F461592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 543 | 333 | 1086 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100001919|Ga0070696_10000191912 |
| Length | 329 |
| Sequence | MSSPHVPDPAAEPQAADGPVAGAAGERGHGELRPAAQELPGFRHMYSGKVRDLYAPLTATGDVDPTRLLLVATDRISAYDHVLPTPIPDKGRVLTQMSLWWFSQLADLVPNHVLSTDVPDEVAGRAVLVRRLHMVPVECVARGYLAGSGLVEYRASGTVCGVPLPPGLTDGSRLDAPIFTPATKAELGEHDENVTFEQVADVVGADLAEELRRLTLAVYARGEQLARDRGILLADTKIELGRDDDGRILLGDEVLTPDSSRFWPAAHWAPGGPQASYDKQFVRDWLTSPASGWDRSSDAPPPPLPDDVVERTRAKYLEAYETLTGQRLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 151 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 152 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 161 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 162 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 164 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 165 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 170 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 253 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 301 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 302 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 304 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 305 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 310 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 312 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 314 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 319 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 320 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 321 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 322 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 323 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 324 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 325 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 326 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 327 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 328 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 329 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 330 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 331 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 332 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 333 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.95 |
| Metatranscriptomes | 1.29 |
| Isolates | 2.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.16 |
| Nodule | 0 |
| Rhizoplane | 6.63 |
| Rhizosphere | 82.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070696_100001919 | 3300005546 | Bacteria | 13686 |
| 2 | JGI24739J22299_10025304 | 3300001989 | Bacteria | 2088 |
| 3 | Ga0007423J48922_100946 | 3300003285 | Bacteria | 4331 |
| 4 | Ga0006562J51391_1095070 | 3300003578 | Bacteria | 10857 |
| 5 | Ga0070683_100346513 | 3300005329 | Bacteria | 1415 |
| 6 | Ga0070670_100023044 | 3300005331 | Bacteria | 5357 |
| 7 | Ga0068869_100015673 | 3300005334 | Bacteria | 5091 |
| 8 | Ga0070666_10217047 | 3300005335 | Bacteria | 1348 |
| 9 | Ga0070680_100023257 | 3300005336 | Bacteria | 4941 |
| 10 | Ga0070682_100053264 | 3300005337 | Bacteria | 2535 |
| 11 | Ga0070660_100245698 | 3300005339 | Bacteria | 1458 |
| 12 | Ga0070691_10020214 | 3300005341 | Bacteria | 3076 |
| 13 | Ga0070691_10085573 | 3300005341 | Bacteria | 1549 |
| 14 | Ga0070687_100094551 | 3300005343 | Bacteria | 1660 |
| 15 | Ga0070661_100267314 | 3300005344 | Bacteria | 1323 |
| 16 | Ga0070692_10007495 | 3300005345 | Bacteria | 4807 |
| 17 | Ga0070675_100054631 | 3300005354 | Bacteria | 3286 |
| 18 | Ga0070671_100013399 | 3300005355 | Bacteria | 6610 |
| 19 | Ga0070671_100079304 | 3300005355 | Bacteria | 2744 |
| 20 | Ga0070674_100359123 | 3300005356 | Bacteria | 1179 |
| 21 | Ga0070673_100046604 | 3300005364 | Bacteria | 3369 |
| 22 | Ga0070688_100050167 | 3300005365 | Bacteria | 2599 |
| 23 | Ga0070659_100000776 | 3300005366 | Bacteria | 23181 |
| 24 | Ga0070659_100250635 | 3300005366 | Bacteria | 1467 |
| 25 | Ga0070709_10055727 | 3300005434 | Bacteria | 2497 |
| 26 | Ga0070714_100042183 | 3300005435 | Bacteria | 3853 |
| 27 | Ga0070713_100085194 | 3300005436 | Bacteria | 2706 |
| 28 | Ga0070700_100000041 | 3300005441 | Bacteria | 103180 |
| 29 | Ga0070700_100024524 | 3300005441 | Bacteria | 3542 |
| 30 | Ga0070663_100016366 | 3300005455 | Bacteria | 4814 |
| 31 | Ga0070678_100009289 | 3300005456 | Bacteria | 5947 |
| 32 | Ga0070681_10053707 | 3300005458 | Bacteria | 4015 |
| 33 | Ga0070681_10665799 | 3300005458 | Bacteria | 956 |
| 34 | Ga0068867_100254672 | 3300005459 | Bacteria | 1429 |
| 35 | Ga0070707_100018432 | 3300005468 | Bacteria | 6567 |
| 36 | Ga0070707_100268084 | 3300005468 | Bacteria | 1660 |
| 37 | Ga0070698_100376992 | 3300005471 | Bacteria | 1351 |
| 38 | Ga0070679_100015511 | 3300005530 | Bacteria | 7322 |
| 39 | Ga0070679_100260448 | 3300005530 | Bacteria | 1689 |
| 40 | Ga0070679_100272139 | 3300005530 | Bacteria | 1648 |
| 41 | Ga0070679_100297180 | 3300005530 | Bacteria | 1566 |
| 42 | Ga0070679_100410057 | 3300005530 | Bacteria | 1300 |
| 43 | Ga0070684_100190771 | 3300005535 | Bacteria | 1865 |
| 44 | Ga0068853_100091000 | 3300005539 | Bacteria | 2682 |
| 45 | Ga0070693_100010114 | 3300005547 | Bacteria | 4711 |
| 46 | Ga0070665_100025044 | 3300005548 | Bacteria | 6015 |
| 47 | Ga0070665_100027824 | 3300005548 | Bacteria | 5693 |
| 48 | Ga0068855_100005398 | 3300005563 | Bacteria | 15594 |
| 49 | Ga0068855_100006885 | 3300005563 | Bacteria | 13788 |
| 50 | Ga0068855_100013946 | 3300005563 | Bacteria | 9692 |
| 51 | Ga0068855_100106710 | 3300005563 | Bacteria | 3218 |
| 52 | Ga0068855_100147084 | 3300005563 | Bacteria | 2681 |
| 53 | Ga0068857_100298661 | 3300005577 | Bacteria | 1484 |
| 54 | Ga0068854_100001179 | 3300005578 | Bacteria | 15661 |
| 55 | Ga0068854_100296071 | 3300005578 | Bacteria | 1307 |
| 56 | Ga0068856_100011963 | 3300005614 | Bacteria | 8402 |
| 57 | Ga0068856_100071920 | 3300005614 | Bacteria | 3424 |
| 58 | Ga0068856_100379619 | 3300005614 | Bacteria | 1432 |
| 59 | Ga0070702_100001566 | 3300005615 | Bacteria | 9430 |
| 60 | Ga0070702_100196042 | 3300005615 | Bacteria | 1333 |
| 61 | Ga0068852_100002958 | 3300005616 | Bacteria | 11804 |
| 62 | Ga0068852_100093028 | 3300005616 | Bacteria | 2701 |
| 63 | Ga0068852_100165000 | 3300005616 | Bacteria | 2072 |
| 64 | Ga0068859_100018321 | 3300005617 | Bacteria | 7039 |
| 65 | Ga0068864_100129380 | 3300005618 | Bacteria | 2266 |
| 66 | Ga0068851_10012570 | 3300005834 | Bacteria | 3993 |
| 67 | Ga0068870_10000054 | 3300005840 | Bacteria | 36323 |
| 68 | Ga0068863_100047685 | 3300005841 | Bacteria | 4063 |
| 69 | Ga0068863_100358771 | 3300005841 | Bacteria | 1421 |
| 70 | Ga0068862_100321550 | 3300005844 | Bacteria | 1428 |
| 71 | Ga0075365_10001930 | 3300006038 | Bacteria | 9787 |
