 3300037068 | Bacteria | 2483 |
| 353 | Ga0373925_0415271 | 3300037068 | Bacteria | 1099 |
| 354 | Ga0395900_0344194 | 3300037418 | Bacteria | 1466 |
| 355 | Ga0395898_0025489 | 3300037466 | Bacteria | 5959 |
| 356 | Ga0395901_0050611 | 3300038443 | Bacteria | 4315 |
| 357 | Ga0395901_0055250 | 3300038443 | Bacteria | 4129 |
| 358 | Ga0395901_0140690 | 3300038443 | Bacteria | 2536 |
| 359 | Ga0395901_0251219 | 3300038443 | Bacteria | 1842 |
| 360 | Ga0439457_000234 | 3300042014 | Bacteria | 14914 |
| 361 | Ga0450896_000211 | 3300042133 | Bacteria | 5147 |
| 362 | Ga0450898_003950 | 3300042134 | Bacteria | 2164 |
| 363 | Ga0450899_001537 | 3300042135 | Bacteria | 2559 |
| 364 | Ga0439464_0025186 | 3300042439 | Bacteria | 1647 |
| 365 | Ga0466969_0008037 | 3300044656 | Bacteria | 5603 |
| 366 | Ga0466969_0043916 | 3300044656 | Bacteria | 2226 |
| 367 | Ga0466972_0007332 | 3300044658 | Bacteria | 5539 |
| 368 | Ga0466965_0038183 | 3300044683 | Bacteria | 2358 |
| 369 | Ga0466966_0001156 | 3300044684 | Bacteria | 16964 |
| 370 | Ga0466966_0151062 | 3300044684 | Bacteria | 1416 |
| 371 | Ga0466963_0015911 | 3300044694 | Bacteria | 4670 |
| 372 | Ga0466963_0132197 | 3300044694 | Bacteria | 1725 |
| 373 | Ga0466963_0152655 | 3300044694 | Bacteria | 1604 |
| 374 | Ga0466971_0001070 | 3300044719 | Bacteria | 11373 |
| 375 | Ga0466971_0004300 | 3300044719 | Bacteria | 6138 |
| 376 | Ga0466968_0093500 | 3300044735 | Bacteria | 1336 |
| 377 | Ga0466970_0001368 | 3300044765 | Bacteria | 11751 |
| 378 | Ga0466957_0000029 | 3300044842 | Bacteria | 52517 |
| 379 | Ga0466957_0068672 | 3300044842 | Bacteria | 2188 |
| 380 | Ga0466958_0014944 | 3300045836 | Bacteria | 4439 |
| 381 | Ga0466958_0134980 | 3300045836 | Bacteria | 1551 |
| 382 | Ga0466967_0024490 | 3300045976 | Bacteria | 4964 |
| 383 | Ga0466967_0080059 | 3300045976 | Bacteria | 2947 |
| 384 | Ga0466967_0167561 | 3300045976 | Bacteria | 2065 |
| 385 | Ga0466967_0287030 | 3300045976 | Bacteria | 1580 |
| 386 | Ga0466967_0437433 | 3300045976 | Bacteria | 1277 |
| 387 | Ga0495592_0017437 | 3300046454 | Bacteria | 5455 |
| 388 | Ga0495592_0082251 | 3300046454 | Bacteria | 2327 |
| 389 | Ga0495592_0126673 | 3300046454 | Bacteria | 1791 |
| 390 | Ga0495629_0000833 | 3300046459 | Bacteria | 25000 |
| 391 | Ga0495641_0059213 | 3300046461 | Bacteria | 1731 |
| 392 | Ga0495651_0002846 | 3300046462 | Bacteria | 13395 |
| 393 | Ga0495651_0004104 | 3300046462 | Bacteria | 11144 |
| 394 | Ga0495651_0048475 | 3300046462 | Bacteria | 3281 |
| 395 | Ga0495653_0008849 | 3300046463 | Bacteria | 8239 |
| 396 | Ga0495653_0017889 | 3300046463 | Bacteria | 5762 |
| 397 | Ga0495653_0125417 | 3300046463 | Bacteria | 1824 |
| 398 | Ga0495650_0002221 | 3300046471 | Bacteria | 16296 |
| 399 | Ga0495582_0010310 | 3300046473 | Bacteria | 5141 |
| 400 | Ga0495662_0013525 | 3300046476 | Bacteria | 3973 |
| 401 | Ga0495662_0043248 | 3300046476 | Bacteria | 2174 |
| 402 | Ga0495608_0002213 | 3300046511 | Bacteria | 14039 |
| 403 | Ga0495618_0028444 | 3300046514 | Bacteria | 3483 |
| 404 | Ga0495618_0040465 | 3300046514 | Bacteria | 2933 |
| 405 | Ga0495618_0099943 | 3300046514 | Bacteria | 1856 |
| 406 | Ga0495628_0053682 | 3300046516 | Bacteria | 3179 |
| 407 | Ga0495628_0054758 | 3300046516 | Bacteria | 3144 |
| 408 | Ga0495630_0156685 | 3300046517 | Bacteria | 1733 |
| 409 | Ga0495666_0037652 | 3300046526 | Bacteria | 2353 |
| 410 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 411 | Ga0495652_0017137 | 3300046529 | Bacteria | 6468 |
| 412 | Ga0495652_0060716 | 3300046529 | Bacteria | 3194 |
| 413 | Ga0495652_0174315 | 3300046529 | Bacteria | 1657 |
| 414 | Ga0495640_0008096 | 3300046533 | Bacteria | 8255 |
| 415 | Ga0495640_0031765 | 3300046533 | Bacteria | 3767 |
| 416 | Ga0495587_0016048 | 3300046536 | Bacteria | 4661 |
| 417 | Ga0495587_0072323 | 3300046536 | Bacteria | 2004 |
| 418 | Ga0495645_0025199 | 3300046543 | Bacteria | 4315 |
| 419 | Ga0495645_0114908 | 3300046543 | Bacteria | 1901 |
| 420 | Ga0495667_0001558 | 3300046559 | Bacteria | 15223 |
| 421 | Ga0495667_0021361 | 3300046559 | Bacteria | 4368 |
| 422 | Ga0495667_0028275 | 3300046559 | Bacteria | 3774 |
| 423 | Ga0495634_0017505 | 3300046642 | Bacteria | 5111 |
| 424 | Ga0495635_0002448 | 3300046663 | Bacteria | 12668 |
| 425 | Ga0495657_0006601 | 3300046675 | Bacteria | 9062 |
| 426 | Ga0495657_0015228 | 3300046675 | Bacteria | 5630 |
| 427 | Ga0495599_0144204 | 3300046678 | Bacteria | 1476 |
| 428 | Ga0495646_0017382 | 3300046680 | Bacteria | 4562 |
| 429 | Ga0495647_0103931 | 3300046681 | Bacteria | 1179 |
| 430 | Ga0495658_0047487 | 3300046683 | Bacteria | 2418 |
| 431 | Ga0495613_0082259 | 3300046689 | Bacteria | 2338 |
| 432 | Ga0495624_0020201 | 3300046690 | Bacteria | 4436 |
| 433 | Ga0495624_0034215 | 3300046690 | Bacteria | 3288 |
| 434 | Ga0495600_0011476 | 3300046809 | Bacteria | 5521 |
| 435 | Ga0495581_0120133 | 3300047315 | Bacteria | 1529 |
| 436 | Ga0495604_0009903 | 3300047317 | Bacteria | 7545 |
| 437 | Ga0495604_0076004 | 3300047317 | Bacteria | 2527 |
| 438 | Ga0495604_0117829 | 3300047317 | Bacteria | 1925 |
| 439 | Ga0495674_0000027 | 3300047319 | Bacteria | 132744 |
| 440 | Ga0495674_0006976 | 3300047319 | Bacteria | 10810 |
| 441 | Ga0495674_0033483 | 3300047319 | Bacteria | 4653 |
| 442 | Ga0495674_0038984 | 3300047319 | Bacteria | 4260 |
| 443 | Ga0495676_0052369 | 3300047321 | Bacteria | 3259 |
| 444 | Ga0495680_0001471 | 3300047322 | Bacteria | 25414 |
| 445 | Ga0495680_0002413 | 3300047322 | Bacteria | 19130 |
| 446 | Ga0495680_0008463 | 3300047322 | Bacteria | 9346 |
| 447 | Ga0495680_0036487 | 3300047322 | Bacteria | 3945 |
| 448 | Ga0495680_0127466 | 3300047322 | Bacteria | 1873 |
| 449 | Ga0495675_0031844 | 3300047444 | Bacteria | 3367 |
| 450 | Ga0495675_0164927 | 3300047444 | Bacteria | 1363 |
| 451 | Ga0495684_0014821 | 3300047471 | Bacteria | 6003 |
| 452 | Ga0495684_0022601 | 3300047471 | Bacteria | 4835 |
| 453 | Ga0495684_0114706 | 3300047471 | Bacteria | 2031 |
| 454 | Ga0495686_0080431 | 3300047472 | Bacteria | 1992 |
| 455 | Ga0495593_0010695 | 3300047673 | Bacteria | 5290 |
| 456 | Ga0495602_0033825 | 3300048088 | Bacteria | 4790 |
| 457 | Ga0495602_0153040 | 3300048088 | Bacteria | 1810 |
| 458 | Ga0495602_0300229 | 3300048088 | Bacteria | 1175 |
| 459 | Ga0496100_0047636 | 3300048903 | Bacteria | 2763 |
| 460 | Ga0496103_0011959 | 3300048906 | Bacteria | 5154 |
