F461475

General Info

Members Datasets Scaffolds Average Seq Length
542 214 1084 360

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10357146|Ga0111539_103571462
Length 384
Sequence MSEPAPNRSTIDALRADFRVRVAAAATDAALKALADEFLSRKSGTITGLMKTLGTLAPDVRREFGALVNGLKQEIETTVEERRVTLAASRPPADAVDVTLSPRVRPVGHAHPLMLVRQQVEDIFARMGYEILEGPEVEDDFHNFEALNMPPDHPARDMQDTLYLGSPIVGGTWGAHRSPVAGNHSIPIPAGKLAFSGNAPEAQVRAATLLRTHTSAMQIRYMKTFPPPVRIIVPGRVYRRDNLDLTHTPMFQQFEGLVVGEQVTMADLKGTFEAMLTALFGDVKIRLRPSFFPYTEPSAEVDISCHKCGGTGCAICKQTGWLEILGSGMVHPAVFEAVGYDSDRVTGFAFGMGIERVAMLKYGVEDIRLFYENDVRFLEQFPSI

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10357146 3300009094 Bacteria 1700
2 JGI24746J21847_1002154 3300001977 Bacteria 3149
3 JGI25406J46586_10002022 3300003203 Bacteria 9569
4 JGI25406J46586_10003040 3300003203 Bacteria 7907
5 Ga0065704_10001460 3300005289 Bacteria 9189
6 Ga0065712_10007799 3300005290 Bacteria 3795
7 Ga0065712_10017064 3300005290 Bacteria 1402
8 Ga0065712_10107138 3300005290 Bacteria 1902
9 Ga0065712_10161890 3300005290 Bacteria 1289
10 Ga0065715_10016329 3300005293 Bacteria 3639
11 Ga0065715_10106502 3300005293 Bacteria 2817
12 Ga0065715_10215457 3300005293 Bacteria 1281
13 Ga0065707_10005888 3300005295 Bacteria 4515
14 Ga0065707_10136815 3300005295 Bacteria 1829
15 Ga0070676_10012243 3300005328 Bacteria 4679
16 Ga0070683_100002401 3300005329 Bacteria 14875
17 Ga0070683_100013130 3300005329 Bacteria 7213
18 Ga0070690_100014556 3300005330 Bacteria 4669
19 Ga0070690_100121477 3300005330 Bacteria 1753
20 Ga0070670_100006873 3300005331 Bacteria 9640
21 Ga0070670_100023737 3300005331 Bacteria 5278
22 Ga0070670_100025005 3300005331 Bacteria 5138
23 Ga0070670_100052256 3300005331 Bacteria 3509
24 Ga0070670_100093217 3300005331 Bacteria 2590
25 Ga0070677_10001862 3300005333 Bacteria 6666
26 Ga0070677_10020298 3300005333 Bacteria 2419
27 Ga0070677_10030244 3300005333 Bacteria 2061
28 Ga0070677_10040108 3300005333 Bacteria 1841
29 Ga0068869_100001798 3300005334 Bacteria 12866
30 Ga0068869_100023322 3300005334 Bacteria 4272
31 Ga0070682_100209337 3300005337 Bacteria 1381
32 Ga0068868_100149248 3300005338 Bacteria 1924
33 Ga0070689_100016327 3300005340 Bacteria 5433
34 Ga0070689_100097162 3300005340 Bacteria 2329
35 Ga0070689_100193079 3300005340 Bacteria 1659
36 Ga0070689_100272507 3300005340 Bacteria 1402
37 Ga0070691_10088061 3300005341 Bacteria 1528
38 Ga0070661_100003093 3300005344 Bacteria 11453
39 Ga0070692_10010858 3300005345 Bacteria 4163
40 Ga0070669_100011635 3300005353 Bacteria 6242
41 Ga0070669_100016387 3300005353 Bacteria 5287
42 Ga0070669_100118277 3300005353 Bacteria 2018
43 Ga0070669_100147529 3300005353 Bacteria 1818
44 Ga0070675_100023149 3300005354 Bacteria 4963
45 Ga0070675_100028818 3300005354 Bacteria 4472
46 Ga0070675_100034119 3300005354 Bacteria 4128
47 Ga0070675_100037733 3300005354 Bacteria 3938
48 Ga0070675_100048659 3300005354 Bacteria 3477
49 Ga0070675_100064452 3300005354 Bacteria 3029
50 Ga0070675_100115824 3300005354 Bacteria 2272
51 Ga0070675_100117379 3300005354 Bacteria 2258
52 Ga0070675_100130577 3300005354 Bacteria 2140
53 Ga0070675_100148345 3300005354 Bacteria 2009
54 Ga0070675_100179806 3300005354 Bacteria 1828
55 Ga0070671_100049312 3300005355 Bacteria 3503
56 Ga0070671_100056819 3300005355 Bacteria 3256
57 Ga0070671_100070732 3300005355 Bacteria 2911
58 Ga0070671_100144742 3300005355 Bacteria 2006
59 Ga0070674_100007028 3300005356 Bacteria 6615
60 Ga0070674_100019646 3300005356 Bacteria 4296
61 Ga0070673_100012345 3300005364 Bacteria 5864
62 Ga0070673_100017612 3300005364 Bacteria 5086
63 Ga0070673_100020398 3300005364 Bacteria 4781
64 Ga0070673_100023787 3300005364 Bacteria 4481
65 Ga0070673_100036926 3300005364 Bacteria 3718
66 Ga0070673_100062141 3300005364 Bacteria 2966
67 Ga0070673_100112944 3300005364 Bacteria 2255
68 Ga0070688_100002841 3300005365 Bacteria 8825
69 Ga0070688_100025771 3300005365 Bacteria 3487
70 Ga0070688_100025815 3300005365 Bacteria 3484
71 Ga0070659_100014099 3300005366 Bacteria 5965
72 Ga0070667_100017876 3300005367 Bacteria 5877
73 Ga0070703_10041336 3300005406 Bacteria 1437
74 Ga0070713_100357686 3300005436 Bacteria 1356
75 Ga0070701_10002170 3300005438 Bacteria 7475
76 Ga0070701_10068040 3300005438 Bacteria 1896
77 Ga0070705_100010932 3300005440 Bacteria 4561
78 Ga0070705_100014483 3300005440 Bacteria 4058
79 Ga0070705_100068017 3300005440 Bacteria 2142
80 Ga0070700_100004598 3300005441 Bacteria 7224
81 Ga0070700_100051996 3300005441 Bacteria 2553
82 Ga0070694_100091689 3300005444 Bacteria 2133
83 Ga0070694_100132222 3300005444 Bacteria 1804
84 Ga0070663_100023782 3300005455 Bacteria 4112
85 Ga0070678_100178543 3300005456 Bacteria 1736
86 Ga0070678_100220387 3300005456 Bacteria 1576
87 Ga0070662_100156997 3300005457 Bacteria 1777
88 Ga0070681_10046630 3300005458 Bacteria 4332
89 Ga0070681_10047727 3300005458 Bacteria 4281
90 Ga0068867_100000147 3300005459 Bacteria 45184
91 Ga0068867_100001598 3300005459 Bacteria 15741
92 Ga0068867_100016910 3300005459 Bacteria 5183
93 Ga0068867_100169838 3300005459 Bacteria 1726
94 Ga0070685_10085001 3300005466 Bacteria 1905
95 Ga0070707_100042030 3300005468 Bacteria 4376
96 Ga0070707_100261118 3300005468 Bacteria 1685
97 Ga0070698_100003723 3300005471 Bacteria 16749
98 Ga0070699_100057136 3300005518 Bacteria 3380
99 Ga0070699_100060048 3300005518 Bacteria 3294
100 Ga0070699_100275192 3300005518 Bacteria 1507
101 Ga0070684_100010601 3300005535 Bacteria 7308
102 Ga0070672_100007611 3300005543 Bacteria 7367
103 Ga0070672_100018875 3300005543 Bacteria 4995
104 Ga0070672_100021261 3300005543 Bacteria 4745
105 Ga0070672_100066572 3300005543 Bacteria 2853
106 Ga0070672_100121740 3300005543 Bacteria 2136