| 72 | Ga0075365_10010544 | 3300006038 | Bacteria | 5387 |
| 73 | Ga0075365_10040239 | 3300006038 | Bacteria | 3048 |
| 74 | Ga0075365_10080411 | 3300006038 | Bacteria | 2207 |
| 75 | Ga0075364_10151181 | 3300006051 | Bacteria | 1565 |
| 76 | Ga0075432_10012177 | 3300006058 | Bacteria | 2924 |
| 77 | Ga0070716_100163066 | 3300006173 | Bacteria | 1446 |
| 78 | Ga0075367_10006525 | 3300006178 | Bacteria | 5901 |
| 79 | Ga0097621_100011796 | 3300006237 | Bacteria | 6454 |
| 80 | Ga0068871_100040482 | 3300006358 | Bacteria | 3732 |
| 81 | Ga0068871_100066171 | 3300006358 | Bacteria | 2962 |
| 82 | Ga0075433_10021009 | 3300006852 | Bacteria | 5468 |
| 83 | Ga0075434_100034189 | 3300006871 | Bacteria | 5019 |
| 84 | Ga0075434_100081793 | 3300006871 | Bacteria | 3226 |
| 85 | Ga0068865_100452318 | 3300006881 | Bacteria | 1062 |
| 86 | Ga0075436_100009759 | 3300006914 | Bacteria | 6568 |
| 87 | Ga0097620_100018321 | 3300006931 | Bacteria | 7039 |
| 88 | Ga0075435_100000557 | 3300007076 | Bacteria | 22898 |
| 89 | Ga0075435_100353561 | 3300007076 | Bacteria | 1260 |
| 90 | Ga0105240_10010994 | 3300009093 | Bacteria | 12673 |
| 91 | Ga0105240_10178705 | 3300009093 | Bacteria | 2506 |
| 92 | Ga0105240_10202689 | 3300009093 | Bacteria | 2324 |
| 93 | Ga0111539_10059203 | 3300009094 | Bacteria | 4543 |
| 94 | Ga0105245_10060995 | 3300009098 | Bacteria | 3398 |
| 95 | Ga0105245_10072445 | 3300009098 | Bacteria | 3130 |
| 96 | Ga0105245_10141687 | 3300009098 | Bacteria | 2265 |
| 97 | Ga0105247_10068025 | 3300009101 | Bacteria | 2220 |
| 98 | Ga0114129_10154336 | 3300009147 | Bacteria | 3141 |
| 99 | Ga0105243_10152643 | 3300009148 | Bacteria | 1983 |
| 100 | Ga0105241_10005686 | 3300009174 | Bacteria | 9203 |
| 101 | Ga0105241_10070753 | 3300009174 | Bacteria | 2707 |
| 102 | Ga0105241_10102848 | 3300009174 | Bacteria | 2274 |
| 103 | Ga0105242_10104733 | 3300009176 | Bacteria | 2402 |
| 104 | Ga0105242_10208391 | 3300009176 | Bacteria | 1740 |
| 105 | Ga0105248_10191857 | 3300009177 | Bacteria | 2302 |
| 106 | Ga0105237_10056552 | 3300009545 | Bacteria | 3926 |
| 107 | Ga0105237_10056940 | 3300009545 | Bacteria | 3912 |
| 108 | Ga0105237_10069518 | 3300009545 | Bacteria | 3517 |
| 109 | Ga0105237_10345786 | 3300009545 | Bacteria | 1491 |
| 110 | Ga0105238_10002139 | 3300009551 | Bacteria | 19954 |
| 111 | Ga0105249_10624876 | 3300009553 | Bacteria | 1133 |
| 112 | Ga0105239_10043428 | 3300010375 | Bacteria | 4927 |
| 113 | Ga0105239_10127054 | 3300010375 | Bacteria | 2835 |
| 114 | Ga0105239_10437644 | 3300010375 | Bacteria | 1482 |
| 115 | Ga0105246_10018883 | 3300011119 | Bacteria | 4397 |
| 116 | Ga0105246_10340137 | 3300011119 | Bacteria | 1226 |
| 117 | Ga0157373_10033532 | 3300013100 | Bacteria | 3693 |
| 118 | Ga0157370_10004912 | 3300013104 | Bacteria | 15148 |
| 119 | Ga0157370_10035549 | 3300013104 | Bacteria | 4841 |
| 120 | Ga0157369_10007361 | 3300013105 | Bacteria | 12674 |
| 121 | Ga0157369_10319661 | 3300013105 | Bacteria | 1614 |
| 122 | Ga0157369_10406048 | 3300013105 | Bacteria | 1413 |
| 123 | Ga0157374_10122184 | 3300013296 | Bacteria | 2514 |
| 124 | Ga0157374_10229437 | 3300013296 | Bacteria | 1823 |
| 125 | Ga0157378_10027006 | 3300013297 | Bacteria | 5064 |
| 126 | Ga0157372_10017717 | 3300013307 | Bacteria | 7647 |
| 127 | Ga0157372_10428251 | 3300013307 | Bacteria | 1542 |
| 128 | Ga0157375_10022174 | 3300013308 | Bacteria | 5842 |
| 129 | Ga0157375_10040586 | 3300013308 | Bacteria | 4488 |
| 130 | Ga0157375_10311765 | 3300013308 | Bacteria | 1738 |
| 131 | Ga0163163_10180850 | 3300014325 | Bacteria | 2156 |
| 132 | Ga0163163_10228523 | 3300014325 | Bacteria | 1909 |
| 133 | Ga0157380_10135373 | 3300014326 | Bacteria | 2108 |
| 134 | Ga0182008_10020326 | 3300014497 | Bacteria | 3421 |
| 135 | Ga0157377_10107980 | 3300014745 | Bacteria | 1669 |
| 136 | Ga0157379_10027362 | 3300014968 | Bacteria | 5077 |
| 137 | Ga0157379_10038490 | 3300014968 | Bacteria | 4267 |
| 138 | Ga0157376_10004667 | 3300014969 | Bacteria | 9551 |
| 139 | Ga0157376_10052486 | 3300014969 | Bacteria | 3390 |
| 140 | Ga0206356_10599629 | 3300020070 | Bacteria | 1455 |
| 141 | Ga0206353_10070396 | 3300020082 | Bacteria | 2121 |
| 142 | Ga0206353_11172701 | 3300020082 | Bacteria | 1502 |
| 143 | Ga0224712_10001001 | 3300022467 | Bacteria | 6159 |
| 144 | Ga0224712_10090096 | 3300022467 | Bacteria | 1283 |
| 145 | Ga0209646_1000202 | 3300025246 | Bacteria | 70943 |
| 146 | Ga0207656_10001680 | 3300025321 | Bacteria | 7350 |
| 147 | Ga0207692_10000253 | 3300025898 | Bacteria | 18328 |
| 148 | Ga0207680_10034849 | 3300025903 | Bacteria | 2883 |
| 149 | Ga0207647_10006126 | 3300025904 | Bacteria | 8765 |
| 150 | Ga0207685_10091123 | 3300025905 | Bacteria | 1284 |
| 151 | Ga0207699_10063591 | 3300025906 | Bacteria | 2230 |
| 152 | Ga0207645_10012844 | 3300025907 | Bacteria | 5669 |
| 153 | Ga0207643_10000972 | 3300025908 | Bacteria | 17234 |
| 154 | Ga0207705_10073393 | 3300025909 | Bacteria | 2482 |
| 155 | Ga0207654_10002485 | 3300025911 | Bacteria | 9366 |
| 156 | Ga0207654_10050757 | 3300025911 | Bacteria | 2385 |
| 157 | Ga0207654_10260567 | 3300025911 | Bacteria | 1165 |
| 158 | Ga0207695_10002209 | 3300025913 | Bacteria | 29277 |
| 159 | Ga0207695_10119295 | 3300025913 | Bacteria | 2608 |
| 160 | Ga0207671_10000910 | 3300025914 | Bacteria | 37314 |
| 161 | Ga0207671_10059215 | 3300025914 | Bacteria | 2840 |
| 162 | Ga0207693_10118089 | 3300025915 | Bacteria | 2083 |
| 163 | Ga0207693_10265739 | 3300025915 | Bacteria | 1345 |
| 164 | Ga0207663_10239926 | 3300025916 | Bacteria | 1329 |
| 165 | Ga0207660_10075793 | 3300025917 | Bacteria | 2458 |
| 166 | Ga0207649_10133119 | 3300025920 | Bacteria | 1691 |
| 167 | Ga0207652_10015663 | 3300025921 | Bacteria | 6172 |
| 168 | Ga0207652_10235824 | 3300025921 | Bacteria | 1649 |
| 169 | Ga0207652_10307457 | 3300025921 | Bacteria | 1431 |
| 170 | Ga0207646_10025655 | 3300025922 | Bacteria | 5390 |
| 171 | Ga0207646_10072870 | 3300025922 | Bacteria | 3068 |
| 172 | Ga0207694_10000405 | 3300025924 | Bacteria | 40220 |
| 173 | Ga0207694_10105466 | 3300025924 | Bacteria | 2237 |
| 174 | Ga0207650_10040069 | 3300025925 | Bacteria | 3426 |
| 175 | Ga0207659_10021222 | 3300025926 | Bacteria | 4307 |
| 176 | Ga0207687_10021806 | 3300025927 | Bacteria | 4258 |
| 177 | Ga0207687_10023155 | 3300025927 | Bacteria | 4138 |
| 178 | Ga0207687_10069791 | 3300025927 | Bacteria | 2507 |
| 179 | Ga0207700_10050607 | 3300025928 | Bacteria | 3096 |
| 180 | Ga0207664_10156419 | 3300025929 | Bacteria | 1941 |
| 181 | Ga0207664_10194569 | 3300025929 | Bacteria | 1747 |
| 182 | Ga0207644_10031787 | 3300025931 | Bacteria | 3679 |
| 183 | Ga0207690_10229197 | 3300025932 | Bacteria | 1425 |
| 184 | Ga0207686_10038165 | 3300025934 | Bacteria | 2904 |
