F461592

General Info

Members Datasets Scaffolds Average Seq Length
543 333 1086 291

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100001919|Ga0070696_10000191912
Length 329
Sequence MSSPHVPDPAAEPQAADGPVAGAAGERGHGELRPAAQELPGFRHMYSGKVRDLYAPLTATGDVDPTRLLLVATDRISAYDHVLPTPIPDKGRVLTQMSLWWFSQLADLVPNHVLSTDVPDEVAGRAVLVRRLHMVPVECVARGYLAGSGLVEYRASGTVCGVPLPPGLTDGSRLDAPIFTPATKAELGEHDENVTFEQVADVVGADLAEELRRLTLAVYARGEQLARDRGILLADTKIELGRDDDGRILLGDEVLTPDSSRFWPAAHWAPGGPQASYDKQFVRDWLTSPASGWDRSSDAPPPPLPDDVVERTRAKYLEAYETLTGQRLR

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
151 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
165 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
301 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
302 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
303 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
304 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
305 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
314 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
319 2643221597 Microbacterium sp. Root180 Isolate Unclassified
320 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
321 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
322 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
323 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
324 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
325 2867475112 Streptomyces sp. TM32 Isolate Unclassified
326 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
327 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
328 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
329 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
330 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
331 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
332 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
333 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 1.29
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 0
Rhizoplane 6.63
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100001919 3300005546 Bacteria 13686
2 JGI24739J22299_10025304 3300001989 Bacteria 2088
3 Ga0007423J48922_100946 3300003285 Bacteria 4331
4 Ga0006562J51391_1095070 3300003578 Bacteria 10857
5 Ga0070683_100346513 3300005329 Bacteria 1415
6 Ga0070670_100023044 3300005331 Bacteria 5357
7 Ga0068869_100015673 3300005334 Bacteria 5091
8 Ga0070666_10217047 3300005335 Bacteria 1348
9 Ga0070680_100023257 3300005336 Bacteria 4941
10 Ga0070682_100053264 3300005337 Bacteria 2535
11 Ga0070660_100245698 3300005339 Bacteria 1458
12 Ga0070691_10020214 3300005341 Bacteria 3076
13 Ga0070691_10085573 3300005341 Bacteria 1549
14 Ga0070687_100094551 3300005343 Bacteria 1660
15 Ga0070661_100267314 3300005344 Bacteria 1323
16 Ga0070692_10007495 3300005345 Bacteria 4807
17 Ga0070675_100054631 3300005354 Bacteria 3286
18 Ga0070671_100013399 3300005355 Bacteria 6610
19 Ga0070671_100079304 3300005355 Bacteria 2744
20 Ga0070674_100359123 3300005356 Bacteria 1179
21 Ga0070673_100046604 3300005364 Bacteria 3369
22 Ga0070688_100050167 3300005365 Bacteria 2599
23 Ga0070659_100000776 3300005366 Bacteria 23181
24 Ga0070659_100250635 3300005366 Bacteria 1467
25 Ga0070709_10055727 3300005434 Bacteria 2497
26 Ga0070714_100042183 3300005435 Bacteria 3853
27 Ga0070713_100085194 3300005436 Bacteria 2706
28 Ga0070700_100000041 3300005441 Bacteria 103180
29 Ga0070700_100024524 3300005441 Bacteria 3542
30 Ga0070663_100016366 3300005455 Bacteria 4814
31 Ga0070678_100009289 3300005456 Bacteria 5947
32 Ga0070681_10053707 3300005458 Bacteria 4015
33 Ga0070681_10665799 3300005458 Bacteria 956
34 Ga0068867_100254672 3300005459 Bacteria 1429
35 Ga0070707_100018432 3300005468 Bacteria 6567
36 Ga0070707_100268084 3300005468 Bacteria 1660
37 Ga0070698_100376992 3300005471 Bacteria 1351
38 Ga0070679_100015511 3300005530 Bacteria 7322
39 Ga0070679_100260448 3300005530 Bacteria 1689
40 Ga0070679_100272139 3300005530 Bacteria 1648
41 Ga0070679_100297180 3300005530 Bacteria 1566
42 Ga0070679_100410057 3300005530 Bacteria 1300
43 Ga0070684_100190771 3300005535 Bacteria 1865
44 Ga0068853_100091000 3300005539 Bacteria 2682
45 Ga0070693_100010114 3300005547 Bacteria 4711
46 Ga0070665_100025044 3300005548 Bacteria 6015
47 Ga0070665_100027824 3300005548 Bacteria 5693
48 Ga0068855_100005398 3300005563 Bacteria 15594
49 Ga0068855_100006885 3300005563 Bacteria 13788
50 Ga0068855_100013946 3300005563 Bacteria 9692
51 Ga0068855_100106710 3300005563 Bacteria 3218
52 Ga0068855_100147084 3300005563 Bacteria 2681
53 Ga0068857_100298661 3300005577 Bacteria 1484
54 Ga0068854_100001179 3300005578 Bacteria 15661
55 Ga0068854_100296071 3300005578 Bacteria 1307
56 Ga0068856_100011963 3300005614 Bacteria 8402
57 Ga0068856_100071920 3300005614 Bacteria 3424
58 Ga0068856_100379619 3300005614 Bacteria 1432
59 Ga0070702_100001566 3300005615 Bacteria 9430
60 Ga0070702_100196042 3300005615 Bacteria 1333
61 Ga0068852_100002958 3300005616 Bacteria 11804
62 Ga0068852_100093028 3300005616 Bacteria 2701
63 Ga0068852_100165000 3300005616 Bacteria 2072
64 Ga0068859_100018321 3300005617 Bacteria 7039
65 Ga0068864_100129380 3300005618 Bacteria 2266
66 Ga0068851_10012570 3300005834 Bacteria 3993