| 461 | Ga0496104_0015124 | 3300048907 | Bacteria | 6985 |
| 462 | Ga0496104_0021514 | 3300048907 | Bacteria | 5922 |
| 463 | Ga0496104_0079745 | 3300048907 | Bacteria | 3120 |
| 464 | Ga0496104_0084968 | 3300048907 | Bacteria | 3020 |
| 465 | Ga0496105_0019141 | 3300048908 | Bacteria | 5519 |
| 466 | Ga0496105_0020825 | 3300048908 | Bacteria | 5302 |
| 467 | Ga0496105_0041668 | 3300048908 | Bacteria | 3784 |
| 468 | Ga0496105_0050900 | 3300048908 | Bacteria | 3422 |
| 469 | Ga0496105_0064350 | 3300048908 | Bacteria | 3026 |
| 470 | Ga0496106_0197953 | 3300048909 | Bacteria | 1599 |
| 471 | Ga0496107_0041415 | 3300048910 | Bacteria | 3306 |
| 472 | Ga0496108_0021210 | 3300048911 | Bacteria | 5339 |
| 473 | Ga0496108_0064217 | 3300048911 | Bacteria | 3092 |
| 474 | Ga0496108_0071244 | 3300048911 | Bacteria | 2932 |
| 475 | Ga0496108_0078208 | 3300048911 | Bacteria | 2799 |
| 476 | Ga0496108_0260015 | 3300048911 | Bacteria | 1511 |
| 477 | Ga0496109_0021953 | 3300048912 | Bacteria | 5652 |
| 478 | Ga0496109_0222869 | 3300048912 | Bacteria | 1773 |
| 479 | Ga0496110_0014956 | 3300048913 | Bacteria | 6451 |
| 480 | Ga0496110_0103442 | 3300048913 | Bacteria | 2554 |
| 481 | Ga0496110_0392301 | 3300048913 | Bacteria | 1265 |
| 482 | Ga0496111_0027452 | 3300048914 | Bacteria | 4027 |
| 483 | Ga0496111_0101828 | 3300048914 | Bacteria | 2110 |
| 484 | Ga0496112_0060511 | 3300048915 | Bacteria | 3732 |
| 485 | Ga0496112_0095954 | 3300048915 | Bacteria | 2936 |
| 486 | Ga0496112_0141781 | 3300048915 | Bacteria | 2372 |
| 487 | Ga0496112_0236749 | 3300048915 | Bacteria | 1779 |
| 488 | Ga0496112_0380097 | 3300048915 | Bacteria | 1353 |
| 489 | Ga0496113_0002878 | 3300048916 | Bacteria | 10133 |
| 490 | Ga0496113_0087912 | 3300048916 | Bacteria | 2390 |
| 491 | Ga0496113_0163825 | 3300048916 | Bacteria | 1759 |
| 492 | Ga0496113_0293403 | 3300048916 | Bacteria | 1301 |
| 493 | Ga0496114_0223705 | 3300048917 | Bacteria | 1652 |
| 494 | Ga0496115_0005891 | 3300048918 | Bacteria | 8935 |
| 495 | Ga0496115_0065751 | 3300048918 | Bacteria | 2929 |
| 496 | Ga0496115_0278892 | 3300048918 | Bacteria | 1372 |
| 497 | Ga0496115_0452786 | 3300048918 | Bacteria | 1036 |
| 498 | Ga0496119_0000153 | 3300048922 | Bacteria | 95945 |
| 499 | Ga0496120_0002595 | 3300048923 | Bacteria | 17940 |
| 500 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 501 | Ga0496126_0040136 | 3300048929 | Bacteria | 4340 |
| 502 | Ga0501032_0080904 | 3300049569 | Bacteria | 2162 |
| 503 | Ga0501034_0005678 | 3300049571 | Bacteria | 13574 |
| 504 | Ga0501036_0015195 | 3300049572 | Bacteria | 6427 |
| 505 | Ga0501038_0024602 | 3300049574 | Bacteria | 5370 |
| 506 | Ga0501039_0065616 | 3300049575 | Bacteria | 2816 |
| 507 | Ga0501042_0002796 | 3300049578 | Bacteria | 10794 |
| 508 | Ga0501043_0008422 | 3300049579 | Bacteria | 8120 |
| 509 | Ga0501046_0346964 | 3300049580 | Bacteria | 1078 |
| 510 | Ga0501047_0230820 | 3300049581 | Bacteria | 1704 |
| 511 | Ga0501083_0000073 | 3300049744 | Bacteria | 66532 |
| 512 | Ga0501083_0006257 | 3300049744 | Bacteria | 8448 |
| 513 | Ga0501044_0016021 | 3300049823 | Bacteria | 8063 |
| 514 | nmdc:mga0qj67_286880_c1 | 3300050509 | Bacteria | 1334 |
| 515 | nmdc:mga0n895_264115_c1 | 3300050512 | Bacteria | 1746 |
| 516 | nmdc:mga0n895_374715_c1 | 3300050512 | Bacteria | 1441 |
| 517 | nmdc:mga0rr50_204446_c1 | 3300050513 | Bacteria | 1624 |
| 518 | nmdc:mga0a205_12459_c1 | 3300050515 | Bacteria | 7868 |
| 519 | Ga0495601_0025141 | 3300053077 | Bacteria | 3670 |
| 520 | Ga0495601_0044595 | 3300053077 | Bacteria | 2787 |
| 521 | Ga0495612_0013607 | 3300053078 | Bacteria | 3277 |
| 522 | Ga0495612_0033459 | 3300053078 | Bacteria | 2080 |
| 523 | Ga0495595_0008547 | 3300053084 | Bacteria | 4209 |
| 524 | Ga0495595_0014580 | 3300053084 | Bacteria | 3338 |
| 525 | Ga0495619_0023859 | 3300053085 | Bacteria | 3921 |
| 526 | Ga0495619_0043442 | 3300053085 | Bacteria | 2946 |
| 527 | Ga0466962_0000570 | 3300061719 | Bacteria | 16211 |
| 528 | Ga0466962_0002590 | 3300061719 | Bacteria | 8589 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0375249 | Ga0373931_0375249_18_881 | 287 |
| 2 | 3300025972 | Ga0207668_10147315 | Ga0207668_101473152 | 288 |
| 3 | 3300006844 | Ga0075428_100284936 | Ga0075428_1002849362 | 290 |
| 4 | 3300045976 | Ga0466967_0437433 | Ga0466967_0437433_241_1209 | 290 |
| 5 | 3300037418 | Ga0395900_0344194 | Ga0395900_0344194_522_1397 | 291 |
| 6 | 3300037466 | Ga0395898_0025489 | Ga0395898_0025489_3643_4518 | 291 |
| 7 | 3300038443 | Ga0395901_0050611 | Ga0395901_0050611_1655_2530 | 291 |
| 8 | 3300005471 | Ga0070698_100089512 | Ga0070698_1000895122 | 293 |
| 9 | 3300006871 | Ga0075434_100060751 | Ga0075434_1000607512 | 293 |
| 10 | 3300007076 | Ga0075435_100035429 | Ga0075435_1000354293 | 293 |
| 11 | 3300025915 | Ga0207693_10148036 | Ga0207693_101480362 | 293 |
| 12 | 3300025929 | Ga0207664_10326843 | Ga0207664_103268432 | 293 |
| 13 | 3300005334 | Ga0068869_100259676 | Ga0068869_1002596762 | 294 |
| 14 | 3300005338 | Ga0068868_100013706 | Ga0068868_1000137061 | 294 |
| 15 | 3300005436 | Ga0070713_100159271 | Ga0070713_1001592711 | 294 |
| 16 | 3300005440 | Ga0070705_100041053 | Ga0070705_1000410531 | 294 |
| 17 | 3300005458 | Ga0070681_10140115 | Ga0070681_101401152 | 294 |
| 18 | 3300005535 | Ga0070684_100154423 | Ga0070684_1001544232 | 294 |
| 19 | 3300005545 | Ga0070695_100330088 | Ga0070695_1003300881 | 294 |
| 20 | 3300005577 | Ga0068857_100096627 | Ga0068857_1000966271 | 294 |
| 21 | 3300005615 | Ga0070702_100032009 | Ga0070702_1000320092 | 294 |
| 22 | 3300005841 | Ga0068863_100420867 | Ga0068863_1004208671 | 294 |
| 23 | 3300005843 | Ga0068860_100394694 | Ga0068860_1003946942 | 294 |
| 24 | 3300006163 | Ga0070715_10070264 | Ga0070715_100702641 | 294 |
| 25 | 3300006237 | Ga0097621_100010723 | Ga0097621_1000107232 | 294 |
| 26 | 3300009098 | Ga0105245_10104583 | Ga0105245_101045831 | 294 |
| 27 | 3300013296 | Ga0157374_10015824 | Ga0157374_100158246 | 294 |
| 28 | 3300013306 | Ga0163162_10007047 | Ga0163162_1000704710 | 294 |
| 29 | 3300014325 | Ga0163163_10343198 | Ga0163163_103431982 | 294 |
| 30 | 3300014968 | Ga0157379_10011804 | Ga0157379_100118047 | 294 |
| 31 | 3300025905 | Ga0207685_10021614 | Ga0207685_100216142 | 294 |
| 32 | 3300025906 | Ga0207699_10231087 | Ga0207699_102310871 | 294 |
| 33 | 3300025927 | Ga0207687_10061644 | Ga0207687_100616441 | 294 |
| 34 | 3300025928 | Ga0207700_10097823 | Ga0207700_100978232 | 294 |