| 185 | Ga0207686_10191703 | 3300025934 | Bacteria | 1457 |
| 186 | Ga0207670_10014323 | 3300025936 | Bacteria | 4705 |
| 187 | Ga0207704_10310599 | 3300025938 | Bacteria | 1212 |
| 188 | Ga0207704_10401308 | 3300025938 | Bacteria | 1082 |
| 189 | Ga0207665_10013384 | 3300025939 | Bacteria | 5394 |
| 190 | Ga0207691_10054668 | 3300025940 | Bacteria | 3642 |
| 191 | Ga0207689_10000818 | 3300025942 | Bacteria | 29960 |
| 192 | Ga0207689_10072689 | 3300025942 | Bacteria | 2825 |
| 193 | Ga0207661_10016235 | 3300025944 | Bacteria | 5491 |
| 194 | Ga0207661_10115563 | 3300025944 | Bacteria | 2277 |
| 195 | Ga0207661_10312669 | 3300025944 | Bacteria | 1411 |
| 196 | Ga0207679_10010796 | 3300025945 | Bacteria | 5889 |
| 197 | Ga0207667_10032894 | 3300025949 | Bacteria | 5581 |
| 198 | Ga0207667_10038442 | 3300025949 | Bacteria | 5112 |
| 199 | Ga0207667_10044125 | 3300025949 | Bacteria | 4727 |
| 200 | Ga0207667_10309647 | 3300025949 | Bacteria | 1613 |
| 201 | Ga0207667_10334754 | 3300025949 | Bacteria | 1545 |
| 202 | Ga0207667_10342596 | 3300025949 | Bacteria | 1525 |
| 203 | Ga0207712_10331282 | 3300025961 | Bacteria | 1259 |
| 204 | Ga0207640_10066106 | 3300025981 | Bacteria | 2415 |
| 205 | Ga0207640_10149400 | 3300025981 | Bacteria | 1714 |
| 206 | Ga0207677_10004691 | 3300026023 | Bacteria | 7365 |
| 207 | Ga0207677_10501916 | 3300026023 | Bacteria | 1049 |
| 208 | Ga0207703_10442995 | 3300026035 | Bacteria | 1212 |
| 209 | Ga0207639_10063529 | 3300026041 | Bacteria | 2859 |
| 210 | Ga0207678_10000468 | 3300026067 | Bacteria | 36559 |
| 211 | Ga0207678_10095833 | 3300026067 | Bacteria | 2536 |
| 212 | Ga0207708_10000036 | 3300026075 | Bacteria | 138158 |
| 213 | Ga0207708_10040493 | 3300026075 | Bacteria | 3552 |
| 214 | Ga0207702_10000541 | 3300026078 | Bacteria | 42221 |
| 215 | Ga0207702_10027831 | 3300026078 | Bacteria | 4696 |
| 216 | Ga0207702_10231438 | 3300026078 | Bacteria | 1727 |
| 217 | Ga0207641_10078498 | 3300026088 | Bacteria | 2859 |
| 218 | Ga0207648_10137332 | 3300026089 | Bacteria | 2154 |
| 219 | Ga0207676_10006524 | 3300026095 | Bacteria | 8249 |
| 220 | Ga0207674_10059901 | 3300026116 | Bacteria | 3852 |
| 221 | Ga0207675_100237337 | 3300026118 | Bacteria | 1761 |
| 222 | Ga0207683_10005467 | 3300026121 | Bacteria | 10883 |
| 223 | Ga0207698_10004256 | 3300026142 | Bacteria | 8708 |
| 224 | Ga0207698_10009218 | 3300026142 | Bacteria | 6279 |
| 225 | Ga0207428_10068101 | 3300027907 | Bacteria | 2801 |
| 226 | Ga0268266_10036974 | 3300028379 | Bacteria | 4160 |
| 227 | Ga0268265_10469702 | 3300028380 | Bacteria | 1179 |
| 228 | Ga0268264_10527409 | 3300028381 | Bacteria | 1155 |
| 229 | Ga0307517_10006780 | 3300028786 | Bacteria | 16856 |
| 230 | Ga0307517_10117968 | 3300028786 | Bacteria | 1978 |
| 231 | Ga0307515_10226581 | 3300028794 | Bacteria | 1673 |
| 232 | Ga0265338_10079398 | 3300028800 | Bacteria | 2761 |
| 233 | Ga0307512_10126147 | 3300030522 | Bacteria | 1624 |
| 234 | Ga0316181_1237623 | 3300030744 | Bacteria | 1119 |
| 235 | Ga0265330_10001427 | 3300031235 | Bacteria | 13947 |
| 236 | Ga0265325_10000171 | 3300031241 | Bacteria | 45980 |
| 237 | Ga0265325_10070730 | 3300031241 | Unclassified | 1752 |
| 238 | Ga0265340_10028506 | 3300031247 | Bacteria | 2808 |
| 239 | Ga0265339_10005053 | 3300031249 | Bacteria | 8864 |
| 240 | Ga0265339_10109694 | 3300031249 | Bacteria | 1429 |
| 241 | Ga0265327_10034277 | 3300031251 | Bacteria | 2819 |
| 242 | Ga0265316_10002273 | 3300031344 | Bacteria | 20130 |
| 243 | Ga0307509_10066732 | 3300031507 | Bacteria | 3773 |
| 244 | Ga0265313_10141239 | 3300031595 | Bacteria | 1035 |
| 245 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 246 | Ga0307514_10068773 | 3300031649 | Bacteria | 2668 |
| 247 | Ga0316575_10000001 | 3300031665 | Bacteria | 151281 |
| 248 | Ga0265342_10001775 | 3300031712 | Bacteria | 19692 |
| 249 | Ga0265342_10102639 | 3300031712 | Bacteria | 1627 |
| 250 | Ga0316576_10026852 | 3300031727 | Bacteria | 4044 |
| 251 | Ga0316576_10119676 | 3300031727 | Bacteria | 1977 |
| 252 | Ga0316576_10178402 | 3300031727 | Bacteria | 1602 |
| 253 | Ga0316578_10080215 | 3300031728 | Bacteria | 1941 |
| 254 | Ga0316578_10114535 | 3300031728 | Bacteria | 1620 |
| 255 | Ga0316578_10132442 | 3300031728 | Bacteria | 1500 |
| 256 | Ga0316577_10014239 | 3300031733 | Bacteria | 4366 |
| 257 | Ga0307409_100177257 | 3300031995 | Bacteria | 1883 |
| 258 | Ga0307411_10569815 | 3300032005 | Bacteria | 969 |
| 259 | Ga0307507_10000002 | 3300033179 | Bacteria | 388650 |
| 260 | Ga0307510_10138313 | 3300033180 | Bacteria | 2087 |
| 261 | Ga0307510_10266310 | 3300033180 | Eukaryota | 1192 |
| 262 | Ga0373930_0000430 | 3300034816 | Bacteria | 5616 |
| 263 | Ga0373928_0000923 | 3300035084 | Bacteria | 5758 |
| 264 | Ga0373929_0002674 | 3300035085 | Bacteria | 3258 |
| 265 | Ga0373932_0000283 | 3300035112 | Bacteria | 15309 |
| 266 | Ga0373946_0039829 | 3300035171 | Bacteria | 1920 |
| 267 | Ga0316574_0038072 | 3300035398 | Bacteria | 2952 |
| 268 | Ga0316574_0182159 | 3300035398 | Bacteria | 1351 |
| 269 | Ga0373924_0009781 | 3300035410 | Bacteria | 3522 |
| 270 | Ga0373931_0000006 | 3300035691 | Bacteria | 437006 |
| 271 | Ga0373931_0000064 | 3300035691 | Bacteria | 54140 |
| 272 | Ga0373933_0013745 | 3300035724 | Bacteria | 4492 |
| 273 | Ga0373937_0051878 | 3300036401 | Bacteria | 3760 |
| 274 | Ga0316582_0023704 | 3300036647 | Bacteria | 3661 |
| 275 | Ga0316582_0038396 | 3300036647 | Bacteria | 2976 |
| 276 | Ga0316584_0017038 | 3300036712 | Bacteria | 5216 |
| 277 | Ga0316584_0036943 | 3300036712 | Bacteria | 3626 |
| 278 | Ga0316584_0056968 | 3300036712 | Bacteria | 2926 |
| 279 | Ga0316584_0249865 | 3300036712 | Bacteria | 1296 |
| 280 | Ga0316584_0406761 | 3300036712 | Unclassified | 968 |
| 281 | Ga0395900_0277743 | 3300037418 | Bacteria | 1668 |
| 282 | Ga0395900_0303203 | 3300037418 | Bacteria | 1583 |
| 283 | Ga0395898_0003103 | 3300037466 | Bacteria | 18791 |
| 284 | Ga0395898_0770186 | 3300037466 | Bacteria | 903 |
| 285 | Ga0436364_1511720 | 3300037853 | Bacteria | 1062 |
| 286 | Ga0395901_0033819 | 3300038443 | Bacteria | 5278 |
| 287 | Ga0395901_0632826 | 3300038443 | Bacteria | 1075 |
| 288 | Ga0436363_0620657 | 3300039450 | Bacteria | 1570 |
| 289 | Ga0436363_1581292 | 3300039450 | Bacteria | 2267 |
| 290 | Ga0466969_0001880 | 3300044656 | Bacteria | 11227 |
| 291 | Ga0466969_0020087 | 3300044656 | Bacteria | 3462 |
| 292 | Ga0466969_0032077 | 3300044656 | Bacteria | 2672 |
| 293 | Ga0466969_0076372 | 3300044656 | Bacteria | 1604 |
| 294 | Ga0466972_0064030 | 3300044658 | Bacteria | 1760 |
| 295 | Ga0466966_0004869 | 3300044684 | Bacteria | 8831 |
| 296 | Ga0466966_0109560 | 3300044684 | Bacteria | 1703 |
| 297 | Ga0466961_0001592 | 3300044693 | Bacteria | 14063 |