67 Ga0068870_10000054 3300005840 Bacteria 36323
68 Ga0068863_100047685 3300005841 Bacteria 4063
69 Ga0068863_100358771 3300005841 Bacteria 1421
70 Ga0068862_100321550 3300005844 Bacteria 1428
71 Ga0075365_10001930 3300006038 Bacteria 9787
72 Ga0075365_10010544 3300006038 Bacteria 5387
73 Ga0075365_10040239 3300006038 Bacteria 3048
74 Ga0075365_10080411 3300006038 Bacteria 2207
75 Ga0075364_10151181 3300006051 Bacteria 1565
76 Ga0075432_10012177 3300006058 Bacteria 2924
77 Ga0070716_100163066 3300006173 Bacteria 1446
78 Ga0075367_10006525 3300006178 Bacteria 5901
79 Ga0097621_100011796 3300006237 Bacteria 6454
80 Ga0068871_100040482 3300006358 Bacteria 3732
81 Ga0068871_100066171 3300006358 Bacteria 2962
82 Ga0075433_10021009 3300006852 Bacteria 5468
83 Ga0075434_100034189 3300006871 Bacteria 5019
84 Ga0075434_100081793 3300006871 Bacteria 3226
85 Ga0068865_100452318 3300006881 Bacteria 1062
86 Ga0075436_100009759 3300006914 Bacteria 6568
87 Ga0097620_100018321 3300006931 Bacteria 7039
88 Ga0075435_100000557 3300007076 Bacteria 22898
89 Ga0075435_100353561 3300007076 Bacteria 1260
90 Ga0105240_10010994 3300009093 Bacteria 12673
91 Ga0105240_10178705 3300009093 Bacteria 2506
92 Ga0105240_10202689 3300009093 Bacteria 2324
93 Ga0111539_10059203 3300009094 Bacteria 4543
94 Ga0105245_10060995 3300009098 Bacteria 3398
95 Ga0105245_10072445 3300009098 Bacteria 3130
96 Ga0105245_10141687 3300009098 Bacteria 2265
97 Ga0105247_10068025 3300009101 Bacteria 2220
98 Ga0114129_10154336 3300009147 Bacteria 3141
99 Ga0105243_10152643 3300009148 Bacteria 1983
100 Ga0105241_10005686 3300009174 Bacteria 9203
101 Ga0105241_10070753 3300009174 Bacteria 2707
102 Ga0105241_10102848 3300009174 Bacteria 2274
103 Ga0105242_10104733 3300009176 Bacteria 2402
104 Ga0105242_10208391 3300009176 Bacteria 1740
105 Ga0105248_10191857 3300009177 Bacteria 2302
106 Ga0105237_10056552 3300009545 Bacteria 3926
107 Ga0105237_10056940 3300009545 Bacteria 3912
108 Ga0105237_10069518 3300009545 Bacteria 3517
109 Ga0105237_10345786 3300009545 Bacteria 1491
110 Ga0105238_10002139 3300009551 Bacteria 19954
111 Ga0105249_10624876 3300009553 Bacteria 1133
112 Ga0105239_10043428 3300010375 Bacteria 4927
113 Ga0105239_10127054 3300010375 Bacteria 2835
114 Ga0105239_10437644 3300010375 Bacteria 1482
115 Ga0105246_10018883 3300011119 Bacteria 4397
116 Ga0105246_10340137 3300011119 Bacteria 1226
117 Ga0157373_10033532 3300013100 Bacteria 3693
118 Ga0157370_10004912 3300013104 Bacteria 15148
119 Ga0157370_10035549 3300013104 Bacteria 4841
120 Ga0157369_10007361 3300013105 Bacteria 12674
121 Ga0157369_10319661 3300013105 Bacteria 1614
122 Ga0157369_10406048 3300013105 Bacteria 1413
123 Ga0157374_10122184 3300013296 Bacteria 2514
124 Ga0157374_10229437 3300013296 Bacteria 1823
125 Ga0157378_10027006 3300013297 Bacteria 5064
126 Ga0157372_10017717 3300013307 Bacteria 7647
127 Ga0157372_10428251 3300013307 Bacteria 1542
128 Ga0157375_10022174 3300013308 Bacteria 5842
129 Ga0157375_10040586 3300013308 Bacteria 4488
130 Ga0157375_10311765 3300013308 Bacteria 1738
131 Ga0163163_10180850 3300014325 Bacteria 2156
132 Ga0163163_10228523 3300014325 Bacteria 1909
133 Ga0157380_10135373 3300014326 Bacteria 2108
134 Ga0182008_10020326 3300014497 Bacteria 3421
135 Ga0157377_10107980 3300014745 Bacteria 1669
136 Ga0157379_10027362 3300014968 Bacteria 5077
137 Ga0157379_10038490 3300014968 Bacteria 4267
138 Ga0157376_10004667 3300014969 Bacteria 9551
139 Ga0157376_10052486 3300014969 Bacteria 3390
140 Ga0206356_10599629 3300020070 Bacteria 1455
141 Ga0206353_10070396 3300020082 Bacteria 2121
142 Ga0206353_11172701 3300020082 Bacteria 1502
143 Ga0224712_10001001 3300022467 Bacteria 6159
144 Ga0224712_10090096 3300022467 Bacteria 1283
145 Ga0209646_1000202 3300025246 Bacteria 70943
146 Ga0207656_10001680 3300025321 Bacteria 7350
147 Ga0207692_10000253 3300025898 Bacteria 18328
148 Ga0207680_10034849 3300025903 Bacteria 2883
149 Ga0207647_10006126 3300025904 Bacteria 8765
150 Ga0207685_10091123 3300025905 Bacteria 1284
151 Ga0207699_10063591 3300025906 Bacteria 2230
152 Ga0207645_10012844 3300025907 Bacteria 5669
153 Ga0207643_10000972 3300025908 Bacteria 17234
154 Ga0207705_10073393 3300025909 Bacteria 2482
155 Ga0207654_10002485 3300025911 Bacteria 9366
156 Ga0207654_10050757 3300025911 Bacteria 2385
157 Ga0207654_10260567 3300025911 Bacteria 1165
158 Ga0207695_10002209 3300025913 Bacteria 29277
159 Ga0207695_10119295 3300025913 Bacteria 2608
160 Ga0207671_10000910 3300025914 Bacteria 37314
161 Ga0207671_10059215 3300025914 Bacteria 2840
162 Ga0207693_10118089 3300025915 Bacteria 2083
163 Ga0207693_10265739 3300025915 Bacteria 1345
164 Ga0207663_10239926 3300025916 Bacteria 1329
165 Ga0207660_10075793 3300025917 Bacteria 2458
166 Ga0207649_10133119 3300025920 Bacteria 1691
167 Ga0207652_10015663 3300025921 Bacteria 6172
168 Ga0207652_10235824 3300025921 Bacteria 1649
169 Ga0207652_10307457 3300025921 Bacteria 1431
170 Ga0207646_10025655 3300025922 Bacteria 5390
171 Ga0207646_10072870 3300025922 Bacteria 3068
172 Ga0207694_10000405 3300025924 Bacteria 40220
173 Ga0207694_10105466 3300025924 Bacteria 2237
174 Ga0207650_10040069 3300025925 Bacteria 3426