| 35 | 3300025929 | Ga0207664_10051797 | Ga0207664_100517972 | 294 |
| 36 | 3300025939 | Ga0207665_10024693 | Ga0207665_100246935 | 294 |
| 37 | 3300025949 | Ga0207667_10142323 | Ga0207667_101423233 | 294 |
| 38 | 3300026023 | Ga0207677_10030618 | Ga0207677_100306185 | 294 |
| 39 | 3300026035 | Ga0207703_10142981 | Ga0207703_101429812 | 294 |
| 40 | 3300026116 | Ga0207674_10065361 | Ga0207674_100653612 | 294 |
| 41 | 3300035089 | Ga0373944_0014792 | Ga0373944_0014792_202_1170 | 294 |
| 42 | 3300035116 | Ga0373945_0031725 | Ga0373945_0031725_500_1468 | 294 |
| 43 | 3300035171 | Ga0373946_0160756 | Ga0373946_0160756_26_994 | 294 |
| 44 | 3300035410 | Ga0373924_0074537 | Ga0373924_0074537_281_1249 | 294 |
| 45 | 3300035691 | Ga0373931_0021812 | Ga0373931_0021812_1398_2366 | 294 |
| 46 | 3300035692 | Ga0373935_0121365 | Ga0373935_0121365_359_1327 | 294 |
| 47 | 3300035724 | Ga0373933_0285626 | Ga0373933_0285626_39_1007 | 294 |
| 48 | 3300046454 | Ga0495592_0017437 | Ga0495592_0017437_3570_4538 | 294 |
| 49 | 3300046461 | Ga0495641_0059213 | Ga0495641_0059213_474_1442 | 294 |
| 50 | 3300046462 | Ga0495651_0004104 | Ga0495651_0004104_7279_8247 | 294 |
| 51 | 3300046463 | Ga0495653_0017889 | Ga0495653_0017889_4390_5358 | 294 |
| 52 | 3300046476 | Ga0495662_0013525 | Ga0495662_0013525_547_1515 | 294 |
| 53 | 3300046514 | Ga0495618_0099943 | Ga0495618_0099943_487_1455 | 294 |
| 54 | 3300046536 | Ga0495587_0072323 | Ga0495587_0072323_227_1195 | 294 |
| 55 | 3300046543 | Ga0495645_0025199 | Ga0495645_0025199_2118_3086 | 294 |
| 56 | 3300046642 | Ga0495634_0017505 | Ga0495634_0017505_1968_2936 | 294 |
| 57 | 3300046675 | Ga0495657_0015228 | Ga0495657_0015228_4406_5374 | 294 |
| 58 | 3300046690 | Ga0495624_0020201 | Ga0495624_0020201_3099_4067 | 294 |
| 59 | 3300047315 | Ga0495581_0120133 | Ga0495581_0120133_513_1481 | 294 |
| 60 | 3300047317 | Ga0495604_0076004 | Ga0495604_0076004_768_1736 | 294 |
| 61 | 3300047319 | Ga0495674_0033483 | Ga0495674_0033483_2290_3258 | 294 |
| 62 | 3300047322 | Ga0495680_0036487 | Ga0495680_0036487_2122_3090 | 294 |
| 63 | 3300047471 | Ga0495684_0022601 | Ga0495684_0022601_449_1417 | 294 |
| 64 | 3300048907 | Ga0496104_0021514 | Ga0496104_0021514_983_1951 | 294 |
| 65 | 3300048908 | Ga0496105_0019141 | Ga0496105_0019141_3658_4626 | 294 |
| 66 | 3300048909 | Ga0496106_0197953 | Ga0496106_0197953_357_1325 | 294 |
| 67 | 3300048912 | Ga0496109_0021953 | Ga0496109_0021953_3294_4262 | 294 |
| 68 | 3300048913 | Ga0496110_0014956 | Ga0496110_0014956_1848_2816 | 294 |
| 69 | 3300048914 | Ga0496111_0027452 | Ga0496111_0027452_2735_3703 | 294 |
| 70 | 3300048915 | Ga0496112_0095954 | Ga0496112_0095954_182_1150 | 294 |
| 71 | 3300048916 | Ga0496113_0293403 | Ga0496113_0293403_37_1005 | 294 |
| 72 | 3300053077 | Ga0495601_0025141 | Ga0495601_0025141_303_1271 | 294 |
| 73 | 3300053078 | Ga0495612_0033459 | Ga0495612_0033459_207_1175 | 294 |
| 74 | 3300053084 | Ga0495595_0014580 | Ga0495595_0014580_1851_2819 | 294 |
| 75 | 3300006163 | Ga0070715_10098391 | Ga0070715_100983912 | 295 |
| 76 | 3300025905 | Ga0207685_10060312 | Ga0207685_100603122 | 295 |
| 77 | 3300030522 | Ga0307512_10009462 | Ga0307512_100094622 | 295 |
| 78 | 3300050512 | nmdc:mga0n895_374715_c1 | nmdc:mga0n895_374715_c1_34_1068 | 295 |
| 79 | 3300005355 | Ga0070671_100177293 | Ga0070671_1001772932 | 296 |
| 80 | 3300005434 | Ga0070709_10006128 | Ga0070709_100061286 | 296 |
| 81 | 3300005436 | Ga0070713_100031034 | Ga0070713_1000310342 | 296 |
| 82 | 3300005614 | Ga0068856_100008985 | Ga0068856_1000089856 | 296 |
| 83 | 3300005841 | Ga0068863_100114972 | Ga0068863_1001149722 | 296 |
| 84 | 3300005844 | Ga0068862_100215699 | Ga0068862_1002156992 | 296 |
| 85 | 3300006175 | Ga0070712_100061822 | Ga0070712_1000618224 | 296 |
| 86 | 3300014968 | Ga0157379_10044971 | Ga0157379_100449713 | 296 |
| 87 | 3300014969 | Ga0157376_10013931 | Ga0157376_100139313 | 296 |
| 88 | 3300025898 | Ga0207692_10034515 | Ga0207692_100345153 | 296 |
| 89 | 3300025906 | Ga0207699_10005542 | Ga0207699_100055424 | 296 |
| 90 | 3300025928 | Ga0207700_10022164 | Ga0207700_100221644 | 296 |
| 91 | 3300025972 | Ga0207668_10029057 | Ga0207668_100290574 | 296 |
| 92 | 3300026078 | Ga0207702_10031862 | Ga0207702_100318622 | 296 |
| 93 | 3300005614 | Ga0068856_100444354 | Ga0068856_1004443542 | 298 |
| 94 | 3300009174 | Ga0105241_10122424 | Ga0105241_101224242 | 298 |
| 95 | 3300009551 | Ga0105238_10265371 | Ga0105238_102653712 | 298 |
| 96 | 3300011119 | Ga0105246_10266640 | Ga0105246_102666402 | 298 |
| 97 | 3300013105 | Ga0157369_10124106 | Ga0157369_101241062 | 298 |
| 98 | 3300013297 | Ga0157378_10022158 | Ga0157378_100221585 | 298 |
| 99 | 3300013306 | Ga0163162_10210298 | Ga0163162_102102982 | 298 |
| 100 | 3300031247 | Ga0265340_10009214 | Ga0265340_100092146 | 298 |
| 101 | 3300035112 | Ga0373932_0073400 | Ga0373932_0073400_12_908 | 298 |
| 102 | 3300048903 | Ga0496100_0047636 | Ga0496100_0047636_214_1110 | 298 |
| 103 | 3300048906 | Ga0496103_0011959 | Ga0496103_0011959_3107_4003 | 298 |
| 104 | 3300048910 | Ga0496107_0041415 | Ga0496107_0041415_600_1496 | 298 |
| 105 | 3300048918 | Ga0496115_0065751 | Ga0496115_0065751_1805_2701 | 298 |
| 106 | 3300003792 | Ga0055540_1000104 | Ga0055540_100010416 | 299 |
| 107 | 3300025303 | Ga0209051_1000231 | Ga0209051_100023115 | 299 |
| 108 | 3300035113 | Ga0373936_0098911 | Ga0373936_0098911_221_1189 | 299 |
| 109 | 3300003320 | rootH2_10015800 | rootH2_100158004 | 300 |
| 110 | 3300003322 | rootL2_10002683 | rootL2_100026835 | 300 |
| 111 | 3300003323 | rootH1_10018354 | rootH1_100183543 | 300 |
| 112 | 3300003323 | rootH1_10031413 | rootH1_100314132 | 300 |
| 113 | 3300005615 | Ga0070702_100055773 | Ga0070702_1000557732 | 301 |
| 114 | 3300006173 | Ga0070716_100146002 | Ga0070716_1001460022 | 301 |
| 115 | 3300025961 | Ga0207712_10275996 | Ga0207712_102759961 | 301 |
| 116 | 3300031507 | Ga0307509_10328992 | Ga0307509_103289921 | 301 |
| 117 | 3300031730 | Ga0307516_10038046 | Ga0307516_100380464 | 301 |
| 118 | 3300048908 | Ga0496105_0020825 | Ga0496105_0020825_4184_5179 | 301 |
| 119 | 3300048908 | Ga0496105_0064350 | Ga0496105_0064350_1268_2236 | 301 |
| 120 | 3300005436 | Ga0070713_100061131 | Ga0070713_1000611313 | 304 |
| 121 | 3300006163 | Ga0070715_10031895 | Ga0070715_100318952 | 304 |
| 122 | 3300006173 | Ga0070716_100007180 | Ga0070716_1000071801 | 304 |
| 123 | 3300025898 | Ga0207692_10007217 | Ga0207692_100072173 | 304 |