| 298 | Ga0466961_0014649 | 3300044693 | Bacteria | 5037 |
| 299 | Ga0466961_0041636 | 3300044693 | Bacteria | 2945 |
| 300 | Ga0466961_0067505 | 3300044693 | Bacteria | 2272 |
| 301 | Ga0466963_0045005 | 3300044694 | Bacteria | 2906 |
| 302 | Ga0466963_0125115 | 3300044694 | Bacteria | 1772 |
| 303 | Ga0466964_0059025 | 3300044706 | Bacteria | 1592 |
| 304 | Ga0466964_0218985 | 3300044706 | Bacteria | 923 |
| 305 | Ga0466971_0000708 | 3300044719 | Bacteria | 13328 |
| 306 | Ga0466971_0011450 | 3300044719 | Bacteria | 3886 |
| 307 | Ga0466970_0007842 | 3300044765 | Bacteria | 5361 |
| 308 | Ga0466970_0030196 | 3300044765 | Bacteria | 2857 |
| 309 | Ga0466970_0208413 | 3300044765 | Bacteria | 1088 |
| 310 | Ga0466959_0005444 | 3300045049 | Bacteria | 8717 |
| 311 | Ga0466959_0045279 | 3300045049 | Bacteria | 3240 |
| 312 | Ga0466959_0150068 | 3300045049 | Bacteria | 1643 |
| 313 | Ga0466959_0329066 | 3300045049 | Bacteria | 1044 |
| 314 | Ga0451576_0291599 | 3300045051 | Bacteria | 1706 |
| 315 | Ga0466958_0005577 | 3300045836 | Bacteria | 6787 |
| 316 | Ga0466958_0012110 | 3300045836 | Bacteria | 4876 |
| 317 | Ga0466967_0000302 | 3300045976 | Bacteria | 22184 |
| 318 | Ga0466967_0120514 | 3300045976 | Bacteria | 2423 |
| 319 | Ga0466967_0142747 | 3300045976 | Bacteria | 2232 |
| 320 | Ga0495627_023531 | 3300046453 | Bacteria | 2017 |
| 321 | Ga0495592_0028677 | 3300046454 | Bacteria | 4214 |
| 322 | Ga0495592_0089964 | 3300046454 | Bacteria | 2203 |
| 323 | Ga0495603_0122378 | 3300046455 | Bacteria | 1516 |
| 324 | Ga0495629_0135584 | 3300046459 | Eukaryota | 1714 |
| 325 | Ga0495651_0002170 | 3300046462 | Bacteria | 15172 |
| 326 | Ga0495651_0014308 | 3300046462 | Bacteria | 6132 |
| 327 | Ga0495651_0024651 | 3300046462 | Bacteria | 4679 |
| 328 | Ga0495651_0069192 | 3300046462 | Bacteria | 2689 |
| 329 | Ga0495662_0096941 | 3300046476 | Bacteria | 1441 |
| 330 | Ga0495664_0034660 | 3300046477 | Bacteria | 2970 |
| 331 | Ga0495628_0003141 | 3300046516 | Bacteria | 14825 |
| 332 | Ga0495628_0016354 | 3300046516 | Bacteria | 6189 |
| 333 | Ga0495632_0011529 | 3300046519 | Bacteria | 5153 |
| 334 | Ga0495643_0001354 | 3300046522 | Bacteria | 22981 |
| 335 | Ga0495652_0002134 | 3300046529 | Bacteria | 20849 |
| 336 | Ga0495652_0006215 | 3300046529 | Bacteria | 11134 |
| 337 | Ga0495652_0565762 | 3300046529 | Bacteria | 780 |
| 338 | Ga0495665_0034680 | 3300046531 | Bacteria | 2698 |
| 339 | Ga0495586_0075528 | 3300046535 | Bacteria | 1845 |
| 340 | Ga0495586_0206041 | 3300046535 | Bacteria | 1115 |
| 341 | Ga0495587_0007687 | 3300046536 | Bacteria | 6973 |
| 342 | Ga0495587_0037919 | 3300046536 | Bacteria | 2892 |
| 343 | Ga0495645_0019539 | 3300046543 | Bacteria | 4877 |
| 344 | Ga0495645_0130966 | 3300046543 | Bacteria | 1757 |
| 345 | Ga0495622_0037190 | 3300046557 | Bacteria | 2268 |
| 346 | Ga0495667_0220675 | 3300046559 | Bacteria | 1210 |
| 347 | Ga0495611_0203437 | 3300046648 | Bacteria | 923 |
| 348 | Ga0495635_0066699 | 3300046663 | Bacteria | 2468 |
| 349 | Ga0495599_0041512 | 3300046678 | Bacteria | 2888 |
| 350 | Ga0495599_0153453 | 3300046678 | Bacteria | 1425 |
| 351 | Ga0495623_0153808 | 3300046679 | Bacteria | 1357 |
| 352 | Ga0495646_0029291 | 3300046680 | Bacteria | 3442 |
| 353 | Ga0495646_0039541 | 3300046680 | Bacteria | 2907 |
| 354 | Ga0495658_0118452 | 3300046683 | Bacteria | 1599 |
| 355 | Ga0495670_0017718 | 3300046691 | Bacteria | 3507 |
| 356 | Ga0495671_0149039 | 3300046692 | Bacteria | 1139 |
| 357 | Ga0495600_0022655 | 3300046809 | Bacteria | 4035 |
| 358 | Ga0495600_0033826 | 3300046809 | Bacteria | 3318 |
| 359 | Ga0495600_0072658 | 3300046809 | Bacteria | 2246 |
| 360 | Ga0495660_0007821 | 3300046810 | Bacteria | 6277 |
| 361 | Ga0495581_0134781 | 3300047315 | Bacteria | 1440 |
| 362 | Ga0495604_0094391 | 3300047317 | Bacteria | 2211 |
| 363 | Ga0495636_0182833 | 3300047318 | Bacteria | 952 |
| 364 | Ga0495674_0130410 | 3300047319 | Bacteria | 2118 |
| 365 | Ga0495676_0033660 | 3300047321 | Bacteria | 4312 |
| 366 | Ga0495683_0100023 | 3300047323 | Bacteria | 1395 |
| 367 | Ga0495675_0087747 | 3300047444 | Bacteria | 1954 |
| 368 | Ga0495685_001478 | 3300047447 | Bacteria | 7203 |
| 369 | Ga0495681_0004552 | 3300047470 | Bacteria | 9452 |
| 370 | Ga0495684_0288062 | 3300047471 | Bacteria | 1183 |
| 371 | Ga0495686_0019434 | 3300047472 | Bacteria | 4538 |
| 372 | Ga0495602_0110862 | 3300048088 | Bacteria | 2229 |
| 373 | Ga0495602_0362284 | 3300048088 | Bacteria | 1043 |
| 374 | Ga0496102_0060129 | 3300048905 | Bacteria | 3476 |
| 375 | Ga0496102_0222732 | 3300048905 | Bacteria | 1779 |
| 376 | Ga0496103_0116112 | 3300048906 | Bacteria | 1703 |
| 377 | Ga0496103_0149361 | 3300048906 | Bacteria | 1496 |
| 378 | Ga0496104_0002353 | 3300048907 | Bacteria | 16334 |
| 379 | Ga0496104_0003341 | 3300048907 | Bacteria | 13849 |
| 380 | Ga0496104_0067010 | 3300048907 | Bacteria | 3410 |
| 381 | Ga0496104_0299420 | 3300048907 | Bacteria | 1520 |
| 382 | Ga0496105_0027239 | 3300048908 | Bacteria | 4666 |
| 383 | Ga0496105_0046604 | 3300048908 | Bacteria | 3578 |
| 384 | Ga0496105_0322451 | 3300048908 | Bacteria | 1238 |
| 385 | Ga0496106_0010972 | 3300048909 | Bacteria | 6698 |
| 386 | Ga0496107_0032463 | 3300048910 | Bacteria | 3732 |
| 387 | Ga0496107_0084221 | 3300048910 | Bacteria | 2320 |
| 388 | Ga0496108_0195158 | 3300048911 | Bacteria | 1755 |
| 389 | Ga0496108_0585080 | 3300048911 | Bacteria | 973 |
| 390 | Ga0496109_0006637 | 3300048912 | Bacteria | 9745 |
| 391 | Ga0496109_0025385 | 3300048912 | Bacteria | 5280 |
| 392 | Ga0496109_0039260 | 3300048912 | Bacteria | 4284 |
| 393 | Ga0496109_0680184 | 3300048912 | Bacteria | 966 |
| 394 | Ga0496110_0008605 | 3300048913 | Bacteria | 8218 |
| 395 | Ga0496110_0018142 | 3300048913 | Bacteria | 5895 |
| 396 | Ga0496110_0045915 | 3300048913 | Bacteria | 3820 |
| 397 | Ga0496110_0056839 | 3300048913 | Bacteria | 3443 |
| 398 | Ga0496110_0147891 | 3300048913 | Bacteria | 2126 |
| 399 | Ga0496111_0116939 | 3300048914 | Bacteria | 1966 |
| 400 | Ga0496111_0150982 | 3300048914 | Bacteria | 1723 |
| 401 | Ga0496111_0328802 | 3300048914 | Bacteria | 1132 |
| 402 | Ga0496112_0006188 | 3300048915 | Bacteria | 10471 |
| 403 | Ga0496112_0034549 | 3300048915 | Bacteria | 4920 |
| 404 | Ga0496112_0059041 | 3300048915 | Bacteria | 3779 |
| 405 | Ga0496114_0016328 | 3300048917 | Bacteria | 5979 |
| 406 | Ga0496114_0101371 | 3300048917 | Bacteria | 2458 |
| 407 | Ga0496114_0157432 | 3300048917 | Bacteria | 1973 |
| 408 | Ga0496114_0160426 | 3300048917 | Bacteria | 1955 |
| 409 | Ga0496114_0201822 | 3300048917 | Bacteria | 1742 |
| 410 | Ga0496117_0010798 | 3300048920 | Bacteria | 8248 |
| 411 | Ga0496119_0001775 | 3300048922 | Bacteria | 25125 |