175 Ga0207659_10021222 3300025926 Bacteria 4307
176 Ga0207687_10021806 3300025927 Bacteria 4258
177 Ga0207687_10023155 3300025927 Bacteria 4138
178 Ga0207687_10069791 3300025927 Bacteria 2507
179 Ga0207700_10050607 3300025928 Bacteria 3096
180 Ga0207664_10156419 3300025929 Bacteria 1941
181 Ga0207664_10194569 3300025929 Bacteria 1747
182 Ga0207644_10031787 3300025931 Bacteria 3679
183 Ga0207690_10229197 3300025932 Bacteria 1425
184 Ga0207686_10038165 3300025934 Bacteria 2904
185 Ga0207686_10191703 3300025934 Bacteria 1457
186 Ga0207670_10014323 3300025936 Bacteria 4705
187 Ga0207704_10310599 3300025938 Bacteria 1212
188 Ga0207704_10401308 3300025938 Bacteria 1082
189 Ga0207665_10013384 3300025939 Bacteria 5394
190 Ga0207691_10054668 3300025940 Bacteria 3642
191 Ga0207689_10000818 3300025942 Bacteria 29960
192 Ga0207689_10072689 3300025942 Bacteria 2825
193 Ga0207661_10016235 3300025944 Bacteria 5491
194 Ga0207661_10115563 3300025944 Bacteria 2277
195 Ga0207661_10312669 3300025944 Bacteria 1411
196 Ga0207679_10010796 3300025945 Bacteria 5889
197 Ga0207667_10032894 3300025949 Bacteria 5581
198 Ga0207667_10038442 3300025949 Bacteria 5112
199 Ga0207667_10044125 3300025949 Bacteria 4727
200 Ga0207667_10309647 3300025949 Bacteria 1613
201 Ga0207667_10334754 3300025949 Bacteria 1545
202 Ga0207667_10342596 3300025949 Bacteria 1525
203 Ga0207712_10331282 3300025961 Bacteria 1259
204 Ga0207640_10066106 3300025981 Bacteria 2415
205 Ga0207640_10149400 3300025981 Bacteria 1714
206 Ga0207677_10004691 3300026023 Bacteria 7365
207 Ga0207677_10501916 3300026023 Bacteria 1049
208 Ga0207703_10442995 3300026035 Bacteria 1212
209 Ga0207639_10063529 3300026041 Bacteria 2859
210 Ga0207678_10000468 3300026067 Bacteria 36559
211 Ga0207678_10095833 3300026067 Bacteria 2536
212 Ga0207708_10000036 3300026075 Bacteria 138158
213 Ga0207708_10040493 3300026075 Bacteria 3552
214 Ga0207702_10000541 3300026078 Bacteria 42221
215 Ga0207702_10027831 3300026078 Bacteria 4696
216 Ga0207702_10231438 3300026078 Bacteria 1727
217 Ga0207641_10078498 3300026088 Bacteria 2859
218 Ga0207648_10137332 3300026089 Bacteria 2154
219 Ga0207676_10006524 3300026095 Bacteria 8249
220 Ga0207674_10059901 3300026116 Bacteria 3852
221 Ga0207675_100237337 3300026118 Bacteria 1761
222 Ga0207683_10005467 3300026121 Bacteria 10883
223 Ga0207698_10004256 3300026142 Bacteria 8708
224 Ga0207698_10009218 3300026142 Bacteria 6279
225 Ga0207428_10068101 3300027907 Bacteria 2801
226 Ga0268266_10036974 3300028379 Bacteria 4160
227 Ga0268265_10469702 3300028380 Bacteria 1179
228 Ga0268264_10527409 3300028381 Bacteria 1155
229 Ga0307517_10006780 3300028786 Bacteria 16856
230 Ga0307517_10117968 3300028786 Bacteria 1978
231 Ga0307515_10226581 3300028794 Bacteria 1673
232 Ga0265338_10079398 3300028800 Bacteria 2761
233 Ga0307512_10126147 3300030522 Bacteria 1624
234 Ga0316181_1237623 3300030744 Bacteria 1119
235 Ga0265330_10001427 3300031235 Bacteria 13947
236 Ga0265325_10000171 3300031241 Bacteria 45980
237 Ga0265325_10070730 3300031241 Unclassified 1752
238 Ga0265340_10028506 3300031247 Bacteria 2808
239 Ga0265339_10005053 3300031249 Bacteria 8864
240 Ga0265339_10109694 3300031249 Bacteria 1429
241 Ga0265327_10034277 3300031251 Bacteria 2819
242 Ga0265316_10002273 3300031344 Bacteria 20130
243 Ga0307509_10066732 3300031507 Bacteria 3773
244 Ga0265313_10141239 3300031595 Bacteria 1035
245 Ga0307514_10000339 3300031649 Bacteria 111130
246 Ga0307514_10068773 3300031649 Bacteria 2668
247 Ga0316575_10000001 3300031665 Bacteria 151281
248 Ga0265342_10001775 3300031712 Bacteria 19692
249 Ga0265342_10102639 3300031712 Bacteria 1627
250 Ga0316576_10026852 3300031727 Bacteria 4044
251 Ga0316576_10119676 3300031727 Bacteria 1977
252 Ga0316576_10178402 3300031727 Bacteria 1602
253 Ga0316578_10080215 3300031728 Bacteria 1941
254 Ga0316578_10114535 3300031728 Bacteria 1620
255 Ga0316578_10132442 3300031728 Bacteria 1500
256 Ga0316577_10014239 3300031733 Bacteria 4366
257 Ga0307409_100177257 3300031995 Bacteria 1883
258 Ga0307411_10569815 3300032005 Bacteria 969
259 Ga0307507_10000002 3300033179 Bacteria 388650
260 Ga0307510_10138313 3300033180 Bacteria 2087
261 Ga0307510_10266310 3300033180 Eukaryota 1192
262 Ga0373930_0000430 3300034816 Bacteria 5616
263 Ga0373928_0000923 3300035084 Bacteria 5758
264 Ga0373929_0002674 3300035085 Bacteria 3258
265 Ga0373932_0000283 3300035112 Bacteria 15309
266 Ga0373946_0039829 3300035171 Bacteria 1920
267 Ga0316574_0038072 3300035398 Bacteria 2952
268 Ga0316574_0182159 3300035398 Bacteria 1351
269 Ga0373924_0009781 3300035410 Bacteria 3522
270 Ga0373931_0000006 3300035691 Bacteria 437006
271 Ga0373931_0000064 3300035691 Bacteria 54140
272 Ga0373933_0013745 3300035724 Bacteria 4492
273 Ga0373937_0051878 3300036401 Bacteria 3760
274 Ga0316582_0023704 3300036647 Bacteria 3661
275 Ga0316582_0038396 3300036647 Bacteria 2976
276 Ga0316584_0017038 3300036712 Bacteria 5216
277 Ga0316584_0036943 3300036712 Bacteria 3626
278 Ga0316584_0056968 3300036712 Bacteria 2926
279 Ga0316584_0249865 3300036712 Bacteria 1296
280 Ga0316584_0406761 3300036712 Unclassified 968
281 Ga0395900_0277743 3300037418 Bacteria 1668
282 Ga0395900_0303203 3300037418 Bacteria 1583