107 Ga0070686_100109430 3300005544 Bacteria 1880
108 Ga0070695_100000425 3300005545 Bacteria 21837
109 Ga0070695_100068609 3300005545 Bacteria 2316
110 Ga0070695_100124265 3300005545 Bacteria 1770
111 Ga0070696_100003060 3300005546 Bacteria 11109
112 Ga0070696_100023176 3300005546 Bacteria 4219
113 Ga0070696_100040570 3300005546 Bacteria 3214
114 Ga0070693_100233205 3300005547 Bacteria 1212
115 Ga0070665_100041915 3300005548 Bacteria 4601
116 Ga0070665_100146938 3300005548 Bacteria 2360
117 Ga0070704_100009821 3300005549 Bacteria 5804
118 Ga0070704_100095308 3300005549 Bacteria 2228
119 Ga0070704_100302855 3300005549 Bacteria 1332
120 Ga0070664_100012481 3300005564 Bacteria 6908
121 Ga0070664_100025355 3300005564 Bacteria 4913
122 Ga0070664_100072181 3300005564 Bacteria 2960
123 Ga0068857_100036015 3300005577 Bacteria 4385
124 Ga0068857_100036969 3300005577 Bacteria 4325
125 Ga0068857_100149684 3300005577 Bacteria 2114
126 Ga0068857_100197415 3300005577 Bacteria 1834
127 Ga0068857_100456122 3300005577 Bacteria 1196
128 Ga0070702_100011065 3300005615 Bacteria 4476
129 Ga0068859_100021771 3300005617 Bacteria 6430
130 Ga0068859_100030802 3300005617 Bacteria 5384
131 Ga0068859_100036834 3300005617 Bacteria 4912
132 Ga0068859_100131480 3300005617 Bacteria 2574
133 Ga0068859_100193973 3300005617 Bacteria 2116
134 Ga0068864_100021793 3300005618 Bacteria 5368
135 Ga0068864_100036455 3300005618 Bacteria 4192
136 Ga0068864_100036507 3300005618 Bacteria 4189
137 Ga0068864_100152481 3300005618 Bacteria 2095
138 Ga0068866_10004193 3300005718 Bacteria 5916
139 Ga0068861_100038240 3300005719 Bacteria 3571
140 Ga0068861_100063093 3300005719 Bacteria 2847
141 Ga0068861_100083889 3300005719 Bacteria 2500
142 Ga0068861_100264949 3300005719 Bacteria 1473
143 Ga0068861_100323603 3300005719 Bacteria 1344
144 Ga0068870_10007223 3300005840 Bacteria 4947
145 Ga0068870_10037304 3300005840 Bacteria 2505
146 Ga0068870_10047579 3300005840 Bacteria 2255
147 Ga0068870_10164901 3300005840 Bacteria 1317
148 Ga0068863_100003088 3300005841 Bacteria 16457
149 Ga0068858_100018688 3300005842 Bacteria 6488
150 Ga0068858_100028053 3300005842 Bacteria 5231
151 Ga0068860_100049033 3300005843 Bacteria 4024
152 Ga0068860_100389930 3300005843 Bacteria 1376
153 Ga0068862_100001293 3300005844 Bacteria 23404
154 Ga0068862_100009919 3300005844 Bacteria 7865
155 Ga0068862_100192326 3300005844 Bacteria 1837
156 Ga0081455_10067398 3300005937 Bacteria 2983
157 Ga0081539_10000013 3300005985 Bacteria 432395
158 Ga0081539_10000164 3300005985 Bacteria 154639
159 Ga0081539_10002616 3300005985 Bacteria 24630
160 Ga0097621_100193662 3300006237 Bacteria 1762
161 Ga0075428_100005833 3300006844 Bacteria 13684
162 Ga0075428_100007143 3300006844 Bacteria 12372
163 Ga0075428_100009580 3300006844 Bacteria 10757
164 Ga0075428_100016765 3300006844 Bacteria 8090
165 Ga0075428_100039280 3300006844 Bacteria 5208
166 Ga0075428_100207692 3300006844 Bacteria 2116
167 Ga0075428_100393355 3300006844 Bacteria 1486
168 Ga0075430_100029837 3300006846 Bacteria 4629
169 Ga0075430_100036705 3300006846 Bacteria 4155
170 Ga0075430_100055131 3300006846 Bacteria 3343
171 Ga0075430_100140078 3300006846 Bacteria 2014
172 Ga0075431_100002953 3300006847 Bacteria 16460
173 Ga0075431_100030628 3300006847 Bacteria 5543
174 Ga0075431_100077110 3300006847 Bacteria 3440
175 Ga0075431_100159839 3300006847 Bacteria 2317
176 Ga0075431_100346787 3300006847 Bacteria 1493
177 Ga0075433_10005531 3300006852 Bacteria 9920
178 Ga0075433_10260955 3300006852 Bacteria 1536
179 Ga0075434_100012823 3300006871 Bacteria 7957
180 Ga0075434_100040917 3300006871 Bacteria 4589
181 Ga0075434_100047736 3300006871 Bacteria 4248
182 Ga0075434_100093066 3300006871 Bacteria 3017
183 Ga0075434_100127841 3300006871 Bacteria 2558
184 Ga0075434_100290828 3300006871 Bacteria 1654
185 Ga0075429_100052847 3300006880 Bacteria 3534
186 Ga0075429_100077306 3300006880 Bacteria 2900
187 Ga0075429_100350369 3300006880 Bacteria 1293
188 Ga0068865_100023016 3300006881 Bacteria 4073
189 Ga0097620_100021771 3300006931 Bacteria 6430
190 Ga0097620_100030802 3300006931 Bacteria 5384
191 Ga0097620_100036834 3300006931 Bacteria 4912
192 Ga0097620_100131478 3300006931 Bacteria 2574
193 Ga0097620_100193969 3300006931 Bacteria 2116
194 Ga0075435_100033100 3300007076 Bacteria 4085
195 Ga0075435_100075556 3300007076 Bacteria 2760
196 Ga0111539_10000044 3300009094 Bacteria 125347
197 Ga0111539_10000769 3300009094 Bacteria 41797
198 Ga0111539_10001774 3300009094 Bacteria 28680
199 Ga0111539_10005848 3300009094 Bacteria 15900
200 Ga0111539_10022822 3300009094 Bacteria 7686
201 Ga0111539_10031253 3300009094 Bacteria 6469
202 Ga0111539_10050548 3300009094 Bacteria 4952
203 Ga0111539_10064026 3300009094 Bacteria 4351
204 Ga0111539_10065854 3300009094 Bacteria 4280
205 Ga0111539_10084199 3300009094 Bacteria 3739
206 Ga0111539_10091543 3300009094 Bacteria 3573
207 Ga0111539_10092990 3300009094 Bacteria 3542
208 Ga0111539_10114192 3300009094 Bacteria 3168
209 Ga0111539_10136423 3300009094 Bacteria 2873
210 Ga0111539_10161074 3300009094 Bacteria 2624
211 Ga0114129_10000946 3300009147 Bacteria 37881
212 Ga0114129_10003198 3300009147 Bacteria 22984
213 Ga0114129_10021596 3300009147 Bacteria 9137
214 Ga0114129_10032110 3300009147 Bacteria 7422
215 Ga0114129_10055812 3300009147 Bacteria 5536
216 Ga0114129_10071328 3300009147 Bacteria 4844
217 Ga0114129_10081626 3300009147 Bacteria 4494
218 Ga0114129_10086953 3300009147 Bacteria 4335
219 Ga0114129_10093564 3300009147 Bacteria 4164
220 Ga0114129_10109975 3300009147 Bacteria 3804
221 Ga0114129_10110967 3300009147 Bacteria 3785
222 Ga0114129_10171565 3300009147 Bacteria 2957