| 412 | Ga0496122_0000105 | 3300048925 | Bacteria | 194509 |
| 413 | Ga0496122_0000594 | 3300048925 | Bacteria | 74393 |
| 414 | Ga0496123_0000443 | 3300048926 | Bacteria | 74390 |
| 415 | Ga0496124_0036142 | 3300048927 | Bacteria | 4313 |
| 416 | Ga0496126_0073739 | 3300048929 | Bacteria | 3033 |
| 417 | Ga0501031_0015990 | 3300049568 | Bacteria | 4872 |
| 418 | Ga0501031_0059168 | 3300049568 | Bacteria | 2497 |
| 419 | Ga0501031_0067936 | 3300049568 | Bacteria | 2321 |
| 420 | Ga0501032_0011102 | 3300049569 | Bacteria | 6473 |
| 421 | Ga0501032_0094728 | 3300049569 | Bacteria | 1979 |
| 422 | Ga0501033_0000100 | 3300049570 | Bacteria | 82096 |
| 423 | Ga0501033_0091553 | 3300049570 | Bacteria | 2224 |
| 424 | Ga0501034_0137499 | 3300049571 | Bacteria | 2424 |
| 425 | Ga0501036_0089351 | 3300049572 | Bacteria | 2603 |
| 426 | Ga0501036_0125174 | 3300049572 | Bacteria | 2170 |
| 427 | Ga0501036_0155528 | 3300049572 | Bacteria | 1928 |
| 428 | Ga0501037_0168544 | 3300049573 | Bacteria | 1558 |
| 429 | Ga0501038_0003902 | 3300049574 | Bacteria | 13868 |
| 430 | Ga0501038_0128799 | 3300049574 | Bacteria | 2080 |
| 431 | Ga0501039_0027304 | 3300049575 | Bacteria | 4390 |
| 432 | Ga0501039_0100225 | 3300049575 | Bacteria | 2260 |
| 433 | Ga0501040_0005270 | 3300049576 | Bacteria | 8359 |
| 434 | Ga0501040_0017549 | 3300049576 | Bacteria | 4751 |
| 435 | Ga0501041_0045233 | 3300049577 | Bacteria | 2675 |
| 436 | Ga0501041_0056253 | 3300049577 | Bacteria | 2403 |
| 437 | Ga0501041_0171606 | 3300049577 | Bacteria | 1357 |
| 438 | Ga0501042_0031090 | 3300049578 | Bacteria | 3777 |
| 439 | Ga0501042_0121567 | 3300049578 | Bacteria | 1880 |
| 440 | Ga0501043_0061264 | 3300049579 | Bacteria | 2955 |
| 441 | Ga0501043_0083181 | 3300049579 | Bacteria | 2516 |
| 442 | Ga0501046_0030750 | 3300049580 | Bacteria | 4357 |
| 443 | Ga0501048_0051087 | 3300049582 | Bacteria | 2943 |
| 444 | Ga0501048_0148915 | 3300049582 | Bacteria | 1655 |
| 445 | Ga0501068_0114106 | 3300049584 | Bacteria | 1682 |
| 446 | Ga0501069_0001065 | 3300049585 | Bacteria | 13167 |
| 447 | Ga0501069_0045985 | 3300049585 | Bacteria | 2420 |
| 448 | Ga0501069_0070399 | 3300049585 | Bacteria | 1959 |
| 449 | Ga0501070_0002795 | 3300049586 | Bacteria | 15236 |
| 450 | Ga0501070_0003281 | 3300049586 | Bacteria | 14039 |
| 451 | Ga0501070_0005528 | 3300049586 | Bacteria | 10778 |
| 452 | Ga0501070_0006518 | 3300049586 | Bacteria | 9928 |
| 453 | Ga0501071_0128417 | 3300049587 | Bacteria | 1882 |
| 454 | Ga0501072_0056965 | 3300049588 | Bacteria | 3079 |
| 455 | Ga0501072_0200152 | 3300049588 | Bacteria | 1592 |
| 456 | Ga0501073_0053756 | 3300049589 | Bacteria | 2819 |
| 457 | Ga0501073_0255355 | 3300049589 | Bacteria | 1210 |
| 458 | Ga0501074_0002544 | 3300049590 | Bacteria | 12719 |
| 459 | Ga0501074_0023639 | 3300049590 | Bacteria | 4467 |
| 460 | Ga0501075_0055413 | 3300049591 | Bacteria | 2983 |
| 461 | Ga0501076_0012283 | 3300049592 | Bacteria | 6403 |
| 462 | Ga0501079_0000567 | 3300049741 | Bacteria | 24344 |
| 463 | Ga0501079_0287937 | 3300049741 | Bacteria | 1284 |
| 464 | Ga0501080_0001441 | 3300049742 | Bacteria | 20013 |
| 465 | Ga0501080_0007921 | 3300049742 | Bacteria | 9623 |
| 466 | Ga0501080_0161366 | 3300049742 | Bacteria | 2070 |
| 467 | Ga0501080_0165736 | 3300049742 | Bacteria | 2039 |
| 468 | Ga0501080_0298371 | 3300049742 | Bacteria | 1462 |
| 469 | Ga0501080_0330746 | 3300049742 | Bacteria | 1378 |
| 470 | Ga0501081_0138079 | 3300049743 | Bacteria | 1746 |
| 471 | Ga0501083_0006854 | 3300049744 | Bacteria | 8086 |
| 472 | Ga0501083_0362077 | 3300049744 | Bacteria | 943 |
| 473 | Ga0501035_0011075 | 3300049822 | Bacteria | 8351 |
| 474 | Ga0501035_0061068 | 3300049822 | Bacteria | 3355 |
| 475 | Ga0501035_0130827 | 3300049822 | Bacteria | 2188 |
| 476 | Ga0501044_0000584 | 3300049823 | Bacteria | 44238 |
| 477 | Ga0501044_0009248 | 3300049823 | Bacteria | 10761 |
| 478 | Ga0501044_0120043 | 3300049823 | Bacteria | 2631 |
| 479 | Ga0501044_0133907 | 3300049823 | Bacteria | 2471 |
| 480 | Ga0501044_0519278 | 3300049823 | Bacteria | 1091 |
| 481 | Ga0501045_0014385 | 3300049824 | Bacteria | 5607 |
| 482 | Ga0501045_0055200 | 3300049824 | Bacteria | 2905 |
| 483 | nmdc:mga0yw44_28225_c1 | 3300050492 | Bacteria | 3226 |
| 484 | nmdc:mga0yw44_80620_c1 | 3300050492 | Bacteria | 2039 |
| 485 | nmdc:mga06z11_41021_c1 | 3300050494 | Bacteria | 2314 |
| 486 | nmdc:mga05p37_217800_c1 | 3300050507 | Bacteria | 2305 |
| 487 | nmdc:mga08y16_291276_c1 | 3300050511 | Bacteria | 1683 |
| 488 | nmdc:mga08y16_58375_c1 | 3300050511 | Bacteria | 4032 |
| 489 | nmdc:mga0n895_18420_c1 | 3300050512 | Bacteria | 6462 |
| 490 | nmdc:mga0n895_262644_c1 | 3300050512 | Bacteria | 1752 |
| 491 | nmdc:mga0n895_96510_c1 | 3300050512 | Bacteria | 2961 |
| 492 | nmdc:mga0rr50_109209_c1 | 3300050513 | Bacteria | 2186 |
| 493 | nmdc:mga08x19_49366_c1 | 3300050514 | Bacteria | 2698 |
| 494 | nmdc:mga08x19_49748_c1 | 3300050514 | Bacteria | 2689 |
| 495 | nmdc:mga0a205_4982_c2 | 3300050515 | Bacteria | 5650 |
| 496 | Ga0495601_0005892 | 3300053077 | Bacteria | 7147 |
| 497 | Ga0495601_0098585 | 3300053077 | Bacteria | 1886 |
| 498 | Ga0500610_0128275 | 3300053079 | Bacteria | 1292 |
| 499 | Ga0495655_0022930 | 3300053083 | Bacteria | 1433 |
| 500 | Ga0495595_0008052 | 3300053084 | Bacteria | 4320 |
| 501 | Ga0495595_0122333 | 3300053084 | Bacteria | 1268 |
| 502 | Ga0495619_0164255 | 3300053085 | Bacteria | 1534 |
| 503 | Ga0495619_0212016 | 3300053085 | Bacteria | 1341 |
| 504 | Ga0500578_0010550 | 3300053086 | Bacteria | 5969 |
| 505 | Ga0500566_0002355 | 3300053094 | Bacteria | 11187 |
| 506 | Ga0500641_0003931 | 3300053096 | Bacteria | 5250 |
| 507 | Ga0500654_029460 | 3300053099 | Bacteria | 3330 |
| 508 | Ga0500580_078364 | 3300053113 | Bacteria | 1345 |
| 509 | Ga0500614_041562 | 3300053123 | Bacteria | 1171 |
| 510 | Ga0500628_028442 | 3300053129 | Bacteria | 1193 |
| 511 | Ga0500658_0005630 | 3300053134 | Bacteria | 4662 |
| 512 | Ga0500659_0002701 | 3300053135 | Eukaryota | 10606 |
| 513 | Ga0500568_0000051 | 3300053139 | Bacteria | 112462 |
| 514 | Ga0500568_0000120 | 3300053139 | Bacteria | 70393 |
| 515 | Ga0500600_0008547 | 3300053149 | Bacteria | 6172 |
| 516 | Ga0500616_0001077 | 3300053153 | Bacteria | 28519 |
| 517 | Ga0500616_0003499 | 3300053153 | Bacteria | 11941 |
| 518 | Ga0500633_0000641 | 3300053160 | Bacteria | 5823 |
| 519 | Ga0500634_0014144 | 3300053161 | Bacteria | 4206 |
| 520 | Ga0500656_000086 | 3300053732 | Bacteria | 5136 |
| 521 | Ga0500587_000723 | 3300053739 | Bacteria | 4237 |
| 522 | Ga0501084_0068581 | 3300054114 | Bacteria | 2969 |
| 523 | Ga0501084_0356076 | 3300054114 | Bacteria | 1236 |
| 524 | Ga0501082_0011356 | 3300060353 | Bacteria | 7658 |
| 525 | Ga0501082_0097797 | 3300060353 | Bacteria | 2537 |