283 Ga0395898_0003103 3300037466 Bacteria 18791
284 Ga0395898_0770186 3300037466 Bacteria 903
285 Ga0436364_1511720 3300037853 Bacteria 1062
286 Ga0395901_0033819 3300038443 Bacteria 5278
287 Ga0395901_0632826 3300038443 Bacteria 1075
288 Ga0436363_0620657 3300039450 Bacteria 1570
289 Ga0436363_1581292 3300039450 Bacteria 2267
290 Ga0466969_0001880 3300044656 Bacteria 11227
291 Ga0466969_0020087 3300044656 Bacteria 3462
292 Ga0466969_0032077 3300044656 Bacteria 2672
293 Ga0466969_0076372 3300044656 Bacteria 1604
294 Ga0466972_0064030 3300044658 Bacteria 1760
295 Ga0466966_0004869 3300044684 Bacteria 8831
296 Ga0466966_0109560 3300044684 Bacteria 1703
297 Ga0466961_0001592 3300044693 Bacteria 14063
298 Ga0466961_0014649 3300044693 Bacteria 5037
299 Ga0466961_0041636 3300044693 Bacteria 2945
300 Ga0466961_0067505 3300044693 Bacteria 2272
301 Ga0466963_0045005 3300044694 Bacteria 2906
302 Ga0466963_0125115 3300044694 Bacteria 1772
303 Ga0466964_0059025 3300044706 Bacteria 1592
304 Ga0466964_0218985 3300044706 Bacteria 923
305 Ga0466971_0000708 3300044719 Bacteria 13328
306 Ga0466971_0011450 3300044719 Bacteria 3886
307 Ga0466970_0007842 3300044765 Bacteria 5361
308 Ga0466970_0030196 3300044765 Bacteria 2857
309 Ga0466970_0208413 3300044765 Bacteria 1088
310 Ga0466959_0005444 3300045049 Bacteria 8717
311 Ga0466959_0045279 3300045049 Bacteria 3240
312 Ga0466959_0150068 3300045049 Bacteria 1643
313 Ga0466959_0329066 3300045049 Bacteria 1044
314 Ga0451576_0291599 3300045051 Bacteria 1706
315 Ga0466958_0005577 3300045836 Bacteria 6787
316 Ga0466958_0012110 3300045836 Bacteria 4876
317 Ga0466967_0000302 3300045976 Bacteria 22184
318 Ga0466967_0120514 3300045976 Bacteria 2423
319 Ga0466967_0142747 3300045976 Bacteria 2232
320 Ga0495627_023531 3300046453 Bacteria 2017
321 Ga0495592_0028677 3300046454 Bacteria 4214
322 Ga0495592_0089964 3300046454 Bacteria 2203
323 Ga0495603_0122378 3300046455 Bacteria 1516
324 Ga0495629_0135584 3300046459 Eukaryota 1714
325 Ga0495651_0002170 3300046462 Bacteria 15172
326 Ga0495651_0014308 3300046462 Bacteria 6132
327 Ga0495651_0024651 3300046462 Bacteria 4679
328 Ga0495651_0069192 3300046462 Bacteria 2689
329 Ga0495662_0096941 3300046476 Bacteria 1441
330 Ga0495664_0034660 3300046477 Bacteria 2970
331 Ga0495628_0003141 3300046516 Bacteria 14825
332 Ga0495628_0016354 3300046516 Bacteria 6189
333 Ga0495632_0011529 3300046519 Bacteria 5153
334 Ga0495643_0001354 3300046522 Bacteria 22981
335 Ga0495652_0002134 3300046529 Bacteria 20849
336 Ga0495652_0006215 3300046529 Bacteria 11134
337 Ga0495652_0565762 3300046529 Bacteria 780
338 Ga0495665_0034680 3300046531 Bacteria 2698
339 Ga0495586_0075528 3300046535 Bacteria 1845
340 Ga0495586_0206041 3300046535 Bacteria 1115
341 Ga0495587_0007687 3300046536 Bacteria 6973
342 Ga0495587_0037919 3300046536 Bacteria 2892
343 Ga0495645_0019539 3300046543 Bacteria 4877
344 Ga0495645_0130966 3300046543 Bacteria 1757
345 Ga0495622_0037190 3300046557 Bacteria 2268
346 Ga0495667_0220675 3300046559 Bacteria 1210
347 Ga0495611_0203437 3300046648 Bacteria 923
348 Ga0495635_0066699 3300046663 Bacteria 2468
349 Ga0495599_0041512 3300046678 Bacteria 2888
350 Ga0495599_0153453 3300046678 Bacteria 1425
351 Ga0495623_0153808 3300046679 Bacteria 1357
352 Ga0495646_0029291 3300046680 Bacteria 3442
353 Ga0495646_0039541 3300046680 Bacteria 2907
354 Ga0495658_0118452 3300046683 Bacteria 1599
355 Ga0495670_0017718 3300046691 Bacteria 3507
356 Ga0495671_0149039 3300046692 Bacteria 1139
357 Ga0495600_0022655 3300046809 Bacteria 4035
358 Ga0495600_0033826 3300046809 Bacteria 3318
359 Ga0495600_0072658 3300046809 Bacteria 2246
360 Ga0495660_0007821 3300046810 Bacteria 6277
361 Ga0495581_0134781 3300047315 Bacteria 1440
362 Ga0495604_0094391 3300047317 Bacteria 2211
363 Ga0495636_0182833 3300047318 Bacteria 952
364 Ga0495674_0130410 3300047319 Bacteria 2118
365 Ga0495676_0033660 3300047321 Bacteria 4312
366 Ga0495683_0100023 3300047323 Bacteria 1395
367 Ga0495675_0087747 3300047444 Bacteria 1954
368 Ga0495685_001478 3300047447 Bacteria 7203
369 Ga0495681_0004552 3300047470 Bacteria 9452
370 Ga0495684_0288062 3300047471 Bacteria 1183
371 Ga0495686_0019434 3300047472 Bacteria 4538
372 Ga0495602_0110862 3300048088 Bacteria 2229
373 Ga0495602_0362284 3300048088 Bacteria 1043
374 Ga0496102_0060129 3300048905 Bacteria 3476
375 Ga0496102_0222732 3300048905 Bacteria 1779
376 Ga0496103_0116112 3300048906 Bacteria 1703
377 Ga0496103_0149361 3300048906 Bacteria 1496
378 Ga0496104_0002353 3300048907 Bacteria 16334
379 Ga0496104_0003341 3300048907 Bacteria 13849
380 Ga0496104_0067010 3300048907 Bacteria 3410
381 Ga0496104_0299420 3300048907 Bacteria 1520
382 Ga0496105_0027239 3300048908 Bacteria 4666
383 Ga0496105_0046604 3300048908 Bacteria 3578
384 Ga0496105_0322451 3300048908 Bacteria 1238
385 Ga0496106_0010972 3300048909 Bacteria 6698
386 Ga0496107_0032463 3300048910 Bacteria 3732
387 Ga0496107_0084221 3300048910 Bacteria 2320
388 Ga0496108_0195158 3300048911 Bacteria 1755
389 Ga0496108_0585080 3300048911 Bacteria 973
390 Ga0496109_0006637 3300048912 Bacteria 9745
391 Ga0496109_0025385 3300048912 Bacteria 5280
392 Ga0496109_0039260 3300048912 Bacteria 4284
393 Ga0496109_0680184 3300048912 Bacteria 966