223 Ga0114129_10183284 3300009147 Bacteria 2847
224 Ga0105243_10021050 3300009148 Bacteria 4949
225 Ga0105243_10376233 3300009148 Bacteria 1312
226 Ga0105243_10448978 3300009148 Bacteria 1209
227 Ga0105242_10005383 3300009176 Bacteria 9899
228 Ga0105242_10266391 3300009176 Bacteria 1550
229 Ga0105248_10023106 3300009177 Bacteria 6906
230 Ga0105237_10179750 3300009545 Bacteria 2116
231 Ga0105238_10064057 3300009551 Bacteria 3677
232 Ga0105249_10007748 3300009553 Bacteria 9358
233 Ga0105249_10024420 3300009553 Bacteria 5432
234 Ga0105246_10034464 3300011119 Bacteria 3374
235 Ga0157369_10444408 3300013105 Bacteria 1343
236 Ga0157374_10117776 3300013296 Bacteria 2560
237 Ga0157378_10725742 3300013297 Bacteria 1015
238 Ga0163162_10183599 3300013306 Bacteria 2218
239 Ga0163162_10276726 3300013306 Bacteria 1810
240 Ga0157375_10034635 3300013308 Bacteria 4812
241 Ga0163163_10012939 3300014325 Bacteria 7620
242 Ga0163163_10066445 3300014325 Bacteria 3582
243 Ga0163163_10072016 3300014325 Bacteria 3445
244 Ga0157380_10007538 3300014326 Bacteria 7732
245 Ga0157380_10247498 3300014326 Bacteria 1611
246 Ga0157377_10081105 3300014745 Bacteria 1897
247 Ga0157377_10155770 3300014745 Bacteria 1416
248 Ga0157379_10012177 3300014968 Bacteria 7513
249 Ga0157379_10116986 3300014968 Bacteria 2398
250 Ga0157379_10236882 3300014968 Bacteria 1655
251 Ga0157376_10052363 3300014969 Bacteria 3394
252 Ga0157376_10257073 3300014969 Bacteria 1634
253 Ga0163161_10011678 3300017792 Bacteria 6094
254 Ga0207697_10001668 3300025315 Bacteria 11987
255 Ga0207697_10016935 3300025315 Bacteria 2998
256 Ga0207697_10031298 3300025315 Bacteria 2176
257 Ga0207656_10027613 3300025321 Bacteria 2323
258 Ga0207682_10003228 3300025893 Bacteria 7131
259 Ga0207682_10007871 3300025893 Bacteria 4233
260 Ga0207682_10020044 3300025893 Bacteria 2623
261 Ga0207688_10000708 3300025901 Bacteria 16482
262 Ga0207688_10002335 3300025901 Bacteria 10191
263 Ga0207680_10065875 3300025903 Bacteria 2225
264 Ga0207680_10095036 3300025903 Bacteria 1904
265 Ga0207645_10000988 3300025907 Bacteria 23486
266 Ga0207645_10028480 3300025907 Bacteria 3606
267 Ga0207643_10004675 3300025908 Bacteria 7347
268 Ga0207643_10005747 3300025908 Bacteria 6632
269 Ga0207643_10016495 3300025908 Bacteria 4030
270 Ga0207643_10075501 3300025908 Bacteria 1945
271 Ga0207643_10155523 3300025908 Bacteria 1373
272 Ga0207707_10038632 3300025912 Bacteria 4171
273 Ga0207646_10067224 3300025922 Bacteria 3200
274 Ga0207681_10006266 3300025923 Bacteria 7301
275 Ga0207681_10008644 3300025923 Bacteria 6219
276 Ga0207681_10055949 3300025923 Bacteria 2689
277 Ga0207681_10162394 3300025923 Bacteria 1685
278 Ga0207694_10086305 3300025924 Bacteria 2471
279 Ga0207650_10045001 3300025925 Bacteria 3246
280 Ga0207650_10258450 3300025925 Bacteria 1412
281 Ga0207659_10000651 3300025926 Bacteria 20674
282 Ga0207659_10001472 3300025926 Bacteria 14038
283 Ga0207659_10006595 3300025926 Bacteria 7126
284 Ga0207659_10012074 3300025926 Bacteria 5477
285 Ga0207659_10034424 3300025926 Bacteria 3493
286 Ga0207659_10093318 3300025926 Bacteria 2252
287 Ga0207659_10094909 3300025926 Bacteria 2236
288 Ga0207700_10021459 3300025928 Bacteria 4410
289 Ga0207700_10131362 3300025928 Bacteria 2045
290 Ga0207644_10039844 3300025931 Bacteria 3318
291 Ga0207644_10058171 3300025931 Bacteria 2793
292 Ga0207644_10080046 3300025931 Bacteria 2412
293 Ga0207690_10304100 3300025932 Bacteria 1249
294 Ga0207706_10090803 3300025933 Bacteria 2685
295 Ga0207706_10127133 3300025933 Bacteria 2241
296 Ga0207706_10190708 3300025933 Bacteria 1799
297 Ga0207686_10002588 3300025934 Bacteria 9823
298 Ga0207686_10031032 3300025934 Bacteria 3170
299 Ga0207686_10089916 3300025934 Bacteria 2025
300 Ga0207709_10006511 3300025935 Bacteria 6560
301 Ga0207670_10042404 3300025936 Bacteria 2998
302 Ga0207669_10009606 3300025937 Bacteria 4620
303 Ga0207669_10045639 3300025937 Bacteria 2583
304 Ga0207669_10073866 3300025937 Bacteria 2154
305 Ga0207704_10010145 3300025938 Bacteria 4578
306 Ga0207691_10000604 3300025940 Bacteria 35804
307 Ga0207691_10001395 3300025940 Bacteria 24180
308 Ga0207691_10010694 3300025940 Bacteria 8809
309 Ga0207691_10014539 3300025940 Bacteria 7507
310 Ga0207691_10026356 3300025940 Bacteria 5454
311 Ga0207691_10047189 3300025940 Bacteria 3954
312 Ga0207691_10072093 3300025940 Bacteria 3116
313 Ga0207691_10203526 3300025940 Bacteria 1722
314 Ga0207691_10311523 3300025940 Bacteria 1351
315 Ga0207711_10225714 3300025941 Bacteria 1714
316 Ga0207689_10010879 3300025942 Bacteria 7825
317 Ga0207689_10013753 3300025942 Bacteria 6896
318 Ga0207689_10070922 3300025942 Bacteria 2862
319 Ga0207689_10092314 3300025942 Bacteria 2487
320 Ga0207661_10018217 3300025944 Bacteria 5215
321 Ga0207661_10052709 3300025944 Bacteria 3252
322 Ga0207661_10240026 3300025944 Bacteria 1608
323 Ga0207679_10027655 3300025945 Bacteria 3925
324 Ga0207679_10029155 3300025945 Bacteria 3840
325 Ga0207679_10054616 3300025945 Bacteria 2941
326 Ga0207679_10087865 3300025945 Bacteria 2395
327 Ga0207651_10008132 3300025960 Bacteria 5641
328 Ga0207651_10008268 3300025960 Bacteria 5610
329 Ga0207651_10023099 3300025960 Bacteria 3817
330 Ga0207651_10054686 3300025960 Bacteria 2737
331 Ga0207651_10090140 3300025960 Bacteria 2241
332 Ga0207651_10175010 3300025960 Bacteria 1696
333 Ga0207651_10182369 3300025960 Bacteria 1666
334 Ga0207651_10256540 3300025960 Bacteria 1433
335 Ga0207712_10006735 3300025961 Bacteria 7247
336 Ga0207640_10296602 3300025981 Bacteria 1277
337 Ga0207703_10006821 3300026035 Bacteria 9096
338 Ga0207703_10081384 3300026035 Bacteria 2699
339 Ga0207708_10001732 3300026075 Bacteria 16102
340 Ga0207708_10048628 3300026075 Bacteria 3229
341 Ga0207708_10106223 3300026075 Bacteria 2177