| 124 | 3300025905 | Ga0207685_10001274 | Ga0207685_100012744 | 304 |
| 125 | 3300025906 | Ga0207699_10002383 | Ga0207699_100023836 | 304 |
| 126 | 3300025915 | Ga0207693_10016500 | Ga0207693_100165003 | 304 |
| 127 | 3300025916 | Ga0207663_10139452 | Ga0207663_101394522 | 304 |
| 128 | 3300025916 | Ga0207663_10289197 | Ga0207663_102891972 | 304 |
| 129 | 3300025929 | Ga0207664_10007882 | Ga0207664_100078823 | 304 |
| 130 | 3300025939 | Ga0207665_10004349 | Ga0207665_100043492 | 304 |
| 131 | 3300046471 | Ga0495650_0002221 | Ga0495650_0002221_4259_5230 | 304 |
| 132 | 3300048907 | Ga0496104_0084968 | Ga0496104_0084968_263_1231 | 304 |
| 133 | 3300048911 | Ga0496108_0078208 | Ga0496108_0078208_1425_2393 | 304 |
| 134 | 3300048915 | Ga0496112_0141781 | Ga0496112_0141781_1220_2188 | 304 |
| 135 | 3300048916 | Ga0496113_0087912 | Ga0496113_0087912_1401_2369 | 304 |
| 136 | 3300048918 | Ga0496115_0452786 | Ga0496115_0452786_43_1011 | 304 |
| 137 | 3300050512 | nmdc:mga0n895_264115_c1 | nmdc:mga0n895_264115_c1_617_1585 | 304 |
| 138 | 3300005983 | Ga0081540_1071029 | Ga0081540_10710292 | 305 |
| 139 | 3300049744 | Ga0501083_0006257 | Ga0501083_0006257_5931_6899 | 306 |
| 140 | 3300009545 | Ga0105237_10154041 | Ga0105237_101540412 | 307 |
| 141 | 3300038443 | Ga0395901_0055250 | Ga0395901_0055250_1467_2432 | 307 |
| 142 | 3300005548 | Ga0070665_100048971 | Ga0070665_1000489712 | 308 |
| 143 | 3300005983 | Ga0081540_1000803 | Ga0081540_100080317 | 308 |
| 144 | 3300025315 | Ga0207697_10012888 | Ga0207697_100128884 | 308 |
| 145 | 3300025986 | Ga0207658_10113299 | Ga0207658_101132992 | 308 |
| 146 | 3300028379 | Ga0268266_10151042 | Ga0268266_101510422 | 308 |
| 147 | 3300028794 | Ga0307515_10038820 | Ga0307515_100388202 | 308 |
| 148 | 3300002070 | JGI24750J21931_1003454 | JGI24750J21931_10034542 | 309 |
| 149 | 3300005331 | Ga0070670_100102437 | Ga0070670_1001024372 | 309 |
| 150 | 3300005618 | Ga0068864_100052883 | Ga0068864_1000528832 | 309 |
| 151 | 3300006186 | Ga0075369_10011213 | Ga0075369_100112132 | 309 |
| 152 | 3300025972 | Ga0207668_10016111 | Ga0207668_100161112 | 309 |
| 153 | 3300048911 | Ga0496108_0071244 | Ga0496108_0071244_150_1145 | 309 |
| 154 | 3300048915 | Ga0496112_0060511 | Ga0496112_0060511_1385_2380 | 309 |
| 155 | 3300025944 | Ga0207661_10111482 | Ga0207661_101114823 | 312 |
| 156 | 3300005329 | Ga0070683_100289167 | Ga0070683_1002891671 | 313 |
| 157 | 3300005367 | Ga0070667_100124386 | Ga0070667_1001243862 | 313 |
| 158 | 3300005617 | Ga0068859_100246895 | Ga0068859_1002468952 | 313 |
| 159 | 3300006931 | Ga0097620_100246899 | Ga0097620_1002468992 | 313 |
| 160 | 3300009545 | Ga0105237_10206769 | Ga0105237_102067691 | 313 |
| 161 | 3300013105 | Ga0157369_10660013 | Ga0157369_106600131 | 313 |
| 162 | 3300013308 | Ga0157375_10132538 | Ga0157375_101325383 | 313 |
| 163 | 3300025908 | Ga0207643_10085777 | Ga0207643_100857773 | 313 |
| 164 | 3300038443 | Ga0395901_0251219 | Ga0395901_0251219_712_1698 | 313 |
| 165 | 3300048913 | Ga0496110_0392301 | Ga0496110_0392301_45_1010 | 313 |
| 166 | 3300049744 | Ga0501083_0000073 | Ga0501083_0000073_26636_27616 | 313 |
| 167 | iso_pu_bacteria | 2582581314 | 2585318082 | 314 |
| 168 | 3300005842 | Ga0068858_100132645 | Ga0068858_1001326452 | 315 |
| 169 | 3300013105 | Ga0157369_10168511 | Ga0157369_101685113 | 315 |
| 170 | 3300025932 | Ga0207690_10216803 | Ga0207690_102168031 | 315 |
| 171 | 3300025933 | Ga0207706_10055687 | Ga0207706_100556873 | 315 |
| 172 | 3300025944 | Ga0207661_10550677 | Ga0207661_105506771 | 315 |
| 173 | 3300026035 | Ga0207703_10095112 | Ga0207703_100951122 | 315 |
| 174 | 3300026067 | Ga0207678_10393252 | Ga0207678_103932522 | 315 |
| 175 | 3300026116 | Ga0207674_10235346 | Ga0207674_102353463 | 315 |
| 176 | 3300026142 | Ga0207698_10115932 | Ga0207698_101159323 | 315 |
| 177 | 3300042439 | Ga0439464_0025186 | Ga0439464_0025186_103_1068 | 315 |
| 178 | iso_pu_bacteria | 2808606700 | 2810364153 | 317 |
| 179 | iso_pu_bacteria | 2905926851 | 2905929121 | 317 |
| 180 | iso_pu_bacteria | 2946003308 | 2946005288 | 317 |
| 181 | iso_pu_bacteria | 2870782633 | 2870790892 | 318 |
| 182 | iso_pu_bacteria | 3002998708 | 3002999657 | 318 |
| 183 | iso_pu_bacteria | 8053945823 | 8053946540 | 318 |
| 184 | iso_pu_bacteria | 2738543005 | 2739202869 | 319 |
| 185 | iso_pu_bacteria | 2928142448 | 2928142912 | 319 |
| 186 | 3300049578 | Ga0501042_0002796 | Ga0501042_0002796_6282_7262 | 320 |
| 187 | 3300005327 | Ga0070658_10109080 | Ga0070658_101090803 | 321 |
| 188 | 3300005328 | Ga0070676_10267502 | Ga0070676_102675021 | 321 |
| 189 | 3300005338 | Ga0068868_100017998 | Ga0068868_1000179983 | 321 |
| 190 | 3300005338 | Ga0068868_100077977 | Ga0068868_1000779771 | 321 |
| 191 | 3300005340 | Ga0070689_100139206 | Ga0070689_1001392062 | 321 |
| 192 | 3300005354 | Ga0070675_100102732 | Ga0070675_1001027324 | 321 |
| 193 | 3300005355 | Ga0070671_100073012 | Ga0070671_1000730122 | 321 |
| 194 | 3300005356 | Ga0070674_100154890 | Ga0070674_1001548903 | 321 |
| 195 | 3300005364 | Ga0070673_100211266 | Ga0070673_1002112661 | 321 |
| 196 | 3300005406 | Ga0070703_10077238 | Ga0070703_100772381 | 321 |
| 197 | 3300005435 | Ga0070714_100000050 | Ga0070714_10000005045 | 321 |
| 198 | 3300005436 | Ga0070713_100146567 | Ga0070713_1001465672 | 321 |
| 199 | 3300005439 | Ga0070711_100182641 | Ga0070711_1001826412 | 321 |
| 200 | 3300005440 | Ga0070705_100244608 | Ga0070705_1002446082 | 321 |
| 201 | 3300005457 | Ga0070662_100011728 | Ga0070662_1000117281 | 321 |
| 202 | 3300005458 | Ga0070681_10396519 | Ga0070681_103965192 | 321 |
| 203 | 3300005545 | Ga0070695_100041282 | Ga0070695_1000412821 | 321 |
| 204 | 3300005548 | Ga0070665_100120095 | Ga0070665_1001200954 | 321 |
| 205 | 3300005614 | Ga0068856_100128643 | Ga0068856_1001286432 | 321 |
| 206 | 3300005616 | Ga0068852_100013804 | Ga0068852_1000138042 | 321 |
| 207 | 3300005616 | Ga0068852_100032489 | Ga0068852_1000324892 | 321 |
| 208 | 3300005617 | Ga0068859_100168620 | Ga0068859_1001686203 | 321 |
| 209 | 3300005618 | Ga0068864_100276038 | Ga0068864_1002760381 | 321 |
| 210 | 3300005842 | Ga0068858_100213216 | Ga0068858_1002132161 | 321 |
| 211 | 3300005843 | Ga0068860_100075350 | Ga0068860_1000753502 | 321 |
| 212 | 3300005983 | Ga0081540_1000735 | Ga0081540_100073515 | 321 |
| 213 | 3300006028 | Ga0070717_10009814 | Ga0070717_100098142 | 321 |
| 214 | 3300006175 | Ga0070712_100170276 | Ga0070712_1001702763 | 321 |