394 Ga0496110_0008605 3300048913 Bacteria 8218
395 Ga0496110_0018142 3300048913 Bacteria 5895
396 Ga0496110_0045915 3300048913 Bacteria 3820
397 Ga0496110_0056839 3300048913 Bacteria 3443
398 Ga0496110_0147891 3300048913 Bacteria 2126
399 Ga0496111_0116939 3300048914 Bacteria 1966
400 Ga0496111_0150982 3300048914 Bacteria 1723
401 Ga0496111_0328802 3300048914 Bacteria 1132
402 Ga0496112_0006188 3300048915 Bacteria 10471
403 Ga0496112_0034549 3300048915 Bacteria 4920
404 Ga0496112_0059041 3300048915 Bacteria 3779
405 Ga0496114_0016328 3300048917 Bacteria 5979
406 Ga0496114_0101371 3300048917 Bacteria 2458
407 Ga0496114_0157432 3300048917 Bacteria 1973
408 Ga0496114_0160426 3300048917 Bacteria 1955
409 Ga0496114_0201822 3300048917 Bacteria 1742
410 Ga0496117_0010798 3300048920 Bacteria 8248
411 Ga0496119_0001775 3300048922 Bacteria 25125
412 Ga0496122_0000105 3300048925 Bacteria 194509
413 Ga0496122_0000594 3300048925 Bacteria 74393
414 Ga0496123_0000443 3300048926 Bacteria 74390
415 Ga0496124_0036142 3300048927 Bacteria 4313
416 Ga0496126_0073739 3300048929 Bacteria 3033
417 Ga0501031_0015990 3300049568 Bacteria 4872
418 Ga0501031_0059168 3300049568 Bacteria 2497
419 Ga0501031_0067936 3300049568 Bacteria 2321
420 Ga0501032_0011102 3300049569 Bacteria 6473
421 Ga0501032_0094728 3300049569 Bacteria 1979
422 Ga0501033_0000100 3300049570 Bacteria 82096
423 Ga0501033_0091553 3300049570 Bacteria 2224
424 Ga0501034_0137499 3300049571 Bacteria 2424
425 Ga0501036_0089351 3300049572 Bacteria 2603
426 Ga0501036_0125174 3300049572 Bacteria 2170
427 Ga0501036_0155528 3300049572 Bacteria 1928
428 Ga0501037_0168544 3300049573 Bacteria 1558
429 Ga0501038_0003902 3300049574 Bacteria 13868
430 Ga0501038_0128799 3300049574 Bacteria 2080
431 Ga0501039_0027304 3300049575 Bacteria 4390
432 Ga0501039_0100225 3300049575 Bacteria 2260
433 Ga0501040_0005270 3300049576 Bacteria 8359
434 Ga0501040_0017549 3300049576 Bacteria 4751
435 Ga0501041_0045233 3300049577 Bacteria 2675
436 Ga0501041_0056253 3300049577 Bacteria 2403
437 Ga0501041_0171606 3300049577 Bacteria 1357
438 Ga0501042_0031090 3300049578 Bacteria 3777
439 Ga0501042_0121567 3300049578 Bacteria 1880
440 Ga0501043_0061264 3300049579 Bacteria 2955
441 Ga0501043_0083181 3300049579 Bacteria 2516
442 Ga0501046_0030750 3300049580 Bacteria 4357
443 Ga0501048_0051087 3300049582 Bacteria 2943
444 Ga0501048_0148915 3300049582 Bacteria 1655
445 Ga0501068_0114106 3300049584 Bacteria 1682
446 Ga0501069_0001065 3300049585 Bacteria 13167
447 Ga0501069_0045985 3300049585 Bacteria 2420
448 Ga0501069_0070399 3300049585 Bacteria 1959
449 Ga0501070_0002795 3300049586 Bacteria 15236
450 Ga0501070_0003281 3300049586 Bacteria 14039
451 Ga0501070_0005528 3300049586 Bacteria 10778
452 Ga0501070_0006518 3300049586 Bacteria 9928
453 Ga0501071_0128417 3300049587 Bacteria 1882
454 Ga0501072_0056965 3300049588 Bacteria 3079
455 Ga0501072_0200152 3300049588 Bacteria 1592
456 Ga0501073_0053756 3300049589 Bacteria 2819
457 Ga0501073_0255355 3300049589 Bacteria 1210
458 Ga0501074_0002544 3300049590 Bacteria 12719
459 Ga0501074_0023639 3300049590 Bacteria 4467
460 Ga0501075_0055413 3300049591 Bacteria 2983
461 Ga0501076_0012283 3300049592 Bacteria 6403
462 Ga0501079_0000567 3300049741 Bacteria 24344
463 Ga0501079_0287937 3300049741 Bacteria 1284
464 Ga0501080_0001441 3300049742 Bacteria 20013
465 Ga0501080_0007921 3300049742 Bacteria 9623
466 Ga0501080_0161366 3300049742 Bacteria 2070
467 Ga0501080_0165736 3300049742 Bacteria 2039
468 Ga0501080_0298371 3300049742 Bacteria 1462
469 Ga0501080_0330746 3300049742 Bacteria 1378
470 Ga0501081_0138079 3300049743 Bacteria 1746
471 Ga0501083_0006854 3300049744 Bacteria 8086
472 Ga0501083_0362077 3300049744 Bacteria 943
473 Ga0501035_0011075 3300049822 Bacteria 8351
474 Ga0501035_0061068 3300049822 Bacteria 3355
475 Ga0501035_0130827 3300049822 Bacteria 2188
476 Ga0501044_0000584 3300049823 Bacteria 44238
477 Ga0501044_0009248 3300049823 Bacteria 10761
478 Ga0501044_0120043 3300049823 Bacteria 2631
479 Ga0501044_0133907 3300049823 Bacteria 2471
480 Ga0501044_0519278 3300049823 Bacteria 1091
481 Ga0501045_0014385 3300049824 Bacteria 5607
482 Ga0501045_0055200 3300049824 Bacteria 2905
483 nmdc:mga0yw44_28225_c1 3300050492 Bacteria 3226
484 nmdc:mga0yw44_80620_c1 3300050492 Bacteria 2039
485 nmdc:mga06z11_41021_c1 3300050494 Bacteria 2314
486 nmdc:mga05p37_217800_c1 3300050507 Bacteria 2305
487 nmdc:mga08y16_291276_c1 3300050511 Bacteria 1683
488 nmdc:mga08y16_58375_c1 3300050511 Bacteria 4032
489 nmdc:mga0n895_18420_c1 3300050512 Bacteria 6462
490 nmdc:mga0n895_262644_c1 3300050512 Bacteria 1752
491 nmdc:mga0n895_96510_c1 3300050512 Bacteria 2961
492 nmdc:mga0rr50_109209_c1 3300050513 Bacteria 2186
493 nmdc:mga08x19_49366_c1 3300050514 Bacteria 2698
494 nmdc:mga08x19_49748_c1 3300050514 Bacteria 2689
495 nmdc:mga0a205_4982_c2 3300050515 Bacteria 5650
496 Ga0495601_0005892 3300053077 Bacteria 7147
497 Ga0495601_0098585 3300053077 Bacteria 1886
498 Ga0500610_0128275 3300053079 Bacteria 1292
499 Ga0495655_0022930 3300053083 Bacteria 1433
500 Ga0495595_0008052 3300053084 Bacteria 4320
501 Ga0495595_0122333 3300053084 Bacteria 1268
502 Ga0495619_0164255 3300053085 Bacteria 1534