| 526 | Ga0466962_0000547 | 3300061719 | Bacteria | 16568 |
| 527 | Ga0466962_0015163 | 3300061719 | Bacteria | 3717 |
| 528 | Ga0530510_0002161 | 3300061734 | Bacteria | 13479 |
| 529 | 2643997448 | 2643221597 | Bacteria | 3347721 |
| 530 | 2784473147 | 2784132109 | Bacteria | 3141763 |
| 531 | 2799182863 | 2799112218 | Bacteria | 4315149 |
| 532 | 2812364000 | 2811994880 | Bacteria | 4147780 |
| 533 | 2816421793 | 2816332119 | Bacteria | 8120218 |
| 534 | 2839987887 | 2839986021 | Bacteria | 3685650 |
| 535 | 2867476933 | 2867475112 | Bacteria | 6909112 |
| 536 | 2868091655 | 2868088558 | Bacteria | 7609351 |
| 537 | 2884996868 | 2884994152 | Bacteria | 4492978 |
| 538 | 2919471995 | 2919468124 | Bacteria | 9133025 |
| 539 | 2932431376 | 2932431166 | Bacteria | 4215299 |
| 540 | 2939661635 | 2939660829 | Bacteria | 3784848 |
| 541 | 2997604415 | 2997600082 | Bacteria | 9896405 |
| 542 | 3001890213 | 3001889506 | Bacteria | 2975194 |
| 543 | 8002813652 | 8002811521 | Bacteria | 2942897 |
| 544 | Ga0070696_100001919 | |||
| 545 | JGI24739J22299_10025304 | |||
| 546 | Ga0007423J48922_100946 | |||
| 547 | Ga0006562J51391_1095070 | |||
| 548 | Ga0070683_100346513 | |||
| 549 | Ga0070670_100023044 | |||
| 550 | Ga0068869_100015673 | |||
| 551 | Ga0070666_10217047 | |||
| 552 | Ga0070680_100023257 | |||
| 553 | Ga0070682_100053264 | |||
| 554 | Ga0070660_100245698 | |||
| 555 | Ga0070691_10020214 | |||
| 556 | Ga0070691_10085573 | |||
| 557 | Ga0070687_100094551 | |||
| 558 | Ga0070661_100267314 | |||
| 559 | Ga0070692_10007495 | |||
| 560 | Ga0070675_100054631 | |||
| 561 | Ga0070671_100013399 | |||
| 562 | Ga0070671_100079304 | |||
| 563 | Ga0070674_100359123 | |||
| 564 | Ga0070673_100046604 | |||
| 565 | Ga0070688_100050167 | |||
| 566 | Ga0070659_100000776 | |||
| 567 | Ga0070659_100250635 | |||
| 568 | Ga0070709_10055727 | |||
| 569 | Ga0070714_100042183 | |||
| 570 | Ga0070713_100085194 | |||
| 571 | Ga0070700_100000041 | |||
| 572 | Ga0070700_100024524 | |||
| 573 | Ga0070663_100016366 | |||
| 574 | Ga0070678_100009289 | |||
| 575 | Ga0070681_10053707 | |||
| 576 | Ga0070681_10665799 | |||
| 577 | Ga0068867_100254672 | |||
| 578 | Ga0070707_100018432 | |||
| 579 | Ga0070707_100268084 | |||
| 580 | Ga0070698_100376992 | |||
| 581 | Ga0070679_100015511 | |||
| 582 | Ga0070679_100260448 | |||
| 583 | Ga0070679_100272139 | |||
| 584 | Ga0070679_100297180 | |||
| 585 | Ga0070679_100410057 | |||
| 586 | Ga0070684_100190771 | |||
| 587 | Ga0068853_100091000 | |||
| 588 | Ga0070693_100010114 | |||
| 589 | Ga0070665_100025044 | |||
| 590 | Ga0070665_100027824 | |||
| 591 | Ga0068855_100005398 | |||
| 592 | Ga0068855_100006885 | |||
| 593 | Ga0068855_100013946 | |||
| 594 | Ga0068855_100106710 | |||
| 595 | Ga0068855_100147084 | |||
| 596 | Ga0068857_100298661 | |||
| 597 | Ga0068854_100001179 | |||
| 598 | Ga0068854_100296071 | |||
| 599 | Ga0068856_100011963 | |||
| 600 | Ga0068856_100071920 | |||
| 601 | Ga0068856_100379619 | |||
| 602 | Ga0070702_100001566 | |||
| 603 | Ga0070702_100196042 | |||
| 604 | Ga0068852_100002958 | |||
| 605 | Ga0068852_100093028 | |||
| 606 | Ga0068852_100165000 | |||
| 607 | Ga0068859_100018321 | |||
| 608 | Ga0068864_100129380 | |||
| 609 | Ga0068851_10012570 | |||
| 610 | Ga0068870_10000054 | |||
| 611 | Ga0068863_100047685 | |||
| 612 | Ga0068863_100358771 | |||
| 613 | Ga0068862_100321550 | |||
| 614 | Ga0075365_10001930 | |||
| 615 | Ga0075365_10010544 | |||
| 616 | Ga0075365_10040239 | |||
| 617 | Ga0075365_10080411 | |||
| 618 | Ga0075364_10151181 | |||
| 619 | Ga0075432_10012177 | |||
| 620 | Ga0070716_100163066 | |||
| 621 | Ga0075367_10006525 | |||
| 622 | Ga0097621_100011796 | |||
| 623 | Ga0068871_100040482 | |||
| 624 | Ga0068871_100066171 | |||
| 625 | Ga0075433_10021009 | |||
| 626 | Ga0075434_100034189 | |||
| 627 | Ga0075434_100081793 | |||
| 628 | Ga0068865_100452318 | |||
| 629 | Ga0075436_100009759 | |||
| 630 | Ga0097620_100018321 | |||
| 631 | Ga0075435_100000557 | |||
| 632 | Ga0075435_100353561 | |||
| 633 | Ga0105240_10010994 | |||
| 634 | Ga0105240_10178705 | |||
| 635 | Ga0105240_10202689 | |||
| 636 | Ga0111539_10059203 | |||
| 637 | Ga0105245_10060995 | |||
| 638 | Ga0105245_10072445 | |||
| 639 | Ga0105245_10141687 | |||
| 640 | Ga0105247_10068025 | |||
| 641 | Ga0114129_10154336 | |||
| 642 | Ga0105243_10152643 | |||
| 643 | Ga0105241_10005686 | |||
| 644 | Ga0105241_10070753 | |||
| 645 | Ga0105241_10102848 | |||
| 646 | Ga0105242_10104733 | |||
| 647 | Ga0105242_10208391 | |||
| 648 | Ga0105248_10191857 | |||
| 649 | Ga0105237_10056552 | |||
| 650 | Ga0105237_10056940 | |||
| 651 | Ga0105237_10069518 | |||
| 652 | Ga0105237_10345786 | |||
| 653 | Ga0105238_10002139 | |||
| 654 | Ga0105249_10624876 | |||
| 655 | Ga0105239_10043428 | |||
| 656 | Ga0105239_10127054 | |||
| 657 | Ga0105239_10437644 | |||
| 658 | Ga0105246_10018883 | |||
| 659 | Ga0105246_10340137 | |||
| 660 | Ga0157373_10033532 | |||
| 661 | Ga0157370_10004912 | |||
| 662 | Ga0157370_10035549 | |||
| 663 | Ga0157369_10007361 | |||
| 664 | Ga0157369_10319661 | |||
| 665 | Ga0157369_10406048 | |||
| 666 | Ga0157374_10122184 | |||
| 667 | Ga0157374_10229437 | |||
| 668 | Ga0157378_10027006 | |||
| 669 | Ga0157372_10017717 | |||
| 670 | Ga0157372_10428251 | |||
| 671 | Ga0157375_10022174 | |||
| 672 | Ga0157375_10040586 | |||
| 673 | Ga0157375_10311765 | |||
| 674 | Ga0163163_10180850 | |||
| 675 | Ga0163163_10228523 | |||
| 676 | Ga0157380_10135373 | |||
| 677 | Ga0182008_10020326 | |||
| 678 | Ga0157377_10107980 | |||
| 679 | Ga0157379_10027362 | |||
| 680 | Ga0157379_10038490 | |||
| 681 | Ga0157376_10004667 | |||
| 682 | Ga0157376_10052486 | |||
| 683 | Ga0206356_10599629 | |||
| 684 | Ga0206353_10070396 | |||
| 685 | Ga0206353_11172701 | |||
| 686 | Ga0224712_10001001 | |||
| 687 | Ga0224712_10090096 | |||
| 688 | Ga0209646_1000202 | |||
| 689 | Ga0207656_10001680 | |||
| 690 | Ga0207692_10000253 | |||
| 691 | Ga0207680_10034849 | |||
| 692 | Ga0207647_10006126 | |||
| 693 | Ga0207685_10091123 | |||
| 694 | Ga0207699_10063591 | |||
| 695 | Ga0207645_10012844 | |||
| 696 | Ga0207643_10000972 | |||
| 697 | Ga0207705_10073393 | |||
| 698 | Ga0207654_10002485 | |||
| 699 | Ga0207654_10050757 | |||
| 700 | Ga0207654_10260567 | |||
| 701 | Ga0207695_10002209 | |||
| 702 | Ga0207695_10119295 | |||
| 703 | Ga0207671_10000910 | |||
| 704 | Ga0207671_10059215 | |||
| 705 | Ga0207693_10118089 | |||
| 706 | Ga0207693_10265739 | |||
| 707 | Ga0207663_10239926 | |||
| 708 | Ga0207660_10075793 | |||
| 709 | Ga0207649_10133119 | |||
| 710 | Ga0207652_10015663 | |||
| 711 | Ga0207652_10235824 | |||
| 712 | Ga0207652_10307457 | |||
| 713 | Ga0207646_10025655 | |||
| 714 | Ga0207646_10072870 | |||