| 215 | 3300006358 | Ga0068871_100037177 | Ga0068871_1000371772 | 321 |
| 216 | 3300006852 | Ga0075433_10065017 | Ga0075433_100650173 | 321 |
| 217 | 3300006871 | Ga0075434_100160162 | Ga0075434_1001601622 | 321 |
| 218 | 3300006881 | Ga0068865_100072506 | Ga0068865_1000725064 | 321 |
| 219 | 3300006881 | Ga0068865_100115625 | Ga0068865_1001156253 | 321 |
| 220 | 3300006914 | Ga0075436_100006552 | Ga0075436_1000065522 | 321 |
| 221 | 3300006931 | Ga0097620_100168627 | Ga0097620_1001686273 | 321 |
| 222 | 3300007076 | Ga0075435_100202456 | Ga0075435_1002024563 | 321 |
| 223 | 3300009093 | Ga0105240_10094429 | Ga0105240_100944296 | 321 |
| 224 | 3300009094 | Ga0111539_10278811 | Ga0111539_102788113 | 321 |
| 225 | 3300009098 | Ga0105245_10004477 | Ga0105245_100044773 | 321 |
| 226 | 3300009098 | Ga0105245_10082476 | Ga0105245_100824765 | 321 |
| 227 | 3300009098 | Ga0105245_10238289 | Ga0105245_102382893 | 321 |
| 228 | 3300009174 | Ga0105241_10246984 | Ga0105241_102469842 | 321 |
| 229 | 3300009551 | Ga0105238_10089225 | Ga0105238_100892251 | 321 |
| 230 | 3300013102 | Ga0157371_10076000 | Ga0157371_100760003 | 321 |
| 231 | 3300013104 | Ga0157370_10014832 | Ga0157370_100148321 | 321 |
| 232 | 3300013105 | Ga0157369_10088068 | Ga0157369_100880682 | 321 |
| 233 | 3300013296 | Ga0157374_10020623 | Ga0157374_100206231 | 321 |
| 234 | 3300013297 | Ga0157378_10444189 | Ga0157378_104441892 | 321 |
| 235 | 3300013306 | Ga0163162_10026165 | Ga0163162_100261659 | 321 |
| 236 | 3300013307 | Ga0157372_10112948 | Ga0157372_101129485 | 321 |
| 237 | 3300013307 | Ga0157372_10354380 | Ga0157372_103543802 | 321 |
| 238 | 3300014325 | Ga0163163_10180320 | Ga0163163_101803203 | 321 |
| 239 | 3300014326 | Ga0157380_10283366 | Ga0157380_102833661 | 321 |
| 240 | 3300014745 | Ga0157377_10075189 | Ga0157377_100751891 | 321 |
| 241 | 3300014968 | Ga0157379_10012642 | Ga0157379_100126421 | 321 |
| 242 | 3300014968 | Ga0157379_10211929 | Ga0157379_102119292 | 321 |
| 243 | 3300014968 | Ga0157379_10290196 | Ga0157379_102901962 | 321 |
| 244 | 3300020070 | Ga0206356_10036690 | Ga0206356_100366904 | 321 |
| 245 | 3300020082 | Ga0206353_11782425 | Ga0206353_117824252 | 321 |
| 246 | 3300025899 | Ga0207642_10130742 | Ga0207642_101307422 | 321 |
| 247 | 3300025900 | Ga0207710_10090267 | Ga0207710_100902671 | 321 |
| 248 | 3300025901 | Ga0207688_10039963 | Ga0207688_100399634 | 321 |
| 249 | 3300025901 | Ga0207688_10110902 | Ga0207688_101109022 | 321 |
| 250 | 3300025904 | Ga0207647_10045073 | Ga0207647_100450731 | 321 |
| 251 | 3300025911 | Ga0207654_10102086 | Ga0207654_101020862 | 321 |
| 252 | 3300025914 | Ga0207671_10057096 | Ga0207671_100570963 | 321 |
| 253 | 3300025915 | Ga0207693_10006705 | Ga0207693_100067051 | 321 |
| 254 | 3300025918 | Ga0207662_10034019 | Ga0207662_100340194 | 321 |
| 255 | 3300025923 | Ga0207681_10190018 | Ga0207681_101900182 | 321 |
| 256 | 3300025926 | Ga0207659_10213692 | Ga0207659_102136922 | 321 |
| 257 | 3300025927 | Ga0207687_10005276 | Ga0207687_100052767 | 321 |
| 258 | 3300025927 | Ga0207687_10084176 | Ga0207687_100841764 | 321 |
| 259 | 3300025929 | Ga0207664_10000003 | Ga0207664_10000003270 | 321 |
| 260 | 3300025933 | Ga0207706_10009290 | Ga0207706_1000929013 | 321 |
| 261 | 3300025937 | Ga0207669_10045916 | Ga0207669_100459165 | 321 |
| 262 | 3300025939 | Ga0207665_10001585 | Ga0207665_100015858 | 321 |
| 263 | 3300025940 | Ga0207691_10075955 | Ga0207691_100759554 | 321 |
| 264 | 3300025942 | Ga0207689_10041548 | Ga0207689_100415482 | 321 |
| 265 | 3300025960 | Ga0207651_10103645 | Ga0207651_101036453 | 321 |
| 266 | 3300026023 | Ga0207677_10025854 | Ga0207677_100258543 | 321 |
| 267 | 3300026067 | Ga0207678_10003358 | Ga0207678_1000335812 | 321 |
| 268 | 3300026078 | Ga0207702_10468076 | Ga0207702_104680761 | 321 |
| 269 | 3300026088 | Ga0207641_10149872 | Ga0207641_101498721 | 321 |
| 270 | 3300026095 | Ga0207676_10285715 | Ga0207676_102857151 | 321 |
| 271 | 3300026116 | Ga0207674_10161330 | Ga0207674_101613302 | 321 |
| 272 | 3300026118 | Ga0207675_100174264 | Ga0207675_1001742641 | 321 |
| 273 | 3300026121 | Ga0207683_10008953 | Ga0207683_100089531 | 321 |
| 274 | 3300026142 | Ga0207698_10005519 | Ga0207698_100055199 | 321 |
| 275 | 3300031616 | Ga0307508_10229282 | Ga0307508_102292822 | 321 |
| 276 | 3300031889 | Ga0326468_10001155 | Ga0326468_100011553 | 321 |
| 277 | 3300031903 | Ga0307407_10041417 | Ga0307407_100414173 | 321 |
| 278 | 3300031995 | Ga0307409_100077091 | Ga0307409_1000770912 | 321 |
| 279 | 3300032002 | Ga0307416_100000412 | Ga0307416_1000004122 | 321 |
| 280 | 3300035090 | Ga0373949_0012116 | Ga0373949_0012116_554_1522 | 321 |
| 281 | 3300035091 | Ga0373951_0008445 | Ga0373951_0008445_71_1039 | 321 |
| 282 | 3300035112 | Ga0373932_0047548 | Ga0373932_0047548_178_1146 | 321 |
| 283 | 3300035114 | Ga0373939_0030354 | Ga0373939_0030354_217_1185 | 321 |
| 284 | 3300044656 | Ga0466969_0043916 | Ga0466969_0043916_979_1947 | 321 |
| 285 | 3300045976 | Ga0466967_0080059 | Ga0466967_0080059_1666_2631 | 321 |
| 286 | 3300045976 | Ga0466967_0167561 | Ga0466967_0167561_522_1487 | 321 |
| 287 | 3300045976 | Ga0466967_0287030 | Ga0466967_0287030_177_1145 | 321 |
| 288 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_568336_569301 | 321 |
| 289 | 3300047319 | Ga0495674_0000027 | Ga0495674_0000027_54255_55220 | 321 |
| 290 | 3300047472 | Ga0495686_0080431 | Ga0495686_0080431_983_1948 | 321 |
| 291 | 3300048907 | Ga0496104_0015124 | Ga0496104_0015124_402_1370 | 321 |
| 292 | 3300048908 | Ga0496105_0050900 | Ga0496105_0050900_402_1370 | 321 |
| 293 | 3300048911 | Ga0496108_0064217 | Ga0496108_0064217_425_1393 | 321 |
| 294 | 3300048911 | Ga0496108_0260015 | Ga0496108_0260015_169_1134 | 321 |
| 295 | 3300048912 | Ga0496109_0222869 | Ga0496109_0222869_577_1545 | 321 |
| 296 | 3300048913 | Ga0496110_0103442 | Ga0496110_0103442_464_1432 | 321 |
| 297 | 3300048914 | Ga0496111_0101828 | Ga0496111_0101828_30_995 | 321 |
| 298 | 3300048915 | Ga0496112_0236749 | Ga0496112_0236749_405_1373 | 321 |
| 299 | 3300048916 | Ga0496113_0002878 | Ga0496113_0002878_1523_2491 | 321 |
| 300 | 3300048918 | Ga0496115_0278892 | Ga0496115_0278892_130_1098 | 321 |
| 301 | 3300048922 | Ga0496119_0000153 | Ga0496119_0000153_10115_11083 | 321 |
| 302 | 3300048923 | Ga0496120_0002595 | Ga0496120_0002595_6867_7835 | 321 |
| 303 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_542920_543888 | 321 |