342 Ga0207708_10116844 3300026075 Bacteria 2075
343 Ga0207708_10246077 3300026075 Bacteria 1439
344 Ga0207641_10008163 3300026088 Bacteria 8664
345 Ga0207648_10000446 3300026089 Bacteria 45706
346 Ga0207648_10024313 3300026089 Bacteria 5410
347 Ga0207648_10064680 3300026089 Bacteria 3188
348 Ga0207648_10173891 3300026089 Bacteria 1904
349 Ga0207676_10016003 3300026095 Bacteria 5427
350 Ga0207676_10047424 3300026095 Bacteria 3330
351 Ga0207676_10169138 3300026095 Bacteria 1902
352 Ga0207674_10037800 3300026116 Bacteria 5016
353 Ga0207674_10045858 3300026116 Bacteria 4493
354 Ga0207674_10103761 3300026116 Bacteria 2822
355 Ga0207674_10173979 3300026116 Bacteria 2106
356 Ga0207675_100017763 3300026118 Bacteria 6635
357 Ga0207675_100031273 3300026118 Bacteria 4958
358 Ga0207675_100070306 3300026118 Bacteria 3271
359 Ga0207683_10004069 3300026121 Bacteria 12639
360 Ga0207683_10059414 3300026121 Bacteria 3359
361 Ga0207683_10167227 3300026121 Bacteria 1990
362 Ga0207428_10000224 3300027907 Bacteria 78533
363 Ga0207428_10000353 3300027907 Bacteria 59325
364 Ga0207428_10001721 3300027907 Bacteria 22410
365 Ga0207428_10001835 3300027907 Bacteria 21713
366 Ga0207428_10008446 3300027907 Bacteria 9296
367 Ga0207428_10030798 3300027907 Bacteria 4433
368 Ga0207428_10032811 3300027907 Bacteria 4270
369 Ga0207428_10067737 3300027907 Bacteria 2810
370 Ga0207428_10166772 3300027907 Bacteria 1669
371 Ga0268265_10000540 3300028380 Bacteria 38471
372 Ga0268265_10002938 3300028380 Bacteria 12483
373 Ga0268265_10101008 3300028380 Bacteria 2330
374 Ga0268265_10236797 3300028380 Bacteria 1608
375 Ga0268264_10029626 3300028381 Bacteria 4485
376 Ga0268264_10032323 3300028381 Bacteria 4293
377 Ga0307408_100011992 3300031548 Bacteria 5738
378 Ga0307408_100015053 3300031548 Bacteria 5147
379 Ga0307408_100072782 3300031548 Bacteria 2545
380 Ga0307405_10002732 3300031731 Bacteria 7900
381 Ga0307405_10162510 3300031731 Bacteria 1584
382 Ga0307413_10061054 3300031824 Bacteria 2324
383 Ga0307413_10162817 3300031824 Bacteria 1569
384 Ga0307410_10053565 3300031852 Bacteria 2731
385 Ga0307410_10061742 3300031852 Bacteria 2565
386 Ga0307410_10243746 3300031852 Bacteria 1394
387 Ga0307407_10144906 3300031903 Bacteria 1536
388 Ga0307412_10110594 3300031911 Bacteria 1961
389 Ga0307409_100003519 3300031995 Bacteria 8533
390 Ga0307416_100003715 3300032002 Bacteria 9048
391 Ga0307416_100053295 3300032002 Bacteria 3244
392 Ga0307416_100097829 3300032002 Bacteria 2543
393 Ga0307416_100177832 3300032002 Bacteria 1990
394 Ga0307416_100197918 3300032002 Bacteria 1903
395 Ga0307416_100202152 3300032002 Bacteria 1886
396 Ga0307414_10168487 3300032004 Bacteria 1748
397 Ga0307411_10003035 3300032005 Bacteria 7662
398 Ga0307411_10010188 3300032005 Bacteria 4997
399 Ga0307411_10029741 3300032005 Bacteria 3341
400 Ga0307415_100021726 3300032126 Bacteria 3951
401 Ga0307415_100226206 3300032126 Bacteria 1503
402 Ga0373960_0042032 3300035121 Bacteria 1326
403 Ga0373955_0122381 3300035172 Bacteria 1513
404 Ga0373931_0029182 3300035691 Bacteria 2830
405 Ga0373925_0148258 3300037068 Bacteria 1840
406 Ga0439439_0010403 3300041406 Bacteria 2223
407 Ga0439450_005527 3300042008 Bacteria 2228
408 Ga0451576_0064404 3300045051 Bacteria 3818
409 Ga0451576_0091701 3300045051 Bacteria 3160
410 Ga0451576_0160858 3300045051 Bacteria 2343
411 Ga0495603_0043077 3300046455 Bacteria 2697
412 Ga0495603_0074358 3300046455 Bacteria 1995
413 Ga0495603_0091057 3300046455 Bacteria 1783
414 Ga0495580_0128579 3300046472 Bacteria 1758
415 Ga0495584_0037723 3300046491 Bacteria 2443
416 Ga0495644_0038770 3300046523 Bacteria 1797
417 Ga0495663_0020985 3300046525 Bacteria 1878
418 Ga0495642_0003837 3300046528 Bacteria 5891
419 Ga0495621_0025606 3300046539 Bacteria 1983
420 Ga0495621_0036029 3300046539 Bacteria 1715
421 Ga0495659_0004725 3300046664 Bacteria 4288
422 Ga0495659_0037914 3300046664 Bacteria 1709
423 Ga0495588_0065596 3300046674 Bacteria 1884
424 Ga0495658_0104017 3300046683 Bacteria 1699
425 Ga0495669_0017754 3300046684 Bacteria 3055
426 Ga0495669_0054822 3300046684 Bacteria 1795
427 Ga0495670_0071233 3300046691 Bacteria 1760
428 Ga0495636_0009007 3300047318 Bacteria 3926
429 Ga0496101_0131205 3300048904 Bacteria 1903
430 Ga0496102_0044395 3300048905 Bacteria 4034
431 Ga0496102_0417863 3300048905 Bacteria 1260
432 Ga0496103_0082618 3300048906 Bacteria 2022
433 Ga0496104_0106375 3300048907 Bacteria 2688
434 Ga0496105_0072311 3300048908 Bacteria 2850
435 Ga0496106_0037659 3300048909 Bacteria 3619
436 Ga0496109_0419162 3300048912 Bacteria 1265
437 Ga0496112_0017105 3300048915 Bacteria 6807
438 Ga0501299_005378 3300049522 Bacteria 1966
439 Ga0501036_0021560 3300049572 Bacteria 5417
440 Ga0501038_0042160 3300049574 Bacteria 3976
441 Ga0501040_0026119 3300049576 Bacteria 3928
442 Ga0501040_0041028 3300049576 Bacteria 3151
443 Ga0501040_0046965 3300049576 Bacteria 2948
444 Ga0501041_0039206 3300049577 Bacteria 2875
445 Ga0501042_0021474 3300049578 Bacteria 4500
446 Ga0501042_0081457 3300049578 Bacteria 2320
447 Ga0501043_0033153 3300049579 Bacteria 4063
448 Ga0501046_0063411 3300049580 Bacteria 2886
449 Ga0501048_0122307 3300049582 Bacteria 1839
450 Ga0501071_0274778 3300049587 Bacteria 1274
451 Ga0501072_0027165 3300049588 Bacteria 4466
452 Ga0501072_0040600 3300049588 Bacteria 3654
453 Ga0501072_0053545 3300049588 Bacteria 3178
454 Ga0501074_0048832 3300049590 Bacteria 3057
455 Ga0501075_0007324 3300049591 Bacteria 7652
456 Ga0501076_0021385 3300049592 Bacteria 4962
457 Ga0501249_005081 3300049679 Bacteria 2688
458 Ga0501079_0047100 3300049741 Bacteria 3326
459 Ga0501079_0110659 3300049741 Bacteria 2134
460 Ga0501079_0125717 3300049741 Bacteria 1995