503 Ga0495619_0212016 3300053085 Bacteria 1341
504 Ga0500578_0010550 3300053086 Bacteria 5969
505 Ga0500566_0002355 3300053094 Bacteria 11187
506 Ga0500641_0003931 3300053096 Bacteria 5250
507 Ga0500654_029460 3300053099 Bacteria 3330
508 Ga0500580_078364 3300053113 Bacteria 1345
509 Ga0500614_041562 3300053123 Bacteria 1171
510 Ga0500628_028442 3300053129 Bacteria 1193
511 Ga0500658_0005630 3300053134 Bacteria 4662
512 Ga0500659_0002701 3300053135 Eukaryota 10606
513 Ga0500568_0000051 3300053139 Bacteria 112462
514 Ga0500568_0000120 3300053139 Bacteria 70393
515 Ga0500600_0008547 3300053149 Bacteria 6172
516 Ga0500616_0001077 3300053153 Bacteria 28519
517 Ga0500616_0003499 3300053153 Bacteria 11941
518 Ga0500633_0000641 3300053160 Bacteria 5823
519 Ga0500634_0014144 3300053161 Bacteria 4206
520 Ga0500656_000086 3300053732 Bacteria 5136
521 Ga0500587_000723 3300053739 Bacteria 4237
522 Ga0501084_0068581 3300054114 Bacteria 2969
523 Ga0501084_0356076 3300054114 Bacteria 1236
524 Ga0501082_0011356 3300060353 Bacteria 7658
525 Ga0501082_0097797 3300060353 Bacteria 2537
526 Ga0466962_0000547 3300061719 Bacteria 16568
527 Ga0466962_0015163 3300061719 Bacteria 3717
528 Ga0530510_0002161 3300061734 Bacteria 13479
529 2643997448 2643221597 Bacteria 3347721
530 2784473147 2784132109 Bacteria 3141763
531 2799182863 2799112218 Bacteria 4315149
532 2812364000 2811994880 Bacteria 4147780
533 2816421793 2816332119 Bacteria 8120218
534 2839987887 2839986021 Bacteria 3685650
535 2867476933 2867475112 Bacteria 6909112
536 2868091655 2868088558 Bacteria 7609351
537 2884996868 2884994152 Bacteria 4492978
538 2919471995 2919468124 Bacteria 9133025
539 2932431376 2932431166 Bacteria 4215299
540 2939661635 2939660829 Bacteria 3784848
541 2997604415 2997600082 Bacteria 9896405
542 3001890213 3001889506 Bacteria 2975194
543 8002813652 8002811521 Bacteria 2942897
544 Ga0070696_100001919
545 JGI24739J22299_10025304
546 Ga0007423J48922_100946
547 Ga0006562J51391_1095070
548 Ga0070683_100346513
549 Ga0070670_100023044
550 Ga0068869_100015673
551 Ga0070666_10217047
552 Ga0070680_100023257
553 Ga0070682_100053264
554 Ga0070660_100245698
555 Ga0070691_10020214
556 Ga0070691_10085573
557 Ga0070687_100094551
558 Ga0070661_100267314
559 Ga0070692_10007495
560 Ga0070675_100054631
561 Ga0070671_100013399
562 Ga0070671_100079304
563 Ga0070674_100359123
564 Ga0070673_100046604
565 Ga0070688_100050167
566 Ga0070659_100000776
567 Ga0070659_100250635
568 Ga0070709_10055727
569 Ga0070714_100042183
570 Ga0070713_100085194
571 Ga0070700_100000041
572 Ga0070700_100024524
573 Ga0070663_100016366
574 Ga0070678_100009289
575 Ga0070681_10053707
576 Ga0070681_10665799
577 Ga0068867_100254672
578 Ga0070707_100018432
579 Ga0070707_100268084
580 Ga0070698_100376992
581 Ga0070679_100015511
582 Ga0070679_100260448
583 Ga0070679_100272139
584 Ga0070679_100297180
585 Ga0070679_100410057
586 Ga0070684_100190771
587 Ga0068853_100091000
588 Ga0070693_100010114
589 Ga0070665_100025044
590 Ga0070665_100027824
591 Ga0068855_100005398
592 Ga0068855_100006885
593 Ga0068855_100013946
594 Ga0068855_100106710
595 Ga0068855_100147084
596 Ga0068857_100298661
597 Ga0068854_100001179
598 Ga0068854_100296071
599 Ga0068856_100011963
600 Ga0068856_100071920
601 Ga0068856_100379619
602 Ga0070702_100001566
603 Ga0070702_100196042
604 Ga0068852_100002958
605 Ga0068852_100093028
606 Ga0068852_100165000
607 Ga0068859_100018321
608 Ga0068864_100129380
609 Ga0068851_10012570
610 Ga0068870_10000054
611 Ga0068863_100047685
612 Ga0068863_100358771
613 Ga0068862_100321550
614 Ga0075365_10001930
615 Ga0075365_10010544
616 Ga0075365_10040239
617 Ga0075365_10080411
618 Ga0075364_10151181
619 Ga0075432_10012177
620 Ga0070716_100163066
621 Ga0075367_10006525
622 Ga0097621_100011796
623 Ga0068871_100040482
624 Ga0068871_100066171
625 Ga0075433_10021009
626 Ga0075434_100034189
627 Ga0075434_100081793
628 Ga0068865_100452318
629 Ga0075436_100009759
630 Ga0097620_100018321
631 Ga0075435_100000557
632 Ga0075435_100353561
633 Ga0105240_10010994
634 Ga0105240_10178705
635 Ga0105240_10202689
636 Ga0111539_10059203
637 Ga0105245_10060995
638 Ga0105245_10072445
639 Ga0105245_10141687
640 Ga0105247_10068025
641 Ga0114129_10154336
642 Ga0105243_10152643
643 Ga0105241_10005686
644 Ga0105241_10070753
645 Ga0105241_10102848
646 Ga0105242_10104733
647 Ga0105242_10208391
648 Ga0105248_10191857
649 Ga0105237_10056552
650 Ga0105237_10056940
651 Ga0105237_10069518
652 Ga0105237_10345786
653 Ga0105238_10002139
654 Ga0105249_10624876
655 Ga0105239_10043428
656 Ga0105239_10127054
657 Ga0105239_10437644
658 Ga0105246_10018883
659 Ga0105246_10340137
660 Ga0157373_10033532
661 Ga0157370_10004912
662 Ga0157370_10035549
663 Ga0157369_10007361
664 Ga0157369_10319661
665 Ga0157369_10406048
666 Ga0157374_10122184
667 Ga0157374_10229437
668 Ga0157378_10027006
669 Ga0157372_10017717
670 Ga0157372_10428251
671 Ga0157375_10022174
672 Ga0157375_10040586
673 Ga0157375_10311765
674 Ga0163163_10180850
675 Ga0163163_10228523
676 Ga0157380_10135373
677 Ga0182008_10020326
678 Ga0157377_10107980
679 Ga0157379_10027362
680 Ga0157379_10038490
681 Ga0157376_10004667
682 Ga0157376_10052486
683 Ga0206356_10599629
684 Ga0206353_10070396
685 Ga0206353_11172701
686 Ga0224712_10001001
687 Ga0224712_10090096
688 Ga0209646_1000202
689 Ga0207656_10001680
690 Ga0207692_10000253
691 Ga0207680_10034849
692 Ga0207647_10006126
693 Ga0207685_10091123
694 Ga0207699_10063591
695 Ga0207645_10012844
696 Ga0207643_10000972
697 Ga0207705_10073393
698 Ga0207654_10002485
699 Ga0207654_10050757
700 Ga0207654_10260567
701 Ga0207695_10002209
702 Ga0207695_10119295
703 Ga0207671_10000910
704 Ga0207671_10059215
705 Ga0207693_10118089
706 Ga0207693_10265739
707 Ga0207663_10239926
708 Ga0207660_10075793
709 Ga0207649_10133119
710 Ga0207652_10015663
711 Ga0207652_10235824
712 Ga0207652_10307457
713 Ga0207646_10025655
714 Ga0207646_10072870
715 Ga0207694_10000405
716 Ga0207694_10105466
717 Ga0207650_10040069
718 Ga0207659_10021222
719 Ga0207687_10021806
720 Ga0207687_10023155
721 Ga0207687_10069791
722 Ga0207700_10050607
723 Ga0207664_10156419
724 Ga0207664_10194569
725 Ga0207644_10031787
726 Ga0207690_10229197
727 Ga0207686_10038165
728 Ga0207686_10191703
729 Ga0207670_10014323
730 Ga0207704_10310599
731 Ga0207704_10401308
732 Ga0207665_10013384
733 Ga0207691_10054668
734 Ga0207689_10000818
735 Ga0207689_10072689
736 Ga0207661_10016235
737 Ga0207661_10115563
738 Ga0207661_10312669
739 Ga0207679_10010796
740 Ga0207667_10032894
741 Ga0207667_10038442
742 Ga0207667_10044125
743 Ga0207667_10309647
744 Ga0207667_10334754
745 Ga0207667_10342596
746 Ga0207712_10331282
747 Ga0207640_10066106
748 Ga0207640_10149400
749 Ga0207677_10004691
750 Ga0207677_10501916
751 Ga0207703_10442995
752 Ga0207639_10063529
753 Ga0207678_10000468
754 Ga0207678_10095833
755 Ga0207708_10000036
756 Ga0207708_10040493
757 Ga0207702_10000541
758 Ga0207702_10027831
759 Ga0207702_10231438
760 Ga0207641_10078498
761 Ga0207648_10137332
762 Ga0207676_10006524
763 Ga0207674_10059901
764 Ga0207675_100237337
765 Ga0207683_10005467
766 Ga0207698_10004256
767 Ga0207698_10009218
768 Ga0207428_10068101
769 Ga0268266_10036974
770 Ga0268265_10469702
771 Ga0268264_10527409
772 Ga0307517_10006780
773 Ga0307517_10117968
774 Ga0307515_10226581
775 Ga0265338_10079398
776 Ga0307512_10126147
777 Ga0316181_1237623
778 Ga0265330_10001427
779 Ga0265325_10000171
780 Ga0265325_10070730
781 Ga0265340_10028506
782 Ga0265339_10005053
783 Ga0265339_10109694
784 Ga0265327_10034277
785 Ga0265316_10002273
786 Ga0307509_10066732
787 Ga0265313_10141239
788 Ga0307514_10000339
789 Ga0307514_10068773
790 Ga0316575_10000001
791 Ga0265342_10001775
792 Ga0265342_10102639
793 Ga0316576_10026852
794 Ga0316576_10119676
795 Ga0316576_10178402
796 Ga0316578_10080215
797 Ga0316578_10114535
798 Ga0316578_10132442
799 Ga0316577_10014239
800 Ga0307409_100177257
801 Ga0307411_10569815
802 Ga0307507_10000002
803 Ga0307510_10138313
804 Ga0307510_10266310
805 Ga0373930_0000430
806 Ga0373928_0000923
807 Ga0373929_0002674
808 Ga0373932_0000283
809 Ga0373946_0039829
810 Ga0316574_0038072
811 Ga0316574_0182159
812 Ga0373924_0009781
813 Ga0373931_0000006
814 Ga0373931_0000064
815 Ga0373933_0013745
816 Ga0373937_0051878
817 Ga0316582_0023704
818 Ga0316582_0038396
819 Ga0316584_0017038
820 Ga0316584_0036943
821 Ga0316584_0056968
822 Ga0316584_0249865
823 Ga0316584_0406761
824 Ga0395900_0277743
825 Ga0395900_0303203
826 Ga0395898_0003103
827 Ga0395898_0770186
828 Ga0436364_1511720
829 Ga0395901_0033819
830 Ga0395901_0632826
831 Ga0436363_0620657
832 Ga0436363_1581292
833 Ga0466969_0001880
834 Ga0466969_0020087
835 Ga0466969_0032077
836 Ga0466969_0076372
837 Ga0466972_0064030
838 Ga0466966_0004869
839 Ga0466966_0109560
840 Ga0466961_0001592
841 Ga0466961_0014649
842 Ga0466961_0041636
843 Ga0466961_0067505
844 Ga0466963_0045005
845 Ga0466963_0125115
846 Ga0466964_0059025
847 Ga0466964_0218985
848 Ga0466971_0000708
849 Ga0466971_0011450
850 Ga0466970_0007842
851 Ga0466970_0030196
852 Ga0466970_0208413
853 Ga0466959_0005444
854 Ga0466959_0045279
855 Ga0466959_0150068
856 Ga0466959_0329066
857 Ga0451576_0291599
858 Ga0466958_0005577
859 Ga0466958_0012110
860 Ga0466967_0000302
861 Ga0466967_0120514
862 Ga0466967_0142747
863 Ga0495627_023531
864 Ga0495592_0028677
865 Ga0495592_0089964
866 Ga0495603_0122378
867 Ga0495629_0135584
868 Ga0495651_0002170
869 Ga0495651_0014308
870 Ga0495651_0024651
871 Ga0495651_0069192
872 Ga0495662_0096941
873 Ga0495664_0034660
874 Ga0495628_0003141
875 Ga0495628_0016354
876 Ga0495632_0011529
877 Ga0495643_0001354
878 Ga0495652_0002134
879 Ga0495652_0006215
880 Ga0495652_0565762
881 Ga0495665_0034680
882 Ga0495586_0075528
883 Ga0495586_0206041
884 Ga0495587_0007687
885 Ga0495587_0037919
886 Ga0495645_0019539
887 Ga0495645_0130966
888 Ga0495622_0037190
889 Ga0495667_0220675
890 Ga0495611_0203437
891 Ga0495635_0066699
892 Ga0495599_0041512
893 Ga0495599_0153453
894 Ga0495623_0153808
895 Ga0495646_0029291
896 Ga0495646_0039541
897 Ga0495658_0118452
898 Ga0495670_0017718
899 Ga0495671_0149039
900 Ga0495600_0022655
901 Ga0495600_0033826
902 Ga0495600_0072658
903 Ga0495660_0007821
904 Ga0495581_0134781
905 Ga0495604_0094391
906 Ga0495636_0182833
907 Ga0495674_0130410
908 Ga0495676_0033660
909 Ga0495683_0100023
910 Ga0495675_0087747
911 Ga0495685_001478
912 Ga0495681_0004552
913 Ga0495684_0288062
914 Ga0495686_0019434