| 304 | 3300048929 | Ga0496126_0040136 | Ga0496126_0040136_2182_3150 | 321 |
| 305 | 3300050509 | nmdc:mga0qj67_286880_c1 | nmdc:mga0qj67_286880_c1_280_1245 | 321 |
| 306 | 3300050515 | nmdc:mga0a205_12459_c1 | nmdc:mga0a205_12459_c1_6024_6992 | 321 |
| 307 | 3300005434 | Ga0070709_10009034 | Ga0070709_100090345 | 322 |
| 308 | 3300005435 | Ga0070714_100007913 | Ga0070714_1000079135 | 322 |
| 309 | 3300005436 | Ga0070713_100027813 | Ga0070713_1000278133 | 322 |
| 310 | 3300005436 | Ga0070713_100092741 | Ga0070713_1000927412 | 322 |
| 311 | 3300005437 | Ga0070710_10008764 | Ga0070710_100087642 | 322 |
| 312 | 3300005439 | Ga0070711_100015764 | Ga0070711_1000157642 | 322 |
| 313 | 3300005468 | Ga0070707_100000127 | Ga0070707_10000012741 | 322 |
| 314 | 3300005468 | Ga0070707_100186135 | Ga0070707_1001861352 | 322 |
| 315 | 3300005471 | Ga0070698_100001111 | Ga0070698_10000111123 | 322 |
| 316 | 3300006028 | Ga0070717_10038283 | Ga0070717_100382834 | 322 |
| 317 | 3300006028 | Ga0070717_10044593 | Ga0070717_100445932 | 322 |
| 318 | 3300006028 | Ga0070717_10122878 | Ga0070717_101228784 | 322 |
| 319 | 3300006173 | Ga0070716_100002471 | Ga0070716_1000024717 | 322 |
| 320 | 3300006175 | Ga0070712_100015940 | Ga0070712_1000159404 | 322 |
| 321 | 3300006175 | Ga0070712_100184902 | Ga0070712_1001849022 | 322 |
| 322 | 3300006914 | Ga0075436_100003312 | Ga0075436_1000033122 | 322 |
| 323 | 3300007076 | Ga0075435_100296827 | Ga0075435_1002968272 | 322 |
| 324 | 3300025898 | Ga0207692_10005854 | Ga0207692_100058545 | 322 |
| 325 | 3300025898 | Ga0207692_10023049 | Ga0207692_100230492 | 322 |
| 326 | 3300025910 | Ga0207684_10018829 | Ga0207684_100188294 | 322 |
| 327 | 3300025916 | Ga0207663_10038546 | Ga0207663_100385461 | 322 |
| 328 | 3300025922 | Ga0207646_10000264 | Ga0207646_1000026425 | 322 |
| 329 | 3300025922 | Ga0207646_10074362 | Ga0207646_100743623 | 322 |
| 330 | 3300025928 | Ga0207700_10015170 | Ga0207700_100151705 | 322 |
| 331 | 3300025928 | Ga0207700_10102344 | Ga0207700_101023442 | 322 |
| 332 | 3300025928 | Ga0207700_10108680 | Ga0207700_101086802 | 322 |
| 333 | 3300025928 | Ga0207700_10127229 | Ga0207700_101272292 | 322 |
| 334 | 3300025929 | Ga0207664_10005800 | Ga0207664_100058004 | 322 |
| 335 | 3300025939 | Ga0207665_10002957 | Ga0207665_100029574 | 322 |
| 336 | 3300031727 | Ga0316576_10007524 | Ga0316576_100075243 | 322 |
| 337 | 3300035117 | Ga0373953_0040450 | Ga0373953_0040450_260_1228 | 322 |
| 338 | 3300035119 | Ga0373956_0005869 | Ga0373956_0005869_120_1088 | 322 |
| 339 | 3300035119 | Ga0373956_0012474 | Ga0373956_0012474_2099_3067 | 322 |
| 340 | 3300035171 | Ga0373946_0044900 | Ga0373946_0044900_734_1702 | 322 |
| 341 | 3300035172 | Ga0373955_0010260 | Ga0373955_0010260_2665_3633 | 322 |
| 342 | 3300035172 | Ga0373955_0046504 | Ga0373955_0046504_182_1150 | 322 |
| 343 | 3300035410 | Ga0373924_0013014 | Ga0373924_0013014_1577_2545 | 322 |
| 344 | 3300035692 | Ga0373935_0139718 | Ga0373935_0139718_22_990 | 322 |
| 345 | 3300035724 | Ga0373933_0048030 | Ga0373933_0048030_1438_2406 | 322 |
| 346 | 3300035724 | Ga0373933_0188118 | Ga0373933_0188118_38_1006 | 322 |
| 347 | 3300036401 | Ga0373937_0002840 | Ga0373937_0002840_5629_6597 | 322 |
| 348 | 3300036401 | Ga0373937_0041616 | Ga0373937_0041616_994_1962 | 322 |
| 349 | 3300036401 | Ga0373937_0124952 | Ga0373937_0124952_1262_2230 | 322 |
| 350 | 3300037068 | Ga0373925_0030571 | Ga0373925_0030571_1487_2455 | 322 |
| 351 | 3300037068 | Ga0373925_0055717 | Ga0373925_0055717_514_1482 | 322 |
| 352 | 3300037068 | Ga0373925_0080038 | Ga0373925_0080038_91_1059 | 322 |
| 353 | 3300037068 | Ga0373925_0415271 | Ga0373925_0415271_53_1021 | 322 |
| 354 | 3300044694 | Ga0466963_0132197 | Ga0466963_0132197_44_1012 | 322 |
| 355 | 3300044694 | Ga0466963_0152655 | Ga0466963_0152655_104_1072 | 322 |
| 356 | 3300044735 | Ga0466968_0093500 | Ga0466968_0093500_240_1208 | 322 |
| 357 | 3300044842 | Ga0466957_0068672 | Ga0466957_0068672_1065_2033 | 322 |
| 358 | 3300045836 | Ga0466958_0134980 | Ga0466958_0134980_420_1388 | 322 |
| 359 | 3300046454 | Ga0495592_0082251 | Ga0495592_0082251_1100_2068 | 322 |
| 360 | 3300046454 | Ga0495592_0126673 | Ga0495592_0126673_636_1604 | 322 |
| 361 | 3300046459 | Ga0495629_0000833 | Ga0495629_0000833_5821_6789 | 322 |
| 362 | 3300046462 | Ga0495651_0002846 | Ga0495651_0002846_9329_10297 | 322 |
| 363 | 3300046462 | Ga0495651_0048475 | Ga0495651_0048475_1863_2831 | 322 |
| 364 | 3300046463 | Ga0495653_0008849 | Ga0495653_0008849_1022_1990 | 322 |
| 365 | 3300046463 | Ga0495653_0125417 | Ga0495653_0125417_655_1623 | 322 |
| 366 | 3300046473 | Ga0495582_0010310 | Ga0495582_0010310_2757_3725 | 322 |
| 367 | 3300046476 | Ga0495662_0043248 | Ga0495662_0043248_507_1475 | 322 |
| 368 | 3300046511 | Ga0495608_0002213 | Ga0495608_0002213_11617_12585 | 322 |
| 369 | 3300046514 | Ga0495618_0028444 | Ga0495618_0028444_1345_2313 | 322 |
| 370 | 3300046514 | Ga0495618_0040465 | Ga0495618_0040465_260_1228 | 322 |
| 371 | 3300046516 | Ga0495628_0053682 | Ga0495628_0053682_999_1967 | 322 |
| 372 | 3300046516 | Ga0495628_0054758 | Ga0495628_0054758_1209_2177 | 322 |
| 373 | 3300046517 | Ga0495630_0156685 | Ga0495630_0156685_31_999 | 322 |
| 374 | 3300046526 | Ga0495666_0037652 | Ga0495666_0037652_1165_2172 | 322 |
| 375 | 3300046529 | Ga0495652_0017137 | Ga0495652_0017137_3453_4421 | 322 |
| 376 | 3300046529 | Ga0495652_0060716 | Ga0495652_0060716_544_1512 | 322 |
| 377 | 3300046529 | Ga0495652_0174315 | Ga0495652_0174315_518_1486 | 322 |
| 378 | 3300046533 | Ga0495640_0008096 | Ga0495640_0008096_4980_5948 | 322 |
| 379 | 3300046533 | Ga0495640_0031765 | Ga0495640_0031765_2706_3674 | 322 |
| 380 | 3300046536 | Ga0495587_0016048 | Ga0495587_0016048_350_1318 | 322 |
| 381 | 3300046543 | Ga0495645_0114908 | Ga0495645_0114908_647_1615 | 322 |
| 382 | 3300046559 | Ga0495667_0001558 | Ga0495667_0001558_846_1814 | 322 |
| 383 | 3300046559 | Ga0495667_0021361 | Ga0495667_0021361_3274_4242 | 322 |
| 384 | 3300046559 | Ga0495667_0028275 | Ga0495667_0028275_2478_3446 | 322 |
| 385 | 3300046663 | Ga0495635_0002448 | Ga0495635_0002448_4633_5601 | 322 |
| 386 | 3300046675 | Ga0495657_0006601 | Ga0495657_0006601_4941_5909 | 322 |
| 387 | 3300046678 | Ga0495599_0144204 | Ga0495599_0144204_282_1250 | 322 |
| 388 | 3300046680 | Ga0495646_0017382 | Ga0495646_0017382_1668_2636 | 322 |
| 389 | 3300046681 | Ga0495647_0103931 | Ga0495647_0103931_191_1159 | 322 |
| 390 | 3300046683 | Ga0495658_0047487 | Ga0495658_0047487_778_1749 | 322 |