461 Ga0501081_0279769 3300049743 Bacteria 1221
462 Ga0501280_000034 3300049776 Bacteria 40552
463 Ga0501045_0012678 3300049824 Bacteria 5935
464 Ga0501045_0323140 3300049824 Bacteria 1148
465 nmdc:mga05p37_106228_c1 3300050507 Bacteria 3454
466 nmdc:mga05p37_11033_c1 3300050507 Bacteria 10735
467 nmdc:mga05p37_11275_c1 3300050507 Bacteria 10630
468 nmdc:mga05p37_119414_c1 3300050507 Bacteria 3239
469 nmdc:mga05p37_1351_c1 3300050507 Bacteria 28525
470 nmdc:mga05p37_165296_c1 3300050507 Bacteria 2701
471 nmdc:mga05p37_223577_c1 3300050507 Bacteria 2271
472 nmdc:mga05p37_324305_c1 3300050507 Bacteria 1822
473 nmdc:mga05p37_601147_c1 3300050507 Bacteria 1241
474 nmdc:mga05p37_64808_c1 3300050507 Bacteria 4496
475 nmdc:mga05p37_9387_c1 3300050507 Bacteria 11579
476 nmdc:mga05p37_99511_c1 3300050507 Bacteria 3581
477 nmdc:mga09592_18413_c1 3300050508 Bacteria 5728
478 nmdc:mga09592_290524_c1 3300050508 Bacteria 1417
479 nmdc:mga09592_36337_c1 3300050508 Bacteria 4125
480 nmdc:mga09592_50007_c1 3300050508 Bacteria 3525
481 nmdc:mga09592_53463_c1 3300050508 Bacteria 3410
482 nmdc:mga0qj67_118232_c1 3300050509 Bacteria 2143
483 nmdc:mga0qj67_1183_c1 3300050509 Bacteria 18079
484 nmdc:mga0qj67_175359_c1 3300050509 Bacteria 1741
485 nmdc:mga0qj67_2940_c1 3300050509 Bacteria 12221
486 nmdc:mga0qj67_6309_c1 3300050509 Bacteria 8704
487 nmdc:mga06r32_10017_c1 3300050510 Bacteria 8552
488 nmdc:mga06r32_13110_c1 3300050510 Bacteria 7504
489 nmdc:mga06r32_196640_c1 3300050510 Bacteria 2004
490 nmdc:mga06r32_231161_c1 3300050510 Bacteria 1837
491 nmdc:mga06r32_238601_c1 3300050510 Bacteria 1806
492 nmdc:mga06r32_238624_c1 3300050510 Bacteria 1806
493 nmdc:mga06r32_302052_c1 3300050510 Bacteria 1587
494 nmdc:mga08y16_13272_c1 3300050511 Bacteria 8664
495 nmdc:mga08y16_145333_c1 3300050511 Bacteria 2465
496 nmdc:mga08y16_145_c1 3300050511 Bacteria 61822
497 nmdc:mga08y16_185809_c1 3300050511 Bacteria 2157
498 nmdc:mga08y16_213356_c1 3300050511 Bacteria 1999
499 nmdc:mga08y16_221527_c1 3300050511 Bacteria 1958
500 nmdc:mga08y16_230710_c1 3300050511 Bacteria 1915
501 nmdc:mga08y16_338378_c1 3300050511 Bacteria 1547
502 nmdc:mga08y16_3594_c1 3300050511 Bacteria 16104
503 nmdc:mga08y16_41872_c1 3300050511 Bacteria 4797
504 nmdc:mga08y16_50440_c1 3300050511 Bacteria 4355
505 nmdc:mga08y16_50911_c1 3300050511 Bacteria 4334
506 nmdc:mga08y16_62709_c1 3300050511 Bacteria 3882
507 nmdc:mga08y16_7446_c1 3300050511 Bacteria 11466
508 nmdc:mga08y16_9502_c1 3300050511 Bacteria 10208
509 nmdc:mga08y16_9784_c1 3300050511 Bacteria 10064
510 nmdc:mga0n895_10349_c1 3300050512 Bacteria 8231
511 nmdc:mga0n895_245532_c1 3300050512 Bacteria 1817
512 nmdc:mga0n895_253118_c1 3300050512 Bacteria 1787
513 nmdc:mga0n895_29336_c1 3300050512 Bacteria 5246
514 nmdc:mga0rr50_116205_c1 3300050513 Bacteria 2124
515 nmdc:mga0rr50_31392_c1 3300050513 Bacteria 3772
516 nmdc:mga0rr50_62824_c1 3300050513 Bacteria 2803
517 nmdc:mga08x19_26092_c1 3300050514 Bacteria 3644
518 nmdc:mga0a205_744_c1 3300050515 Bacteria 26285
519 nmdc:mga0a205_8052_c1 3300050515 Bacteria 9580
520 nmdc:mga0a205_87468_c1 3300050515 Bacteria 3011
521 nmdc:mga0a205_9266_c1 3300050515 Bacteria 8992
522 Ga0495612_0032657 3300053078 Bacteria 2104
523 Ga0495619_0085375 3300053085 Bacteria 2132
524 Ga0500651_0110388 3300053093 Bacteria 1679
525 Ga0500555_000184 3300053103 Bacteria 28411
526 Ga0500616_0000100 3300053153 Bacteria 173477
527 Ga0500645_001139 3300053730 Bacteria 14408
528 Ga0501084_0002042 3300054114 Bacteria 16121
529 Ga0501084_0272930 3300054114 Bacteria 1428
530 Ga0590071_000324 3300059421 Bacteria 14000
531 Ga0590071_019828 3300059421 Bacteria 1583
532 Ga0590074_001711 3300059423 Bacteria 3585
533 Ga0590074_002223 3300059423 Bacteria 3185
534 Ga0590075_000187 3300059424 Bacteria 17295
535 Ga0590075_003895 3300059424 Bacteria 3536
536 Ga0590077_000049 3300059426 Bacteria 28044
537 Ga0590077_001294 3300059426 Bacteria 5957
538 Ga0501082_0097907 3300060353 Bacteria 2536
539 Ga0501082_0382413 3300060353 Bacteria 1228
540 Ga0530510_0008852 3300061734 Bacteria 7045
541 Ga0530510_0023005 3300061734 Bacteria 4441
542 Ga0530510_0238666 3300061734 Bacteria 1353
543 Ga0111539_10357146
544 JGI24746J21847_1002154
545 JGI25406J46586_10002022
546 JGI25406J46586_10003040
547 Ga0065704_10001460
548 Ga0065712_10007799
549 Ga0065712_10017064
550 Ga0065712_10107138
551 Ga0065712_10161890
552 Ga0065715_10016329
553 Ga0065715_10106502
554 Ga0065715_10215457
555 Ga0065707_10005888
556 Ga0065707_10136815
557 Ga0070676_10012243
558 Ga0070683_100002401
559 Ga0070683_100013130
560 Ga0070690_100014556
561 Ga0070690_100121477
562 Ga0070670_100006873
563 Ga0070670_100023737
564 Ga0070670_100025005
565 Ga0070670_100052256
566 Ga0070670_100093217
567 Ga0070677_10001862
568 Ga0070677_10020298
569 Ga0070677_10030244
570 Ga0070677_10040108
571 Ga0068869_100001798
572 Ga0068869_100023322
573 Ga0070682_100209337
574 Ga0068868_100149248
575 Ga0070689_100016327
576 Ga0070689_100097162
577 Ga0070689_100193079
578 Ga0070689_100272507
579 Ga0070691_10088061
580 Ga0070661_100003093
581 Ga0070692_10010858
582 Ga0070669_100011635
583 Ga0070669_100016387
584 Ga0070669_100118277
585 Ga0070669_100147529
586 Ga0070675_100023149
587 Ga0070675_100028818
588 Ga0070675_100034119
589 Ga0070675_100037733
590 Ga0070675_100048659
591 Ga0070675_100064452
592 Ga0070675_100115824
593 Ga0070675_100117379
594 Ga0070675_100130577
595 Ga0070675_100148345
596 Ga0070675_100179806
597 Ga0070671_100049312
598 Ga0070671_100056819
599 Ga0070671_100070732
600 Ga0070671_100144742
601 Ga0070674_100007028
602 Ga0070674_100019646
603 Ga0070673_100012345
604 Ga0070673_100017612
605 Ga0070673_100020398
606 Ga0070673_100023787
607 Ga0070673_100036926