915 Ga0495602_0110862
916 Ga0495602_0362284
917 Ga0496102_0060129
918 Ga0496102_0222732
919 Ga0496103_0116112
920 Ga0496103_0149361
921 Ga0496104_0002353
922 Ga0496104_0003341
923 Ga0496104_0067010
924 Ga0496104_0299420
925 Ga0496105_0027239
926 Ga0496105_0046604
927 Ga0496105_0322451
928 Ga0496106_0010972
929 Ga0496107_0032463
930 Ga0496107_0084221
931 Ga0496108_0195158
932 Ga0496108_0585080
933 Ga0496109_0006637
934 Ga0496109_0025385
935 Ga0496109_0039260
936 Ga0496109_0680184
937 Ga0496110_0008605
938 Ga0496110_0018142
939 Ga0496110_0045915
940 Ga0496110_0056839
941 Ga0496110_0147891
942 Ga0496111_0116939
943 Ga0496111_0150982
944 Ga0496111_0328802
945 Ga0496112_0006188
946 Ga0496112_0034549
947 Ga0496112_0059041
948 Ga0496114_0016328
949 Ga0496114_0101371
950 Ga0496114_0157432
951 Ga0496114_0160426
952 Ga0496114_0201822
953 Ga0496117_0010798
954 Ga0496119_0001775
955 Ga0496122_0000105
956 Ga0496122_0000594
957 Ga0496123_0000443
958 Ga0496124_0036142
959 Ga0496126_0073739
960 Ga0501031_0015990
961 Ga0501031_0059168
962 Ga0501031_0067936
963 Ga0501032_0011102
964 Ga0501032_0094728
965 Ga0501033_0000100
966 Ga0501033_0091553
967 Ga0501034_0137499
968 Ga0501036_0089351
969 Ga0501036_0125174
970 Ga0501036_0155528
971 Ga0501037_0168544
972 Ga0501038_0003902
973 Ga0501038_0128799
974 Ga0501039_0027304
975 Ga0501039_0100225
976 Ga0501040_0005270
977 Ga0501040_0017549
978 Ga0501041_0045233
979 Ga0501041_0056253
980 Ga0501041_0171606
981 Ga0501042_0031090
982 Ga0501042_0121567
983 Ga0501043_0061264
984 Ga0501043_0083181
985 Ga0501046_0030750
986 Ga0501048_0051087
987 Ga0501048_0148915
988 Ga0501068_0114106
989 Ga0501069_0001065
990 Ga0501069_0045985
991 Ga0501069_0070399
992 Ga0501070_0002795
993 Ga0501070_0003281
994 Ga0501070_0005528
995 Ga0501070_0006518
996 Ga0501071_0128417
997 Ga0501072_0056965
998 Ga0501072_0200152
999 Ga0501073_0053756
1000 Ga0501073_0255355
1001 Ga0501074_0002544
1002 Ga0501074_0023639
1003 Ga0501075_0055413
1004 Ga0501076_0012283
1005 Ga0501079_0000567
1006 Ga0501079_0287937
1007 Ga0501080_0001441
1008 Ga0501080_0007921
1009 Ga0501080_0161366
1010 Ga0501080_0165736
1011 Ga0501080_0298371
1012 Ga0501080_0330746
1013 Ga0501081_0138079
1014 Ga0501083_0006854
1015 Ga0501083_0362077
1016 Ga0501035_0011075
1017 Ga0501035_0061068
1018 Ga0501035_0130827
1019 Ga0501044_0000584
1020 Ga0501044_0009248
1021 Ga0501044_0120043
1022 Ga0501044_0133907
1023 Ga0501044_0519278
1024 Ga0501045_0014385
1025 Ga0501045_0055200
1026 nmdc:mga0yw44_28225_c1
1027 nmdc:mga0yw44_80620_c1
1028 nmdc:mga06z11_41021_c1
1029 nmdc:mga05p37_217800_c1
1030 nmdc:mga08y16_291276_c1
1031 nmdc:mga08y16_58375_c1
1032 nmdc:mga0n895_18420_c1
1033 nmdc:mga0n895_262644_c1
1034 nmdc:mga0n895_96510_c1
1035 nmdc:mga0rr50_109209_c1
1036 nmdc:mga08x19_49366_c1
1037 nmdc:mga08x19_49748_c1
1038 nmdc:mga0a205_4982_c2
1039 Ga0495601_0005892
1040 Ga0495601_0098585
1041 Ga0500610_0128275
1042 Ga0495655_0022930
1043 Ga0495595_0008052
1044 Ga0495595_0122333
1045 Ga0495619_0164255
1046 Ga0495619_0212016
1047 Ga0500578_0010550
1048 Ga0500566_0002355
1049 Ga0500641_0003931
1050 Ga0500654_029460
1051 Ga0500580_078364
1052 Ga0500614_041562
1053 Ga0500628_028442
1054 Ga0500658_0005630
1055 Ga0500659_0002701
1056 Ga0500568_0000051
1057 Ga0500568_0000120
1058 Ga0500600_0008547
1059 Ga0500616_0001077
1060 Ga0500616_0003499
1061 Ga0500633_0000641
1062 Ga0500634_0014144
1063 Ga0500656_000086
1064 Ga0500587_000723
1065 Ga0501084_0068581
1066 Ga0501084_0356076
1067 Ga0501082_0011356
1068 Ga0501082_0097797
1069 Ga0466962_0000547
1070 Ga0466962_0015163
1071 Ga0530510_0002161
1072 2643997448
1073 2784473147
1074 2799182863
1075 2812364000
1076 2816421793
1077 2839987887
1078 2867476933
1079 2868091655
1080 2884996868
1081 2919471995
1082 2932431376
1083 2939661635
1084 2997604415
1085 3001890213
1086 8002813652

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

44

300

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r9r-assembly1.cif.gz_A structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9558 8 289
6z0r-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 0.9543 6 288
6yya-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9525 6 288
6yyb-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.9515 6 288
6z0r-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 0.9256 6 288
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9859 96 238 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9658 96 238 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9653 96 239 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9462 96 239 3.30.470.20
af_P9WHN1_1_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9194 6 94 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3S4W3U4-F1-model_v4 deleted 0.9968 90 199
AF-A0A7K3MCS8-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9952 7 289 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A7Y9S3Y5-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9946 4 289 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-T1CG79-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9946 85 237 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2W5NBR4-F1-model_v4 deleted 0.9939 15 224

Map