| 715 | Ga0207694_10000405 | |||
| 716 | Ga0207694_10105466 | |||
| 717 | Ga0207650_10040069 | |||
| 718 | Ga0207659_10021222 | |||
| 719 | Ga0207687_10021806 | |||
| 720 | Ga0207687_10023155 | |||
| 721 | Ga0207687_10069791 | |||
| 722 | Ga0207700_10050607 | |||
| 723 | Ga0207664_10156419 | |||
| 724 | Ga0207664_10194569 | |||
| 725 | Ga0207644_10031787 | |||
| 726 | Ga0207690_10229197 | |||
| 727 | Ga0207686_10038165 | |||
| 728 | Ga0207686_10191703 | |||
| 729 | Ga0207670_10014323 | |||
| 730 | Ga0207704_10310599 | |||
| 731 | Ga0207704_10401308 | |||
| 732 | Ga0207665_10013384 | |||
| 733 | Ga0207691_10054668 | |||
| 734 | Ga0207689_10000818 | |||
| 735 | Ga0207689_10072689 | |||
| 736 | Ga0207661_10016235 | |||
| 737 | Ga0207661_10115563 | |||
| 738 | Ga0207661_10312669 | |||
| 739 | Ga0207679_10010796 | |||
| 740 | Ga0207667_10032894 | |||
| 741 | Ga0207667_10038442 | |||
| 742 | Ga0207667_10044125 | |||
| 743 | Ga0207667_10309647 | |||
| 744 | Ga0207667_10334754 | |||
| 745 | Ga0207667_10342596 | |||
| 746 | Ga0207712_10331282 | |||
| 747 | Ga0207640_10066106 | |||
| 748 | Ga0207640_10149400 | |||
| 749 | Ga0207677_10004691 | |||
| 750 | Ga0207677_10501916 | |||
| 751 | Ga0207703_10442995 | |||
| 752 | Ga0207639_10063529 | |||
| 753 | Ga0207678_10000468 | |||
| 754 | Ga0207678_10095833 | |||
| 755 | Ga0207708_10000036 | |||
| 756 | Ga0207708_10040493 | |||
| 757 | Ga0207702_10000541 | |||
| 758 | Ga0207702_10027831 | |||
| 759 | Ga0207702_10231438 | |||
| 760 | Ga0207641_10078498 | |||
| 761 | Ga0207648_10137332 | |||
| 762 | Ga0207676_10006524 | |||
| 763 | Ga0207674_10059901 | |||
| 764 | Ga0207675_100237337 | |||
| 765 | Ga0207683_10005467 | |||
| 766 | Ga0207698_10004256 | |||
| 767 | Ga0207698_10009218 | |||
| 768 | Ga0207428_10068101 | |||
| 769 | Ga0268266_10036974 | |||
| 770 | Ga0268265_10469702 | |||
| 771 | Ga0268264_10527409 | |||
| 772 | Ga0307517_10006780 | |||
| 773 | Ga0307517_10117968 | |||
| 774 | Ga0307515_10226581 | |||
| 775 | Ga0265338_10079398 | |||
| 776 | Ga0307512_10126147 | |||
| 777 | Ga0316181_1237623 | |||
| 778 | Ga0265330_10001427 | |||
| 779 | Ga0265325_10000171 | |||
| 780 | Ga0265325_10070730 | |||
| 781 | Ga0265340_10028506 | |||
| 782 | Ga0265339_10005053 | |||
| 783 | Ga0265339_10109694 | |||
| 784 | Ga0265327_10034277 | |||
| 785 | Ga0265316_10002273 | |||
| 786 | Ga0307509_10066732 | |||
| 787 | Ga0265313_10141239 | |||
| 788 | Ga0307514_10000339 | |||
| 789 | Ga0307514_10068773 | |||
| 790 | Ga0316575_10000001 | |||
| 791 | Ga0265342_10001775 | |||
| 792 | Ga0265342_10102639 | |||
| 793 | Ga0316576_10026852 | |||
| 794 | Ga0316576_10119676 | |||
| 795 | Ga0316576_10178402 | |||
| 796 | Ga0316578_10080215 | |||
| 797 | Ga0316578_10114535 | |||
| 798 | Ga0316578_10132442 | |||
| 799 | Ga0316577_10014239 | |||
| 800 | Ga0307409_100177257 | |||
| 801 | Ga0307411_10569815 | |||
| 802 | Ga0307507_10000002 | |||
| 803 | Ga0307510_10138313 | |||
| 804 | Ga0307510_10266310 | |||
| 805 | Ga0373930_0000430 | |||
| 806 | Ga0373928_0000923 | |||
| 807 | Ga0373929_0002674 | |||
| 808 | Ga0373932_0000283 | |||
| 809 | Ga0373946_0039829 | |||
| 810 | Ga0316574_0038072 | |||
| 811 | Ga0316574_0182159 | |||
| 812 | Ga0373924_0009781 | |||
| 813 | Ga0373931_0000006 | |||
| 814 | Ga0373931_0000064 | |||
| 815 | Ga0373933_0013745 | |||
| 816 | Ga0373937_0051878 | |||
| 817 | Ga0316582_0023704 | |||
| 818 | Ga0316582_0038396 | |||
| 819 | Ga0316584_0017038 | |||
| 820 | Ga0316584_0036943 | |||
| 821 | Ga0316584_0056968 | |||
| 822 | Ga0316584_0249865 | |||
| 823 | Ga0316584_0406761 | |||
| 824 | Ga0395900_0277743 | |||
| 825 | Ga0395900_0303203 | |||
| 826 | Ga0395898_0003103 | |||
| 827 | Ga0395898_0770186 | |||
| 828 | Ga0436364_1511720 | |||
| 829 | Ga0395901_0033819 | |||
| 830 | Ga0395901_0632826 | |||
| 831 | Ga0436363_0620657 | |||
| 832 | Ga0436363_1581292 | |||
| 833 | Ga0466969_0001880 | |||
| 834 | Ga0466969_0020087 | |||
| 835 | Ga0466969_0032077 | |||
| 836 | Ga0466969_0076372 | |||
| 837 | Ga0466972_0064030 | |||
| 838 | Ga0466966_0004869 | |||
| 839 | Ga0466966_0109560 | |||
| 840 | Ga0466961_0001592 | |||
| 841 | Ga0466961_0014649 | |||
| 842 | Ga0466961_0041636 | |||
| 843 | Ga0466961_0067505 | |||
| 844 | Ga0466963_0045005 | |||
| 845 | Ga0466963_0125115 | |||
| 846 | Ga0466964_0059025 | |||
| 847 | Ga0466964_0218985 | |||
| 848 | Ga0466971_0000708 | |||
| 849 | Ga0466971_0011450 | |||
| 850 | Ga0466970_0007842 | |||
| 851 | Ga0466970_0030196 | |||
| 852 | Ga0466970_0208413 | |||
| 853 | Ga0466959_0005444 | |||
| 854 | Ga0466959_0045279 | |||
| 855 | Ga0466959_0150068 | |||
| 856 | Ga0466959_0329066 | |||
| 857 | Ga0451576_0291599 | |||
| 858 | Ga0466958_0005577 | |||
| 859 | Ga0466958_0012110 | |||
| 860 | Ga0466967_0000302 | |||
| 861 | Ga0466967_0120514 | |||
| 862 | Ga0466967_0142747 | |||
| 863 | Ga0495627_023531 | |||
| 864 | Ga0495592_0028677 | |||
| 865 | Ga0495592_0089964 | |||
| 866 | Ga0495603_0122378 | |||
| 867 | Ga0495629_0135584 | |||
| 868 | Ga0495651_0002170 | |||
| 869 | Ga0495651_0014308 | |||
| 870 | Ga0495651_0024651 | |||
| 871 | Ga0495651_0069192 | |||
| 872 | Ga0495662_0096941 | |||
| 873 | Ga0495664_0034660 | |||
| 874 | Ga0495628_0003141 | |||
| 875 | Ga0495628_0016354 | |||
| 876 | Ga0495632_0011529 | |||
| 877 | Ga0495643_0001354 | |||
| 878 | Ga0495652_0002134 | |||
| 879 | Ga0495652_0006215 | |||
| 880 | Ga0495652_0565762 | |||
| 881 | Ga0495665_0034680 | |||
| 882 | Ga0495586_0075528 | |||
| 883 | Ga0495586_0206041 | |||
| 884 | Ga0495587_0007687 | |||
| 885 | Ga0495587_0037919 | |||
| 886 | Ga0495645_0019539 | |||
| 887 | Ga0495645_0130966 | |||
| 888 | Ga0495622_0037190 | |||
| 889 | Ga0495667_0220675 | |||
| 890 | Ga0495611_0203437 | |||
| 891 | Ga0495635_0066699 | |||
| 892 | Ga0495599_0041512 | |||
| 893 | Ga0495599_0153453 | |||
| 894 | Ga0495623_0153808 | |||
| 895 | Ga0495646_0029291 | |||
| 896 | Ga0495646_0039541 | |||
| 897 | Ga0495658_0118452 | |||
| 898 | Ga0495670_0017718 | |||
| 899 | Ga0495671_0149039 | |||
| 900 | Ga0495600_0022655 | |||
| 901 | Ga0495600_0033826 | |||
| 902 | Ga0495600_0072658 | |||
| 903 | Ga0495660_0007821 | |||
| 904 | Ga0495581_0134781 | |||
| 905 | Ga0495604_0094391 | |||
| 906 | Ga0495636_0182833 | |||
| 907 | Ga0495674_0130410 | |||
| 908 | Ga0495676_0033660 | |||
| 909 | Ga0495683_0100023 | |||
| 910 | Ga0495675_0087747 | |||
| 911 | Ga0495685_001478 | |||
| 912 | Ga0495681_0004552 | |||
| 913 | Ga0495684_0288062 | |||
| 914 | Ga0495686_0019434 | |||
| 915 | Ga0495602_0110862 | |||
| 916 | Ga0495602_0362284 | |||
| 917 | Ga0496102_0060129 | |||
| 918 | Ga0496102_0222732 | |||
| 919 | Ga0496103_0116112 | |||
| 920 | Ga0496103_0149361 | |||
| 921 | Ga0496104_0002353 | |||
| 922 | Ga0496104_0003341 | |||
| 923 | Ga0496104_0067010 | |||
| 924 | Ga0496104_0299420 | |||
| 925 | Ga0496105_0027239 | |||
| 926 | Ga0496105_0046604 | |||
| 927 | Ga0496105_0322451 | |||
| 928 | Ga0496106_0010972 | |||
| 929 | Ga0496107_0032463 | |||
| 930 | Ga0496107_0084221 | |||
| 931 | Ga0496108_0195158 | |||
| 932 | Ga0496108_0585080 | |||
| 933 | Ga0496109_0006637 | |||
| 934 | Ga0496109_0025385 | |||
| 935 | Ga0496109_0039260 | |||
| 936 | Ga0496109_0680184 | |||
| 937 | Ga0496110_0008605 | |||
| 938 | Ga0496110_0018142 | |||
| 939 | Ga0496110_0045915 | |||
| 940 | Ga0496110_0056839 | |||
| 941 | Ga0496110_0147891 | |||
| 942 | Ga0496111_0116939 | |||
| 943 | Ga0496111_0150982 | |||
| 944 | Ga0496111_0328802 | |||
| 945 | Ga0496112_0006188 | |||
| 946 | Ga0496112_0034549 | |||
| 947 | Ga0496112_0059041 | |||
| 948 | Ga0496114_0016328 | |||
| 949 | Ga0496114_0101371 | |||
| 950 | Ga0496114_0157432 | |||
| 951 | Ga0496114_0160426 | |||
| 952 | Ga0496114_0201822 | |||
| 953 | Ga0496117_0010798 | |||
| 954 | Ga0496119_0001775 | |||
| 955 | Ga0496122_0000105 | |||
| 956 | Ga0496122_0000594 | |||
| 957 | Ga0496123_0000443 | |||
| 958 | Ga0496124_0036142 | |||
| 959 | Ga0496126_0073739 | |||
| 960 | Ga0501031_0015990 | |||
| 961 | Ga0501031_0059168 | |||
| 962 | Ga0501031_0067936 | |||
| 963 | Ga0501032_0011102 | |||
| 964 | Ga0501032_0094728 | |||
| 965 | Ga0501033_0000100 | |||
| 966 | Ga0501033_0091553 | |||
| 967 | Ga0501034_0137499 | |||
| 968 | Ga0501036_0089351 | |||
| 969 | Ga0501036_0125174 | |||
| 970 | Ga0501036_0155528 | |||
| 971 | Ga0501037_0168544 | |||
| 972 | Ga0501038_0003902 | |||
| 973 | Ga0501038_0128799 | |||
| 974 | Ga0501039_0027304 | |||
| 975 | Ga0501039_0100225 | |||
| 976 | Ga0501040_0005270 | |||
| 977 | Ga0501040_0017549 | |||
| 978 | Ga0501041_0045233 | |||
| 979 | Ga0501041_0056253 | |||
| 980 | Ga0501041_0171606 | |||
| 981 | Ga0501042_0031090 | |||
| 982 | Ga0501042_0121567 | |||
| 983 | Ga0501043_0061264 | |||
| 984 | Ga0501043_0083181 | |||
| 985 | Ga0501046_0030750 | |||
| 986 | Ga0501048_0051087 | |||
| 987 | Ga0501048_0148915 | |||
| 988 | Ga0501068_0114106 | |||
| 989 | Ga0501069_0001065 | |||
| 990 | Ga0501069_0045985 | |||
| 991 | Ga0501069_0070399 | |||
| 992 | Ga0501070_0002795 | |||
| 993 | Ga0501070_0003281 | |||
| 994 | Ga0501070_0005528 | |||
| 995 | Ga0501070_0006518 | |||
| 996 | Ga0501071_0128417 | |||
| 997 | Ga0501072_0056965 | |||
| 998 | Ga0501072_0200152 | |||
| 999 | Ga0501073_0053756 | |||
| 1000 | Ga0501073_0255355 | |||
| 1001 | Ga0501074_0002544 | |||
| 1002 | Ga0501074_0023639 | |||
| 1003 | Ga0501075_0055413 | |||
| 1004 | Ga0501076_0012283 | |||
| 1005 | Ga0501079_0000567 | |||
| 1006 | Ga0501079_0287937 | |||
| 1007 | Ga0501080_0001441 | |||
| 1008 | Ga0501080_0007921 | |||
| 1009 | Ga0501080_0161366 | |||
| 1010 | Ga0501080_0165736 | |||
| 1011 | Ga0501080_0298371 | |||
| 1012 | Ga0501080_0330746 | |||
| 1013 | Ga0501081_0138079 | |||
| 1014 | Ga0501083_0006854 | |||
| 1015 | Ga0501083_0362077 | |||
| 1016 | Ga0501035_0011075 | |||
| 1017 | Ga0501035_0061068 | |||
| 1018 | Ga0501035_0130827 | |||
| 1019 | Ga0501044_0000584 | |||
| 1020 | Ga0501044_0009248 | |||
| 1021 | Ga0501044_0120043 | |||
| 1022 | Ga0501044_0133907 | |||
| 1023 | Ga0501044_0519278 | |||
| 1024 | Ga0501045_0014385 | |||
| 1025 | Ga0501045_0055200 | |||
| 1026 | nmdc:mga0yw44_28225_c1 | |||
| 1027 | nmdc:mga0yw44_80620_c1 | |||
| 1028 | nmdc:mga06z11_41021_c1 | |||
| 1029 | nmdc:mga05p37_217800_c1 | |||
| 1030 | nmdc:mga08y16_291276_c1 | |||
| 1031 | nmdc:mga08y16_58375_c1 | |||
| 1032 | nmdc:mga0n895_18420_c1 | |||
| 1033 | nmdc:mga0n895_262644_c1 | |||
| 1034 | nmdc:mga0n895_96510_c1 | |||
| 1035 | nmdc:mga0rr50_109209_c1 | |||
| 1036 | nmdc:mga08x19_49366_c1 | |||
| 1037 | nmdc:mga08x19_49748_c1 | |||
| 1038 | nmdc:mga0a205_4982_c2 | |||
| 1039 | Ga0495601_0005892 | |||
| 1040 | Ga0495601_0098585 | |||
| 1041 | Ga0500610_0128275 | |||
| 1042 | Ga0495655_0022930 | |||
| 1043 | Ga0495595_0008052 | |||
| 1044 | Ga0495595_0122333 | |||
| 1045 | Ga0495619_0164255 | |||
| 1046 | Ga0495619_0212016 | |||
| 1047 | Ga0500578_0010550 | |||
| 1048 | Ga0500566_0002355 | |||
| 1049 | Ga0500641_0003931 | |||
| 1050 | Ga0500654_029460 | |||
| 1051 | Ga0500580_078364 | |||
| 1052 | Ga0500614_041562 | |||
| 1053 | Ga0500628_028442 | |||
| 1054 | Ga0500658_0005630 | |||
| 1055 | Ga0500659_0002701 | |||
| 1056 | Ga0500568_0000051 | |||
| 1057 | Ga0500568_0000120 | |||
| 1058 | Ga0500600_0008547 | |||
| 1059 | Ga0500616_0001077 | |||
| 1060 | Ga0500616_0003499 | |||
| 1061 | Ga0500633_0000641 | |||
| 1062 | Ga0500634_0014144 | |||
| 1063 | Ga0500656_000086 | |||
| 1064 | Ga0500587_000723 | |||
| 1065 | Ga0501084_0068581 | |||
| 1066 | Ga0501084_0356076 | |||
| 1067 | Ga0501082_0011356 | |||
| 1068 | Ga0501082_0097797 | |||
| 1069 | Ga0466962_0000547 | |||
| 1070 | Ga0466962_0015163 | |||
| 1071 | Ga0530510_0002161 | |||
| 1072 | 2643997448 | |||
| 1073 | 2784473147 | |||
| 1074 | 2799182863 | |||
| 1075 | 2812364000 | |||
| 1076 | 2816421793 | |||
| 1077 | 2839987887 | |||
| 1078 | 2867476933 | |||
| 1079 | 2868091655 | |||
| 1080 | 2884996868 | |||
| 1081 | 2919471995 | |||
| 1082 | 2932431376 | |||
| 1083 | 2939661635 | |||
| 1084 | 2997604415 | |||
| 1085 | 3001890213 | |||
| 1086 | 8002813652 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r9r-assembly1.cif.gz_A | structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 | 0.9558 | 8 | 289 |
| 6z0r-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 | 0.9543 | 6 | 288 |
| 6yya-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor | 0.9525 | 6 | 288 |
| 6yyb-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor | 0.9515 | 6 | 288 |
| 6z0r-assembly1.cif.gz_A | crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 | 0.9256 | 6 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9859 | 96 | 238 | 3.30.470.20 |
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9658 | 96 | 238 | 3.30.470.20 |
| 1obgA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9653 | 96 | 239 | 3.30.470.20 |
| 1obgA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9462 | 96 | 239 | 3.30.470.20 |
| af_P9WHN1_1_93_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.9194 | 6 | 94 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S4W3U4-F1-model_v4 | deleted | 0.9968 | 90 | 199 |
|
| AF-A0A7K3MCS8-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9952 | 7 | 289 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A7Y9S3Y5-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9946 | 4 | 289 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-T1CG79-F1-model_v4 | phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) | 0.9946 | 85 | 237 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A2W5NBR4-F1-model_v4 | deleted | 0.9939 | 15 | 224 |
|