608 Ga0070673_100062141
609 Ga0070673_100112944
610 Ga0070688_100002841
611 Ga0070688_100025771
612 Ga0070688_100025815
613 Ga0070659_100014099
614 Ga0070667_100017876
615 Ga0070703_10041336
616 Ga0070713_100357686
617 Ga0070701_10002170
618 Ga0070701_10068040
619 Ga0070705_100010932
620 Ga0070705_100014483
621 Ga0070705_100068017
622 Ga0070700_100004598
623 Ga0070700_100051996
624 Ga0070694_100091689
625 Ga0070694_100132222
626 Ga0070663_100023782
627 Ga0070678_100178543
628 Ga0070678_100220387
629 Ga0070662_100156997
630 Ga0070681_10046630
631 Ga0070681_10047727
632 Ga0068867_100000147
633 Ga0068867_100001598
634 Ga0068867_100016910
635 Ga0068867_100169838
636 Ga0070685_10085001
637 Ga0070707_100042030
638 Ga0070707_100261118
639 Ga0070698_100003723
640 Ga0070699_100057136
641 Ga0070699_100060048
642 Ga0070699_100275192
643 Ga0070684_100010601
644 Ga0070672_100007611
645 Ga0070672_100018875
646 Ga0070672_100021261
647 Ga0070672_100066572
648 Ga0070672_100121740
649 Ga0070686_100109430
650 Ga0070695_100000425
651 Ga0070695_100068609
652 Ga0070695_100124265
653 Ga0070696_100003060
654 Ga0070696_100023176
655 Ga0070696_100040570
656 Ga0070693_100233205
657 Ga0070665_100041915
658 Ga0070665_100146938
659 Ga0070704_100009821
660 Ga0070704_100095308
661 Ga0070704_100302855
662 Ga0070664_100012481
663 Ga0070664_100025355
664 Ga0070664_100072181
665 Ga0068857_100036015
666 Ga0068857_100036969
667 Ga0068857_100149684
668 Ga0068857_100197415
669 Ga0068857_100456122
670 Ga0070702_100011065
671 Ga0068859_100021771
672 Ga0068859_100030802
673 Ga0068859_100036834
674 Ga0068859_100131480
675 Ga0068859_100193973
676 Ga0068864_100021793
677 Ga0068864_100036455
678 Ga0068864_100036507
679 Ga0068864_100152481
680 Ga0068866_10004193
681 Ga0068861_100038240
682 Ga0068861_100063093
683 Ga0068861_100083889
684 Ga0068861_100264949
685 Ga0068861_100323603
686 Ga0068870_10007223
687 Ga0068870_10037304
688 Ga0068870_10047579
689 Ga0068870_10164901
690 Ga0068863_100003088
691 Ga0068858_100018688
692 Ga0068858_100028053
693 Ga0068860_100049033
694 Ga0068860_100389930
695 Ga0068862_100001293
696 Ga0068862_100009919
697 Ga0068862_100192326
698 Ga0081455_10067398
699 Ga0081539_10000013
700 Ga0081539_10000164
701 Ga0081539_10002616
702 Ga0097621_100193662
703 Ga0075428_100005833
704 Ga0075428_100007143
705 Ga0075428_100009580
706 Ga0075428_100016765
707 Ga0075428_100039280
708 Ga0075428_100207692
709 Ga0075428_100393355
710 Ga0075430_100029837
711 Ga0075430_100036705
712 Ga0075430_100055131
713 Ga0075430_100140078
714 Ga0075431_100002953
715 Ga0075431_100030628
716 Ga0075431_100077110
717 Ga0075431_100159839
718 Ga0075431_100346787
719 Ga0075433_10005531
720 Ga0075433_10260955
721 Ga0075434_100012823
722 Ga0075434_100040917
723 Ga0075434_100047736
724 Ga0075434_100093066
725 Ga0075434_100127841
726 Ga0075434_100290828
727 Ga0075429_100052847
728 Ga0075429_100077306
729 Ga0075429_100350369
730 Ga0068865_100023016
731 Ga0097620_100021771
732 Ga0097620_100030802
733 Ga0097620_100036834
734 Ga0097620_100131478
735 Ga0097620_100193969
736 Ga0075435_100033100
737 Ga0075435_100075556
738 Ga0111539_10000044
739 Ga0111539_10000769
740 Ga0111539_10001774
741 Ga0111539_10005848
742 Ga0111539_10022822
743 Ga0111539_10031253
744 Ga0111539_10050548
745 Ga0111539_10064026
746 Ga0111539_10065854
747 Ga0111539_10084199
748 Ga0111539_10091543
749 Ga0111539_10092990
750 Ga0111539_10114192
751 Ga0111539_10136423
752 Ga0111539_10161074
753 Ga0114129_10000946
754 Ga0114129_10003198
755 Ga0114129_10021596
756 Ga0114129_10032110
757 Ga0114129_10055812
758 Ga0114129_10071328
759 Ga0114129_10081626
760 Ga0114129_10086953
761 Ga0114129_10093564
762 Ga0114129_10109975
763 Ga0114129_10110967
764 Ga0114129_10171565
765 Ga0114129_10183284
766 Ga0105243_10021050
767 Ga0105243_10376233
768 Ga0105243_10448978
769 Ga0105242_10005383
770 Ga0105242_10266391
771 Ga0105248_10023106
772 Ga0105237_10179750
773 Ga0105238_10064057
774 Ga0105249_10007748
775 Ga0105249_10024420
776 Ga0105246_10034464
777 Ga0157369_10444408
778 Ga0157374_10117776
779 Ga0157378_10725742
780 Ga0163162_10183599
781 Ga0163162_10276726
782 Ga0157375_10034635
783 Ga0163163_10012939
784 Ga0163163_10066445
785 Ga0163163_10072016
786 Ga0157380_10007538
787 Ga0157380_10247498
788 Ga0157377_10081105
789 Ga0157377_10155770
790 Ga0157379_10012177
791 Ga0157379_10116986
792 Ga0157379_10236882
793 Ga0157376_10052363
794 Ga0157376_10257073
795 Ga0163161_10011678
796 Ga0207697_10001668
797 Ga0207697_10016935
798 Ga0207697_10031298
799 Ga0207656_10027613
800 Ga0207682_10003228
801 Ga0207682_10007871
802 Ga0207682_10020044
803 Ga0207688_10000708
804 Ga0207688_10002335
805 Ga0207680_10065875
806 Ga0207680_10095036
807 Ga0207645_10000988
808 Ga0207645_10028480
809 Ga0207643_10004675
810 Ga0207643_10005747
811 Ga0207643_10016495
812 Ga0207643_10075501
813 Ga0207643_10155523
814 Ga0207707_10038632
815 Ga0207646_10067224
816 Ga0207681_10006266
817 Ga0207681_10008644
818 Ga0207681_10055949
819 Ga0207681_10162394
820 Ga0207694_10086305
821 Ga0207650_10045001
822 Ga0207650_10258450
823 Ga0207659_10000651
824 Ga0207659_10001472
825 Ga0207659_10006595
826 Ga0207659_10012074
827 Ga0207659_10034424
828 Ga0207659_10093318
829 Ga0207659_10094909
830 Ga0207700_10021459
831 Ga0207700_10131362
832 Ga0207644_10039844
833 Ga0207644_10058171
834 Ga0207644_10080046
835 Ga0207690_10304100
836 Ga0207706_10090803
837 Ga0207706_10127133
838 Ga0207706_10190708
839 Ga0207686_10002588
840 Ga0207686_10031032
841 Ga0207686_10089916
842 Ga0207709_10006511
843 Ga0207670_10042404
844 Ga0207669_10009606
845 Ga0207669_10045639
846 Ga0207669_10073866
847 Ga0207704_10010145
848 Ga0207691_10000604
849 Ga0207691_10001395