| 391 | 3300046689 | Ga0495613_0082259 | Ga0495613_0082259_910_1878 | 322 |
| 392 | 3300046690 | Ga0495624_0034215 | Ga0495624_0034215_1854_2822 | 322 |
| 393 | 3300046809 | Ga0495600_0011476 | Ga0495600_0011476_3921_4889 | 322 |
| 394 | 3300047317 | Ga0495604_0009903 | Ga0495604_0009903_5485_6453 | 322 |
| 395 | 3300047317 | Ga0495604_0117829 | Ga0495604_0117829_95_1063 | 322 |
| 396 | 3300047319 | Ga0495674_0006976 | Ga0495674_0006976_5585_6553 | 322 |
| 397 | 3300047319 | Ga0495674_0038984 | Ga0495674_0038984_3127_4095 | 322 |
| 398 | 3300047321 | Ga0495676_0052369 | Ga0495676_0052369_58_1026 | 322 |
| 399 | 3300047322 | Ga0495680_0001471 | Ga0495680_0001471_7389_8357 | 322 |
| 400 | 3300047322 | Ga0495680_0002413 | Ga0495680_0002413_15930_16898 | 322 |
| 401 | 3300047322 | Ga0495680_0008463 | Ga0495680_0008463_7755_8723 | 322 |
| 402 | 3300047322 | Ga0495680_0127466 | Ga0495680_0127466_227_1195 | 322 |
| 403 | 3300047444 | Ga0495675_0031844 | Ga0495675_0031844_1751_2719 | 322 |
| 404 | 3300047444 | Ga0495675_0164927 | Ga0495675_0164927_342_1310 | 322 |
| 405 | 3300047471 | Ga0495684_0014821 | Ga0495684_0014821_1407_2375 | 322 |
| 406 | 3300047471 | Ga0495684_0114706 | Ga0495684_0114706_184_1152 | 322 |
| 407 | 3300047673 | Ga0495593_0010695 | Ga0495593_0010695_3472_4440 | 322 |
| 408 | 3300048088 | Ga0495602_0033825 | Ga0495602_0033825_2195_3163 | 322 |
| 409 | 3300048088 | Ga0495602_0153040 | Ga0495602_0153040_734_1702 | 322 |
| 410 | 3300048088 | Ga0495602_0300229 | Ga0495602_0300229_158_1126 | 322 |
| 411 | 3300049569 | Ga0501032_0080904 | Ga0501032_0080904_718_1686 | 322 |
| 412 | 3300049571 | Ga0501034_0005678 | Ga0501034_0005678_8695_9663 | 322 |
| 413 | 3300049572 | Ga0501036_0015195 | Ga0501036_0015195_3704_4672 | 322 |
| 414 | 3300049574 | Ga0501038_0024602 | Ga0501038_0024602_3379_4347 | 322 |
| 415 | 3300049575 | Ga0501039_0065616 | Ga0501039_0065616_869_1837 | 322 |
| 416 | 3300049579 | Ga0501043_0008422 | Ga0501043_0008422_2694_3662 | 322 |
| 417 | 3300049580 | Ga0501046_0346964 | Ga0501046_0346964_21_989 | 322 |
| 418 | 3300049581 | Ga0501047_0230820 | Ga0501047_0230820_522_1490 | 322 |
| 419 | 3300049823 | Ga0501044_0016021 | Ga0501044_0016021_3918_4886 | 322 |
| 420 | 3300050513 | nmdc:mga0rr50_204446_c1 | nmdc:mga0rr50_204446_c1_547_1515 | 322 |
| 421 | 3300053077 | Ga0495601_0044595 | Ga0495601_0044595_1326_2294 | 322 |
| 422 | 3300053078 | Ga0495612_0013607 | Ga0495612_0013607_590_1558 | 322 |
| 423 | 3300053084 | Ga0495595_0008547 | Ga0495595_0008547_1870_2838 | 322 |
| 424 | 3300053085 | Ga0495619_0023859 | Ga0495619_0023859_1315_2283 | 322 |
| 425 | 3300053085 | Ga0495619_0043442 | Ga0495619_0043442_841_1809 | 322 |
| 426 | iso_pu_bacteria | 2784746763 | 2785338948 | 323 |
| 427 | 3300009093 | Ga0105240_10056625 | Ga0105240_100566254 | 324 |
| 428 | 3300010375 | Ga0105239_10024363 | Ga0105239_100243634 | 324 |
| 429 | 3300025913 | Ga0207695_10053990 | Ga0207695_100539904 | 324 |
| 430 | 3300026078 | Ga0207702_10005898 | Ga0207702_100058985 | 324 |
| 431 | iso_pu_bacteria | 2862382967 | 2862387045 | 325 |
| 432 | iso_pu_bacteria | 8008558824 | 8008560447 | 325 |
| 433 | 3300038443 | Ga0395901_0140690 | Ga0395901_0140690_139_1122 | 327 |
| 434 | iso_pu_bacteria | 2738543034 | 2739363483 | 327 |
| 435 | iso_pu_bacteria | 8048406513 | 8048408701 | 327 |
| 436 | 3300045976 | Ga0466967_0024490 | Ga0466967_0024490_1456_2451 | 328 |
| 437 | 3300044656 | Ga0466969_0008037 | Ga0466969_0008037_2779_3768 | 329 |
| 438 | 3300044684 | Ga0466966_0001156 | Ga0466966_0001156_5224_6213 | 329 |
| 439 | 3300044719 | Ga0466971_0001070 | Ga0466971_0001070_4956_5945 | 329 |
| 440 | 3300061719 | Ga0466962_0002590 | Ga0466962_0002590_4972_5961 | 329 |
| 441 | iso_pu_bacteria | 2547132424 | 2548695162 | 329 |
| 442 | 3300009098 | Ga0105245_10025969 | Ga0105245_100259695 | 330 |
| 443 | 3300010375 | Ga0105239_10109146 | Ga0105239_101091462 | 330 |
| 444 | 3300025899 | Ga0207642_10015743 | Ga0207642_100157432 | 330 |
| 445 | 3300025927 | Ga0207687_10009296 | Ga0207687_100092965 | 330 |
| 446 | 3300001989 | JGI24739J22299_10021259 | JGI24739J22299_100212592 | 331 |
| 447 | 3300002073 | JGI24745J21846_1001714 | JGI24745J21846_10017142 | 331 |
| 448 | 3300002077 | JGI24744J21845_10000214 | JGI24744J21845_100002141 | 331 |
| 449 | 3300002244 | JGI24742J22300_10005898 | JGI24742J22300_100058982 | 331 |
| 450 | 3300005330 | Ga0070690_100051518 | Ga0070690_1000515182 | 331 |
| 451 | 3300005340 | Ga0070689_100076306 | Ga0070689_1000763061 | 331 |
| 452 | 3300005347 | Ga0070668_100288935 | Ga0070668_1002889351 | 331 |
| 453 | 3300005356 | Ga0070674_100054217 | Ga0070674_1000542172 | 331 |
| 454 | 3300005366 | Ga0070659_100290470 | Ga0070659_1002904701 | 331 |
| 455 | 3300005434 | Ga0070709_10002658 | Ga0070709_1000265810 | 331 |
| 456 | 3300005439 | Ga0070711_100157550 | Ga0070711_1001575502 | 331 |
| 457 | 3300005441 | Ga0070700_100010564 | Ga0070700_1000105642 | 331 |
| 458 | 3300005445 | Ga0070708_100380935 | Ga0070708_1003809352 | 331 |
| 459 | 3300005455 | Ga0070663_100131412 | Ga0070663_1001314122 | 331 |
| 460 | 3300005456 | Ga0070678_100007402 | Ga0070678_1000074021 | 331 |
| 461 | 3300005459 | Ga0068867_100028304 | Ga0068867_1000283044 | 331 |
| 462 | 3300005543 | Ga0070672_100125728 | Ga0070672_1001257282 | 331 |
| 463 | 3300005546 | Ga0070696_100203662 | Ga0070696_1002036622 | 331 |
| 464 | 3300005549 | Ga0070704_100013524 | Ga0070704_1000135246 | 331 |
| 465 | 3300005615 | Ga0070702_100014720 | Ga0070702_1000147202 | 331 |
| 466 | 3300005842 | Ga0068858_100278544 | Ga0068858_1002785442 | 331 |
| 467 | 3300005844 | Ga0068862_100367355 | Ga0068862_1003673551 | 331 |
| 468 | 3300006163 | Ga0070715_10031756 | Ga0070715_100317562 | 331 |
| 469 | 3300006186 | Ga0075369_10004313 | Ga0075369_100043134 | 331 |
| 470 | 3300006237 | Ga0097621_100013389 | Ga0097621_1000133893 | 331 |
| 471 | 3300006358 | Ga0068871_100159858 | Ga0068871_1001598582 | 331 |
| 472 | 3300006881 | Ga0068865_100004759 | Ga0068865_10000475910 | 331 |
| 473 | 3300009098 | Ga0105245_10105220 | Ga0105245_101052202 | 331 |
| 474 | 3300009101 | Ga0105247_10056817 | Ga0105247_100568172 | 331 |
| 475 | 3300009148 | Ga0105243_10095716 | Ga0105243_100957162 | 331 |
| 476 | 3300009177 | Ga0105248_10265765 | Ga0105248_102657652 | 331 |
| 477 | 3300009545 | Ga0105237_10315820 | Ga0105237_103158202 | 331 |
| 478 | 3300009545 | Ga0105237_10422804 | Ga0105237_104228042 | 331 |