850 Ga0207691_10010694
851 Ga0207691_10014539
852 Ga0207691_10026356
853 Ga0207691_10047189
854 Ga0207691_10072093
855 Ga0207691_10203526
856 Ga0207691_10311523
857 Ga0207711_10225714
858 Ga0207689_10010879
859 Ga0207689_10013753
860 Ga0207689_10070922
861 Ga0207689_10092314
862 Ga0207661_10018217
863 Ga0207661_10052709
864 Ga0207661_10240026
865 Ga0207679_10027655
866 Ga0207679_10029155
867 Ga0207679_10054616
868 Ga0207679_10087865
869 Ga0207651_10008132
870 Ga0207651_10008268
871 Ga0207651_10023099
872 Ga0207651_10054686
873 Ga0207651_10090140
874 Ga0207651_10175010
875 Ga0207651_10182369
876 Ga0207651_10256540
877 Ga0207712_10006735
878 Ga0207640_10296602
879 Ga0207703_10006821
880 Ga0207703_10081384
881 Ga0207708_10001732
882 Ga0207708_10048628
883 Ga0207708_10106223
884 Ga0207708_10116844
885 Ga0207708_10246077
886 Ga0207641_10008163
887 Ga0207648_10000446
888 Ga0207648_10024313
889 Ga0207648_10064680
890 Ga0207648_10173891
891 Ga0207676_10016003
892 Ga0207676_10047424
893 Ga0207676_10169138
894 Ga0207674_10037800
895 Ga0207674_10045858
896 Ga0207674_10103761
897 Ga0207674_10173979
898 Ga0207675_100017763
899 Ga0207675_100031273
900 Ga0207675_100070306
901 Ga0207683_10004069
902 Ga0207683_10059414
903 Ga0207683_10167227
904 Ga0207428_10000224
905 Ga0207428_10000353
906 Ga0207428_10001721
907 Ga0207428_10001835
908 Ga0207428_10008446
909 Ga0207428_10030798
910 Ga0207428_10032811
911 Ga0207428_10067737
912 Ga0207428_10166772
913 Ga0268265_10000540
914 Ga0268265_10002938
915 Ga0268265_10101008
916 Ga0268265_10236797
917 Ga0268264_10029626
918 Ga0268264_10032323
919 Ga0307408_100011992
920 Ga0307408_100015053
921 Ga0307408_100072782
922 Ga0307405_10002732
923 Ga0307405_10162510
924 Ga0307413_10061054
925 Ga0307413_10162817
926 Ga0307410_10053565
927 Ga0307410_10061742
928 Ga0307410_10243746
929 Ga0307407_10144906
930 Ga0307412_10110594
931 Ga0307409_100003519
932 Ga0307416_100003715
933 Ga0307416_100053295
934 Ga0307416_100097829
935 Ga0307416_100177832
936 Ga0307416_100197918
937 Ga0307416_100202152
938 Ga0307414_10168487
939 Ga0307411_10003035
940 Ga0307411_10010188
941 Ga0307411_10029741
942 Ga0307415_100021726
943 Ga0307415_100226206
944 Ga0373960_0042032
945 Ga0373955_0122381
946 Ga0373931_0029182
947 Ga0373925_0148258
948 Ga0439439_0010403
949 Ga0439450_005527
950 Ga0451576_0064404
951 Ga0451576_0091701
952 Ga0451576_0160858
953 Ga0495603_0043077
954 Ga0495603_0074358
955 Ga0495603_0091057
956 Ga0495580_0128579
957 Ga0495584_0037723
958 Ga0495644_0038770
959 Ga0495663_0020985
960 Ga0495642_0003837
961 Ga0495621_0025606
962 Ga0495621_0036029
963 Ga0495659_0004725
964 Ga0495659_0037914
965 Ga0495588_0065596
966 Ga0495658_0104017
967 Ga0495669_0017754
968 Ga0495669_0054822
969 Ga0495670_0071233
970 Ga0495636_0009007
971 Ga0496101_0131205
972 Ga0496102_0044395
973 Ga0496102_0417863
974 Ga0496103_0082618
975 Ga0496104_0106375
976 Ga0496105_0072311
977 Ga0496106_0037659
978 Ga0496109_0419162
979 Ga0496112_0017105
980 Ga0501299_005378
981 Ga0501036_0021560
982 Ga0501038_0042160
983 Ga0501040_0026119
984 Ga0501040_0041028
985 Ga0501040_0046965
986 Ga0501041_0039206
987 Ga0501042_0021474
988 Ga0501042_0081457
989 Ga0501043_0033153
990 Ga0501046_0063411
991 Ga0501048_0122307
992 Ga0501071_0274778
993 Ga0501072_0027165
994 Ga0501072_0040600
995 Ga0501072_0053545
996 Ga0501074_0048832
997 Ga0501075_0007324
998 Ga0501076_0021385
999 Ga0501249_005081
1000 Ga0501079_0047100
1001 Ga0501079_0110659
1002 Ga0501079_0125717
1003 Ga0501081_0279769
1004 Ga0501280_000034
1005 Ga0501045_0012678
1006 Ga0501045_0323140
1007 nmdc:mga05p37_106228_c1
1008 nmdc:mga05p37_11033_c1
1009 nmdc:mga05p37_11275_c1
1010 nmdc:mga05p37_119414_c1
1011 nmdc:mga05p37_1351_c1
1012 nmdc:mga05p37_165296_c1
1013 nmdc:mga05p37_223577_c1
1014 nmdc:mga05p37_324305_c1
1015 nmdc:mga05p37_601147_c1
1016 nmdc:mga05p37_64808_c1
1017 nmdc:mga05p37_9387_c1
1018 nmdc:mga05p37_99511_c1
1019 nmdc:mga09592_18413_c1
1020 nmdc:mga09592_290524_c1
1021 nmdc:mga09592_36337_c1
1022 nmdc:mga09592_50007_c1
1023 nmdc:mga09592_53463_c1
1024 nmdc:mga0qj67_118232_c1
1025 nmdc:mga0qj67_1183_c1
1026 nmdc:mga0qj67_175359_c1
1027 nmdc:mga0qj67_2940_c1
1028 nmdc:mga0qj67_6309_c1
1029 nmdc:mga06r32_10017_c1
1030 nmdc:mga06r32_13110_c1
1031 nmdc:mga06r32_196640_c1
1032 nmdc:mga06r32_231161_c1
1033 nmdc:mga06r32_238601_c1
1034 nmdc:mga06r32_238624_c1
1035 nmdc:mga06r32_302052_c1
1036 nmdc:mga08y16_13272_c1
1037 nmdc:mga08y16_145333_c1
1038 nmdc:mga08y16_145_c1
1039 nmdc:mga08y16_185809_c1
1040 nmdc:mga08y16_213356_c1
1041 nmdc:mga08y16_221527_c1
1042 nmdc:mga08y16_230710_c1
1043 nmdc:mga08y16_338378_c1
1044 nmdc:mga08y16_3594_c1
1045 nmdc:mga08y16_41872_c1
1046 nmdc:mga08y16_50440_c1
1047 nmdc:mga08y16_50911_c1
1048 nmdc:mga08y16_62709_c1
1049 nmdc:mga08y16_7446_c1
1050 nmdc:mga08y16_9502_c1
1051 nmdc:mga08y16_9784_c1
1052 nmdc:mga0n895_10349_c1
1053 nmdc:mga0n895_245532_c1
1054 nmdc:mga0n895_253118_c1
1055 nmdc:mga0n895_29336_c1
1056 nmdc:mga0rr50_116205_c1
1057 nmdc:mga0rr50_31392_c1
1058 nmdc:mga0rr50_62824_c1
1059 nmdc:mga08x19_26092_c1
1060 nmdc:mga0a205_744_c1
1061 nmdc:mga0a205_8052_c1
1062 nmdc:mga0a205_87468_c1
1063 nmdc:mga0a205_9266_c1
1064 Ga0495612_0032657
1065 Ga0495619_0085375
1066 Ga0500651_0110388
1067 Ga0500555_000184
1068 Ga0500616_0000100
1069 Ga0500645_001139
1070 Ga0501084_0002042
1071 Ga0501084_0272930
1072 Ga0590071_000324
1073 Ga0590071_019828
1074 Ga0590074_001711
1075 Ga0590074_002223
1076 Ga0590075_000187
1077 Ga0590075_003895
1078 Ga0590077_000049
1079 Ga0590077_001294
1080 Ga0501082_0097907
1081 Ga0501082_0382413
1082 Ga0530510_0008852
1083 Ga0530510_0023005
1084 Ga0530510_0238666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01409

tRNA-synt_2d

tRNA synthetases class II core domain (F)

95

381

0.98

PF02912

Phe_tRNA-synt_N

Aminoacyl tRNA synthetase class II, N-terminal domain

26

92

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.9163 97 363
4p75-assembly1.cif.gz_D phers in complex with compound 4a 0.912 97 363
4p73-assembly1.cif.gz_D phers in complex with compound 1a 0.9108 97 363
4p74-assembly1.cif.gz_D phers in complex with compound 3a 0.907 97 363
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.9012 97 363
ID Description Score Start End Superfamily
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9506 111 363 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9422 111 363 3.30.930.10
af_Q94K73_217_334_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8886 247 363 3.30.930.10
2rhsC00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8641 80 365 3.30.930.10
af_Q2QPD4_79_354_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8441 111 364 3.30.930.10
ID Description Score Start End GO Terms
AF-B0F4H5-F1-model_v4 phenylalanine--tRNA ligase (EC 6.1.1.20) 0.9872 210 334 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A0A5D0WGN2-F1-model_v4 deleted 0.9854 215 346
AF-G0LP40-F1-model_v4 Phenylalanine tRNA synthetase, alpha subunit 0.9808 190 327 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A1IUT1-F1-model_v4 Phenylalanyl-tRNA synthase alpha subunit (EC 6.1.1.20) 0.9795 190 326 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A0A3D1QB45-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha (EC 6.1.1.20) 0.9792 227 344 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740

Map