| 479 | 3300009553 | Ga0105249_10146861 | Ga0105249_101468612 | 331 |
| 480 | 3300010375 | Ga0105239_10038218 | Ga0105239_100382182 | 331 |
| 481 | 3300013105 | Ga0157369_10350668 | Ga0157369_103506682 | 331 |
| 482 | 3300013297 | Ga0157378_10361859 | Ga0157378_103618592 | 331 |
| 483 | 3300013307 | Ga0157372_10025001 | Ga0157372_100250013 | 331 |
| 484 | 3300013308 | Ga0157375_10080366 | Ga0157375_100803664 | 331 |
| 485 | 3300014325 | Ga0163163_10299067 | Ga0163163_102990672 | 331 |
| 486 | 3300014968 | Ga0157379_10104922 | Ga0157379_101049222 | 331 |
| 487 | 3300017792 | Ga0163161_10027335 | Ga0163161_100273354 | 331 |
| 488 | 3300025885 | Ga0207653_10021709 | Ga0207653_100217092 | 331 |
| 489 | 3300025898 | Ga0207692_10087651 | Ga0207692_100876512 | 331 |
| 490 | 3300025900 | Ga0207710_10018144 | Ga0207710_100181442 | 331 |
| 491 | 3300025901 | Ga0207688_10054315 | Ga0207688_100543152 | 331 |
| 492 | 3300025901 | Ga0207688_10059170 | Ga0207688_100591702 | 331 |
| 493 | 3300025903 | Ga0207680_10057681 | Ga0207680_100576812 | 331 |
| 494 | 3300025907 | Ga0207645_10006008 | Ga0207645_100060088 | 331 |
| 495 | 3300025911 | Ga0207654_10024231 | Ga0207654_100242314 | 331 |
| 496 | 3300025914 | Ga0207671_10014463 | Ga0207671_100144635 | 331 |
| 497 | 3300025915 | Ga0207693_10005274 | Ga0207693_100052742 | 331 |
| 498 | 3300025916 | Ga0207663_10037153 | Ga0207663_100371533 | 331 |
| 499 | 3300025916 | Ga0207663_10158364 | Ga0207663_101583641 | 331 |
| 500 | 3300025918 | Ga0207662_10022858 | Ga0207662_100228583 | 331 |
| 501 | 3300025919 | Ga0207657_10040850 | Ga0207657_100408503 | 331 |
| 502 | 3300025922 | Ga0207646_10030324 | Ga0207646_100303242 | 331 |
| 503 | 3300025924 | Ga0207694_10303173 | Ga0207694_103031732 | 331 |
| 504 | 3300025926 | Ga0207659_10158253 | Ga0207659_101582532 | 331 |
| 505 | 3300025927 | Ga0207687_10002019 | Ga0207687_1000201911 | 331 |
| 506 | 3300025932 | Ga0207690_10033566 | Ga0207690_100335662 | 331 |
| 507 | 3300025934 | Ga0207686_10003225 | Ga0207686_100032252 | 331 |
| 508 | 3300025936 | Ga0207670_10014471 | Ga0207670_100144713 | 331 |
| 509 | 3300025937 | Ga0207669_10001321 | Ga0207669_100013216 | 331 |
| 510 | 3300025938 | Ga0207704_10002679 | Ga0207704_100026793 | 331 |
| 511 | 3300025941 | Ga0207711_10055152 | Ga0207711_100551524 | 331 |
| 512 | 3300025942 | Ga0207689_10036830 | Ga0207689_100368302 | 331 |
| 513 | 3300025981 | Ga0207640_10007110 | Ga0207640_100071105 | 331 |
| 514 | 3300026023 | Ga0207677_10054186 | Ga0207677_100541862 | 331 |
| 515 | 3300026041 | Ga0207639_10045451 | Ga0207639_100454514 | 331 |
| 516 | 3300026067 | Ga0207678_10062430 | Ga0207678_100624302 | 331 |
| 517 | 3300026075 | Ga0207708_10024554 | Ga0207708_100245542 | 331 |
| 518 | 3300026075 | Ga0207708_10253639 | Ga0207708_102536392 | 331 |
| 519 | 3300026089 | Ga0207648_10002868 | Ga0207648_1000286816 | 331 |
| 520 | 3300026118 | Ga0207675_100078752 | Ga0207675_1000787524 | 331 |
| 521 | 3300026121 | Ga0207683_10007428 | Ga0207683_100074282 | 331 |
| 522 | 3300026121 | Ga0207683_10007593 | Ga0207683_1000759311 | 331 |
| 523 | 3300028381 | Ga0268264_10030845 | Ga0268264_100308452 | 331 |
| 524 | 3300042014 | Ga0439457_000234 | Ga0439457_000234_6732_7733 | 331 |
| 525 | 3300042133 | Ga0450896_000211 | Ga0450896_000211_3501_4502 | 331 |
| 526 | 3300042134 | Ga0450898_003950 | Ga0450898_003950_121_1122 | 331 |
| 527 | 3300042135 | Ga0450899_001537 | Ga0450899_001537_1423_2424 | 331 |
| 528 | 3300044658 | Ga0466972_0007332 | Ga0466972_0007332_4116_5111 | 331 |
| 529 | 3300044683 | Ga0466965_0038183 | Ga0466965_0038183_1214_2209 | 331 |
| 530 | 3300044684 | Ga0466966_0151062 | Ga0466966_0151062_398_1393 | 331 |
| 531 | 3300044694 | Ga0466963_0015911 | Ga0466963_0015911_1737_2732 | 331 |
| 532 | 3300044719 | Ga0466971_0004300 | Ga0466971_0004300_2169_3164 | 331 |
| 533 | 3300044765 | Ga0466970_0001368 | Ga0466970_0001368_1737_2732 | 331 |
| 534 | 3300044842 | Ga0466957_0000029 | Ga0466957_0000029_11952_12947 | 331 |
| 535 | 3300045836 | Ga0466958_0014944 | Ga0466958_0014944_105_1100 | 331 |
| 536 | 3300048907 | Ga0496104_0079745 | Ga0496104_0079745_1680_2675 | 331 |
| 537 | 3300048908 | Ga0496105_0041668 | Ga0496105_0041668_2763_3758 | 331 |
| 538 | 3300048911 | Ga0496108_0021210 | Ga0496108_0021210_2189_3184 | 331 |
| 539 | 3300048915 | Ga0496112_0380097 | Ga0496112_0380097_192_1187 | 331 |
| 540 | 3300048916 | Ga0496113_0163825 | Ga0496113_0163825_222_1217 | 331 |
| 541 | 3300048917 | Ga0496114_0223705 | Ga0496114_0223705_151_1146 | 331 |
| 542 | 3300048918 | Ga0496115_0005891 | Ga0496115_0005891_2191_3186 | 331 |
| 543 | 3300061719 | Ga0466962_0000570 | Ga0466962_0000570_11745_12740 | 331 |
| 544 | iso_pu_bacteria | 2773857922 | 2774852447 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y0k-assembly1.cif.gz_A | structure of crotonyl-coa carboxylase/reductase ante in complex with nadp | 0.9134 | 2 | 321 |
| 6n7l-assembly3.cif.gz_K | crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 | 0.9134 | 2 | 324 |
| 4y1b-assembly1.cif.gz_A | structure of crotonyl-coa carboxylase/reductase ante v350a in complex with nadp | 0.9127 | 2 | 321 |
| 2eih-assembly1.cif.gz_A | crystal structure of nad-dependent alcohol dehydrogenase | 0.9094 | 1 | 321 |
| 1llu-assembly1.cif.gz_A | the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate | 0.9086 | 2 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O74489_128_266_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9484 | 145 | 268 | 3.40.50.720 |
| af_Q3UNZ8_155_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9286 | 148 | 265 | 3.40.50.720 |
| af_A0A286Y901_130_273_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9258 | 137 | 269 | 3.40.50.720 |
| 4rvuB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9228 | 141 | 268 | 3.40.50.720 |
| 3krtB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.92 | 152 | 269 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6BV53-F1-model_v4 | Zinc-binding dehydrogenase | 0.9918 | 1 | 321 |
GO:0016491
|
| AF-A0A6L6BV53-F1-model_v4 | Zinc-binding dehydrogenase | 0.9857 | 1 | 321 |
GO:0016491
|
| AF-A0A4R4T618-F1-model_v4 | Zn-dependent oxidoreductase | 0.9823 | 158 | 324 |
|
| AF-A0A4R4T618-F1-model_v4 | Zn-dependent oxidoreductase | 0.9765 | 158 | 324 |
|
| AF-A0A4R5L2Q3-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9692 | 170 | 320 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar