F461466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 329 | 539 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10004482|Ga0081455_1000448216 |
| Length | 247 |
| Sequence | MDARIKSGHDVSICARSSGLRHMPLIDLTRAHSAEPSKDCPLCPRLVQFRKDNRKAHPDWFNGAVPSFGPETARLLIVGLAPGLKGANRTGRPFLGDYAGELLYGTLLKVGLARGRHDPAAPQELELVDCMISNAVRCVPPANKPTPEEVGNCRQFLAGRIHALPELRAILALGRIAHDGVLDALQVRRRDFPFAHGARHVLLSGLLLFDSYHCSRQNTSTGRLTTPMFETVVSEVAASLRGPPETG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 3 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 203 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 204 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 307 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 312 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 314 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 316 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 317 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 318 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 320 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 322 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 324 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 329 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0 |
| Isolates | 0.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 0.37 |
| Rhizoplane | 9.04 |
| Rhizosphere | 84.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1806315 | 2162886007 | Bacteria | 1280 |
| 2 | SwRhRL2b_contig_2605276 | 2162886007 | Bacteria | 1147 |
| 3 | JGI24746J21847_1008036 | 3300001977 | Unclassified | 1601 |
| 4 | JGI24739J22299_10033922 | 3300001989 | Unclassified | 1742 |
| 5 | JGI24737J22298_10028612 | 3300001990 | Unclassified | 1751 |
| 6 | JGI24750J21931_1000903 | 3300002070 | Bacteria | 4032 |
| 7 | JGI24738J21930_10008109 | 3300002075 | Unclassified | 2398 |
| 8 | JGI25153J46596_10037647 | 3300003215 | Bacteria | 1535 |
| 9 | Ga0070658_10031372 | 3300005327 | Bacteria | 4267 |
| 10 | Ga0070676_10007925 | 3300005328 | Bacteria | 5710 |
| 11 | Ga0070690_100000780 | 3300005330 | Bacteria | 16166 |
| 12 | Ga0070690_100380366 | 3300005330 | Bacteria | 1032 |
| 13 | Ga0070670_100001837 | 3300005331 | Bacteria | 17301 |
| 14 | Ga0070677_10039552 | 3300005333 | Unclassified | 1851 |
| 15 | Ga0068869_100004906 | 3300005334 | Bacteria | 8371 |
| 16 | Ga0070666_10002181 | 3300005335 | Bacteria | 11896 |
| 17 | Ga0070680_100052784 | 3300005336 | Bacteria | 3317 |
| 18 | Ga0070682_100000868 | 3300005337 | Bacteria | 17634 |
| 19 | Ga0068868_100002238 | 3300005338 | Bacteria | 13379 |
| 20 | Ga0068868_100286232 | 3300005338 | Unclassified | 1396 |
| 21 | Ga0070660_100000822 | 3300005339 | Bacteria | 20602 |
| 22 | Ga0070689_100001665 | 3300005340 | Bacteria | 14184 |
| 23 | Ga0070691_10001014 | 3300005341 | Bacteria | 11527 |
| 24 | Ga0070687_100014448 | 3300005343 | Bacteria | 3547 |
| 25 | Ga0070661_100000197 | 3300005344 | Bacteria | 50071 |
| 26 | Ga0070692_10029717 | 3300005345 | Bacteria | 2726 |
| 27 | Ga0070668_100000339 | 3300005347 | Bacteria | 30929 |
| 28 | Ga0070669_100000542 | 3300005353 | Bacteria | 28160 |
| 29 | Ga0070675_100005758 | 3300005354 | Bacteria | 9479 |
| 30 | Ga0070671_100003157 | 3300005355 | Bacteria | 12848 |
| 31 | Ga0070674_100011081 | 3300005356 | Bacteria | 5473 |
| 32 | Ga0070673_100000612 | 3300005364 | Bacteria | 19530 |
| 33 | Ga0070688_100000119 | 3300005365 | Bacteria | 41289 |
| 34 | Ga0070659_100002119 | 3300005366 | Bacteria | 14126 |
| 35 | Ga0070667_100000028 | 3300005367 | Bacteria | 180376 |
| 36 | Ga0070667_100060908 | 3300005367 | Bacteria | 3195 |
| 37 | Ga0070667_100098848 | 3300005367 | Bacteria | 2518 |
| 38 | Ga0070709_10000481 | 3300005434 | Bacteria | 23495 |
| 39 | Ga0070714_100002193 | 3300005435 | Bacteria | 14373 |
| 40 | Ga0070713_100009063 | 3300005436 | Bacteria | 7097 |
| 41 | Ga0070713_100713526 | 3300005436 | Unclassified | 958 |
| 42 | Ga0070710_10001367 | 3300005437 | Bacteria | 11521 |
| 43 | Ga0070701_10000488 | 3300005438 | Bacteria | 13564 |
| 44 | Ga0070701_10039677 | 3300005438 | Bacteria | 2390 |
| 45 | Ga0070711_100000677 | 3300005439 | Bacteria | 17860 |
| 46 | Ga0070711_100016397 | 3300005439 | Bacteria | 4705 |
| 47 | Ga0070711_100234492 | 3300005439 | Bacteria | 1432 |
| 48 | Ga0070705_100000494 | 3300005440 | Bacteria | 22730 |
| 49 | Ga0070700_100003352 | 3300005441 | Bacteria | 8262 |
| 50 | Ga0070694_100021641 | 3300005444 | Bacteria | 4112 |
| 51 | Ga0070694_100579684 | 3300005444 | Bacteria | 901 |
| 52 | Ga0070663_100000855 | 3300005455 | Bacteria | 16513 |
| 53 | Ga0070678_100000183 | 3300005456 | Bacteria | 27374 |
| 54 | Ga0070662_100066073 | 3300005457 | Unclassified | 2653 |
| 55 | Ga0070662_100302037 | 3300005457 | Bacteria | 1301 |
| 56 | Ga0070681_10146084 | 3300005458 | Bacteria | 2294 |
| 57 | Ga0068867_100014445 | 3300005459 | Bacteria | 5597 |
| 58 | Ga0070698_100076013 | 3300005471 | Bacteria | 3362 |
| 59 | Ga0070699_100117932 | 3300005518 | Unclassified | 2333 |
| 60 | Ga0070679_100038121 | 3300005530 | Bacteria | 4778 |
| 61 | Ga0070684_100046137 | 3300005535 | Bacteria | 3775 |
| 62 | Ga0070697_100002769 | 3300005536 | Bacteria | 13494 |
| 63 | Ga0068853_100000537 | 3300005539 | Bacteria | 25735 |
| 64 | Ga0070672_100085295 | 3300005543 | Unclassified | 2538 |
| 65 | Ga0070672_100139993 | 3300005543 | Bacteria | 1995 |
| 66 | Ga0070686_100154702 | 3300005544 | Bacteria | 1609 |
| 67 | Ga0070686_100428489 | 3300005544 | Bacteria | 1012 |
| 68 | Ga0070695_100007432 | 3300005545 | Bacteria | 6499 |
| 69 | Ga0070695_100013353 | 3300005545 | Bacteria | 4934 |
| 70 | Ga0070695_100211989 | 3300005545 | Bacteria | 1391 |
| 71 | Ga0070696_100001626 | 3300005546 | Bacteria | 14749 |
| 72 | Ga0070693_100000106 | 3300005547 | Bacteria | 37502 |
| 73 | Ga0070665_100105925 | 3300005548 | Bacteria | 2814 |
| 74 | Ga0070704_100001004 | 3300005549 | Bacteria | 14418 |
| 75 | Ga0070704_100234108 | 3300005549 | Bacteria | 1500 |
| 76 | Ga0068855_100012257 | 3300005563 | Bacteria | 10361 |
| 77 | Ga0070664_100000182 | 3300005564 | Bacteria | 44467 |
| 78 | Ga0068857_100000505 | 3300005577 | Bacteria | 27976 |
| 79 | Ga0068854_100022193 | 3300005578 | Bacteria | 4320 |
| 80 | Ga0068856_100020684 | 3300005614 | Bacteria | 6393 |
| 81 | Ga0068856_100375434 | 3300005614 | Bacteria | 1441 |
| 82 | Ga0070702_100000684 | 3300005615 | Bacteria | 12743 |
| 83 | Ga0070702_100037692 | 3300005615 | Bacteria | 2685 |
| 84 | Ga0068852_100002310 | 3300005616 | Bacteria | 13102 |
| 85 | Ga0068852_100803384 | 3300005616 | Bacteria | 955 |
| 86 | Ga0068859_100005071 | 3300005617 | Bacteria | 13373 |
| 87 | Ga0068859_100412148 | 3300005617 | Bacteria | 1447 |
| 88 | Ga0068864_100150302 | 3300005618 | Bacteria | 2109 |
| 89 | Ga0068866_10003533 | 3300005718 | Bacteria | 6402 |
| 90 | Ga0068866_10085206 | 3300005718 | Bacteria | 1707 |
| 91 | Ga0068861_100000179 | 3300005719 | Bacteria | 33782 |
| 92 | Ga0068861_100012716 | 3300005719 | Bacteria | 5874 |
| 93 | Ga0068851_10010050 | 3300005834 | Bacteria | 4408 |
| 94 | Ga0068863_100014960 | 3300005841 | Bacteria | 7452 |
| 95 | Ga0068858_100005862 | 3300005842 | Bacteria | 11998 |
| 96 | Ga0068858_100032058 | 3300005842 | Bacteria | 4882 |
| 97 | Ga0068860_100001853 | 3300005843 | Bacteria | 22493 |
| 98 | Ga0068860_100214006 | 3300005843 | Bacteria | 1870 |
| 99 | Ga0068862_100001564 | 3300005844 | Bacteria | 20887 |
| 100 | Ga0068862_100202146 | 3300005844 | Bacteria | 1792 |
| 101 | Ga0068862_100210439 | 3300005844 | Bacteria | 1757 |
| 102 | Ga0081455_10004482 | 3300005937 | Bacteria | 15630 |
| 103 | Ga0070717_10027719 | 3300006028 | Bacteria | 4529 |
| 104 | Ga0070715_10000596 | 3300006163 | Bacteria | 9523 |
| 105 | Ga0070716_100000486 | 3300006173 | Bacteria | 16463 |
| 106 | Ga0070712_100007148 | 3300006175 | Bacteria | 6962 |
| 107 | Ga0070712_100042094 | 3300006175 | Bacteria | 3140 |
| 108 | Ga0070712_100381355 | 3300006175 | Bacteria | 1161 |
| 109 | Ga0097621_100391783 | 3300006237 | Bacteria | 1242 |
| 110 | Ga0068871_100051199 | 3300006358 | Unclassified | 3343 |
| 111 | Ga0075431_100423907 | 3300006847 | Unclassified | 1329 |
| 112 | Ga0075433_10370255 | 3300006852 | Bacteria | 1265 |
| 113 | Ga0075434_100052916 | 3300006871 | Bacteria | 4035 |
| 114 | Ga0075429_100012905 | 3300006880 | Bacteria | 7249 |
| 115 | Ga0068865_100001379 | 3300006881 | Bacteria | 14127 |
| 116 | Ga0068865_100220136 | 3300006881 | Bacteria | 1484 |
| 117 | Ga0097620_100005071 | 3300006931 | Bacteria | 13373 |
| 118 | Ga0097620_100412169 | 3300006931 | Bacteria | 1447 |
| 119 | Ga0105244_10092703 | 3300009036 | Unclassified | 1484 |
| 120 | Ga0105250_10011711 | 3300009092 | Unclassified | 3634 |
| 121 | Ga0111539_10001601 | 3300009094 | Bacteria | 30196 |
| 122 | Ga0111539_10206003 | 3300009094 | Bacteria | 2292 |
| 123 | Ga0105245_10024137 | 3300009098 | Bacteria | 5339 |
| 124 | Ga0105245_10992185 | 3300009098 | Bacteria | 884 |
| 125 | Ga0105247_10001527 | 3300009101 | Bacteria | 16538 |
| 126 | Ga0105247_10003457 | 3300009101 | Bacteria | 10297 |
| 127 | Ga0105247_10021733 | 3300009101 | Bacteria | 3861 |
| 128 | Ga0105247_10131204 | 3300009101 | Bacteria | 1633 |
| 129 | Ga0114129_10453078 | 3300009147 | Bacteria | 1682 |
| 130 | Ga0105243_10002927 | 3300009148 | Bacteria | 14121 |
| 131 | Ga0105243_10264163 | 3300009148 | Bacteria | 1542 |
| 132 | Ga0105243_10535022 | 3300009148 | Bacteria | 1117 |
| 133 | Ga0105241_10000695 | 3300009174 | Bacteria | 25382 |
| 134 | Ga0105241_10288873 | 3300009174 | Bacteria | 1403 |
| 135 | Ga0105242_10004028 | 3300009176 | Bacteria | 11421 |
| 136 | Ga0105242_10630185 | 3300009176 | Bacteria | 1040 |
| 137 | Ga0105248_10001513 | 3300009177 | Bacteria | 25875 |
| 138 | Ga0105248_10010219 | 3300009177 | Bacteria | 10334 |
| 139 | Ga0105237_10003743 | 3300009545 | Bacteria | 17920 |
| 140 | Ga0105237_10279611 | 3300009545 | Bacteria | 1672 |
| 141 | Ga0105237_10572911 | 3300009545 | Bacteria | 1136 |
| 142 | Ga0105237_11196233 | 3300009545 | Bacteria | 767 |
| 143 | Ga0105238_10123312 | 3300009551 | Bacteria | 2570 |
| 144 | Ga0105238_10351032 | 3300009551 | Bacteria | 1464 |
| 145 | Ga0105249_10001563 | 3300009553 | Bacteria | 20095 |
| 146 | Ga0105249_10009909 | 3300009553 | Bacteria | 8352 |
| 147 | Ga0105239_10008110 | 3300010375 | Bacteria | 11988 |
| 148 | Ga0105246_10000499 | 3300011119 | Bacteria | 21360 |
| 149 | Ga0105246_10067183 | 3300011119 | Bacteria | 2512 |
| 150 | Ga0105246_10283735 | 3300011119 | Bacteria | 1330 |
| 151 | Ga0157373_10004826 | 3300013100 | Bacteria | 10143 |
| 152 | Ga0157371_10002971 | 3300013102 | Bacteria | 15741 |
| 153 | Ga0157370_10040198 | 3300013104 | Bacteria | 4516 |
| 154 | Ga0157369_10007447 | 3300013105 | Bacteria | 12606 |
| 155 | Ga0157374_10015936 | 3300013296 | Bacteria | 6604 |
| 156 | Ga0157378_10000352 | 3300013297 | Bacteria | 45160 |
| 157 | Ga0157378_10073211 | 3300013297 | Bacteria | 3080 |
| 158 | Ga0163162_10021080 | 3300013306 | Bacteria | 6410 |
| 159 | Ga0163162_10560727 | 3300013306 | Bacteria | 1270 |
| 160 | Ga0157372_10004794 | 3300013307 | Bacteria | 14369 |
| 161 | Ga0157375_10024932 | 3300013308 | Bacteria | 5545 |
| 162 | Ga0157375_10025195 | 3300013308 | Bacteria | 5521 |
| 163 | Ga0163163_10004442 | 3300014325 | Bacteria | 11963 |
| 164 | Ga0163163_10028487 | 3300014325 | Bacteria | 5365 |
| 165 | Ga0163163_10280619 | 3300014325 | Bacteria | 1717 |
| 166 | Ga0157380_10117920 | 3300014326 | Bacteria | 2243 |
| 167 | Ga0157380_10715275 | 3300014326 | Bacteria | 1008 |
| 168 | Ga0182008_10036900 | 3300014497 | Bacteria | 2446 |
| 169 | Ga0182008_10093911 | 3300014497 | Bacteria | 1480 |
| 170 | Ga0157377_10003807 | 3300014745 | Bacteria | 6854 |
| 171 | Ga0157379_10000158 | 3300014968 | Bacteria | 50531 |
| 172 | Ga0157379_10017064 | 3300014968 | Bacteria | 6392 |
| 173 | Ga0157379_10063495 | 3300014968 | Bacteria | 3301 |
| 174 | Ga0157379_10066825 | 3300014968 | Bacteria | 3214 |
| 175 | Ga0157379_10163155 | 3300014968 | Bacteria | 2011 |
| 176 | Ga0157376_10000303 | 3300014969 | Bacteria | 33063 |
| 177 | Ga0157376_10110608 | 3300014969 | Bacteria | 2417 |
| 178 | Ga0163161_10006616 | 3300017792 | Bacteria | 8026 |
| 179 | Ga0163161_10019758 | 3300017792 | Bacteria | 4726 |
| 180 | Ga0163161_10206328 | 3300017792 | Bacteria | 1516 |
| 181 | Ga0213872_10017327 | 3300021361 | Bacteria | 3331 |
| 182 | Ga0207656_10042694 | 3300025321 | Unclassified | 1931 |
| 183 | Ga0207653_10104538 | 3300025885 | Unclassified | 1005 |
| 184 | Ga0207682_10069868 | 3300025893 | Unclassified | 1486 |
| 185 | Ga0207692_10002053 | 3300025898 | Bacteria | 7687 |
| 186 | Ga0207710_10004383 | 3300025900 | Bacteria | 6166 |
| 187 | Ga0207710_10032357 | 3300025900 | Bacteria | 2290 |
| 188 | Ga0207710_10056684 | 3300025900 | Bacteria | 1768 |
| 189 | Ga0207688_10000241 | 3300025901 | Bacteria | 24846 |
| 190 | Ga0207688_10162135 | 3300025901 | Bacteria | 1326 |
| 191 | Ga0207680_10049756 | 3300025903 | Unclassified | 2496 |
| 192 | Ga0207647_10001633 | 3300025904 | Bacteria | 17238 |
| 193 | Ga0207685_10000595 | 3300025905 | Bacteria | 6302 |
| 194 | Ga0207645_10028041 | 3300025907 | Bacteria | 3635 |
| 195 | Ga0207705_10031736 | 3300025909 | Bacteria | 3772 |
| 196 | Ga0207707_10124175 | 3300025912 | Bacteria | 2257 |
| 197 | Ga0207695_10537749 | 3300025913 | Bacteria | 1050 |
| 198 | Ga0207693_10000238 | 3300025915 | Bacteria | 50667 |
| 199 | Ga0207693_10433087 | 3300025915 | Bacteria | 1028 |
| 200 | Ga0207662_10002553 | 3300025918 | Bacteria | 9166 |
| 201 | Ga0207657_10000279 | 3300025919 | Bacteria | 54382 |
| 202 | Ga0207649_10005852 | 3300025920 | Bacteria | 6662 |
| 203 | Ga0207681_10025475 | 3300025923 | Bacteria | 3805 |
| 204 | Ga0207694_10198113 | 3300025924 | Unclassified | 1633 |
| 205 | Ga0207694_10253781 | 3300025924 | Bacteria | 1440 |
| 206 | Ga0207650_10021771 | 3300025925 | Unclassified | 4533 |
| 207 | Ga0207659_10059941 | 3300025926 | Unclassified | 2737 |
| 208 | Ga0207687_10013340 | 3300025927 | Bacteria | 5365 |
| 209 | Ga0207700_10021851 | 3300025928 | Bacteria | 4378 |
| 210 | Ga0207700_10112785 | 3300025928 | Bacteria | 2191 |
| 211 | Ga0207664_10015131 | 3300025929 | Bacteria | 5590 |
| 212 | Ga0207644_10017693 | 3300025931 | Bacteria | 4819 |
| 213 | Ga0207690_10001432 | 3300025932 | Bacteria | 14930 |
| 214 | Ga0207706_10000298 | 3300025933 | Bacteria | 53969 |
| 215 | Ga0207706_10399361 | 3300025933 | Bacteria | 1192 |
| 216 | Ga0207686_10075307 | 3300025934 | Unclassified | 2184 |
| 217 | Ga0207709_10001191 | 3300025935 | Bacteria | 18784 |
| 218 | Ga0207669_10061713 | 3300025937 | Bacteria | 2305 |
| 219 | Ga0207669_10179712 | 3300025937 | Unclassified | 1515 |
| 220 | Ga0207669_10261141 | 3300025937 | Bacteria | 1295 |
| 221 | Ga0207704_10013740 | 3300025938 | Bacteria | 4065 |
| 222 | Ga0207704_10122340 | 3300025938 | Bacteria | 1784 |
| 223 | Ga0207665_10000284 | 3300025939 | Bacteria | 35246 |
| 224 | Ga0207691_10085392 | 3300025940 | Unclassified | 2833 |
| 225 | Ga0207691_10382831 | 3300025940 | Bacteria | 1201 |
| 226 | Ga0207711_10026025 | 3300025941 | Bacteria | 4907 |
| 227 | Ga0207711_10063391 | 3300025941 | Unclassified | 3190 |
| 228 | Ga0207689_10006893 | 3300025942 | Bacteria | 9990 |
| 229 | Ga0207661_10265804 | 3300025944 | Unclassified | 1529 |
| 230 | Ga0207679_10003035 | 3300025945 | Bacteria | 10398 |
| 231 | Ga0207651_10016117 | 3300025960 | Bacteria | 4366 |
| 232 | Ga0207712_10001524 | 3300025961 | Bacteria | 15682 |
| 233 | Ga0207712_10083788 | 3300025961 | Bacteria | 2328 |
| 234 | Ga0207640_10003161 | 3300025981 | Bacteria | 8864 |
| 235 | Ga0207658_10000054 | 3300025986 | Bacteria | 125062 |
| 236 | Ga0207658_10035985 | 3300025986 | Bacteria | 3549 |
| 237 | Ga0207658_10038862 | 3300025986 | Bacteria | 3432 |
| 238 | Ga0207658_10192485 | 3300025986 | Unclassified | 1696 |
| 239 | Ga0207677_10007579 | 3300026023 | Bacteria | 6021 |
| 240 | Ga0207703_10002953 | 3300026035 | Bacteria | 14420 |
| 241 | Ga0207703_10019705 | 3300026035 | Bacteria | 5273 |
| 242 | Ga0207703_10242917 | 3300026035 | Bacteria | 1619 |
| 243 | Ga0207703_10541309 | 3300026035 | Bacteria | 1097 |
| 244 | Ga0207639_10002918 | 3300026041 | Bacteria | 11492 |
| 245 | Ga0207639_10717766 | 3300026041 | Bacteria | 928 |
| 246 | Ga0207678_10000147 | 3300026067 | Bacteria | 57839 |
| 247 | Ga0207708_10014662 | 3300026075 | Bacteria | 5866 |
| 248 | Ga0207708_10047523 | 3300026075 | Bacteria | 3266 |
| 249 | Ga0207702_10021467 | 3300026078 | Bacteria | 5346 |
| 250 | Ga0207641_10002538 | 3300026088 | Bacteria | 16796 |
| 251 | Ga0207648_10007041 | 3300026089 | Bacteria | 11116 |
| 252 | Ga0207648_10099390 | 3300026089 | Bacteria | 2548 |
| 253 | Ga0207674_10008721 | 3300026116 | Bacteria | 11673 |
| 254 | Ga0207675_100000256 | 3300026118 | Bacteria | 50777 |
| 255 | Ga0207675_100577396 | 3300026118 | Bacteria | 1125 |
| 256 | Ga0207683_10001913 | 3300026121 | Bacteria | 18440 |
| 257 | Ga0207683_10390414 | 3300026121 | Bacteria | 1280 |
| 258 | Ga0207683_10539369 | 3300026121 | Bacteria | 1078 |
| 259 | Ga0207698_10389714 | 3300026142 | Unclassified | 1328 |
| 260 | Ga0207428_10004621 | 3300027907 | Bacteria | 13054 |
| 261 | Ga0268265_10023565 | 3300028380 | Bacteria | 4340 |
| 262 | Ga0268265_10112108 | 3300028380 | Bacteria | 2229 |
| 263 | Ga0268265_10352264 | 3300028380 | Bacteria | 1345 |
| 264 | Ga0307408_100349405 | 3300031548 | Bacteria | 1254 |
| 265 | Ga0265314_10336768 | 3300031711 | Bacteria | 834 |
| 266 | Ga0307409_100087034 | 3300031995 | Bacteria | 2545 |
| 267 | Ga0307416_100290349 | 3300032002 | Bacteria | 1618 |
| 268 | Ga0373923_0028703 | 3300035111 | Bacteria | 2227 |
| 269 | Ga0373936_0055609 | 3300035113 | Bacteria | 1607 |
| 270 | Ga0373941_0046731 | 3300035115 | Bacteria | 1361 |
| 271 | Ga0373953_0023137 | 3300035117 | Bacteria | 2350 |
| 272 | Ga0373956_0134441 | 3300035119 | Bacteria | 1159 |
| 273 | Ga0373943_0050510 | 3300035170 | Bacteria | 2044 |
| 274 | Ga0373961_0026324 | 3300035241 | Unclassified | 1589 |
| 275 | Ga0373924_0098401 | 3300035410 | Bacteria | 1257 |
| 276 | Ga0373931_0006372 | 3300035691 | Bacteria | 5510 |
| 277 | Ga0373931_0079411 | 3300035691 | Bacteria | 1807 |
| 278 | Ga0373935_0065872 | 3300035692 | Bacteria | 2326 |
| 279 | Ga0373927_0031719 | 3300035695 | Bacteria | 3443 |
| 280 | Ga0373927_0384298 | 3300035695 | Bacteria | 926 |
| 281 | Ga0373933_0006192 | 3300035724 | Bacteria | 6513 |
| 282 | Ga0373933_0021820 | 3300035724 | Bacteria | 3642 |
| 283 | Ga0373933_0555575 | 3300035724 | Bacteria | 753 |
| 284 | Ga0373947_0030940 | 3300035725 | Bacteria | 3147 |
| 285 | Ga0373947_0190308 | 3300035725 | Bacteria | 1339 |
| 286 | Ga0373947_0353415 | 3300035725 | Bacteria | 986 |
| 287 | Ga0373937_0001999 | 3300036401 | Bacteria | 17052 |
| 288 | Ga0373937_0031629 | 3300036401 | Bacteria | 4796 |
| 289 | Ga0373937_0077997 | 3300036401 | Bacteria | 3061 |
| 290 | Ga0373937_0327040 | 3300036401 | Bacteria | 1451 |
| 291 | Ga0373925_0034512 | 3300037068 | Bacteria | 3729 |
| 292 | Ga0373925_0054716 | 3300037068 | Bacteria | 2985 |
| 293 | Ga0395900_0017819 | 3300037418 | Bacteria | 7249 |
| 294 | Ga0395898_0031751 | 3300037466 | Bacteria | 5275 |
| 295 | Ga0395898_0033548 | 3300037466 | Bacteria | 5122 |
| 296 | Ga0395905_0006470 | 3300037471 | Bacteria | 11788 |
| 297 | Ga0395905_0096605 | 3300037471 | Bacteria | 2774 |
| 298 | Ga0436364_0113032 | 3300037853 | Bacteria | 1979 |
| 299 | Ga0436364_0394424 | 3300037853 | Bacteria | 2650 |
| 300 | Ga0436364_1005063 | 3300037853 | Bacteria | 4859 |
| 301 | Ga0436364_1087062 | 3300037853 | Bacteria | 3407 |
| 302 | Ga0436364_1090756 | 3300037853 | Bacteria | 759 |
| 303 | Ga0395901_0002999 | 3300038443 | Bacteria | 17024 |
| 304 | Ga0395901_0895899 | 3300038443 | Bacteria | 869 |
| 305 | Ga0400485_03784 | 3300038735 | Bacteria | 1835 |
| 306 | Ga0400486_26293 | 3300038742 | Bacteria | 1788 |
| 307 | Ga0400483_064186 | 3300039062 | Bacteria | 26495 |
| 308 | Ga0400483_100782 | 3300039062 | Bacteria | 3855 |
| 309 | Ga0400483_181595 | 3300039062 | Bacteria | 28212 |
| 310 | Ga0400483_201439 | 3300039062 | Bacteria | 21086 |
| 311 | Ga0400483_211969 | 3300039062 | Bacteria | 11271 |
| 312 | Ga0436361_0195517 | 3300039447 | Bacteria | 2217 |
| 313 | Ga0436361_0670010 | 3300039447 | Bacteria | 47567 |
| 314 | Ga0436361_1095379 | 3300039447 | Bacteria | 3333 |
| 315 | Ga0466963_0101096 | 3300044694 | Bacteria | 1974 |
| 316 | Ga0453684_0012589 | 3300044712 | Bacteria | 13917 |
| 317 | Ga0453684_0025003 | 3300044712 | Bacteria | 8691 |
| 318 | Ga0466957_0615952 | 3300044842 | Bacteria | 761 |
| 319 | Ga0466958_0002853 | 3300045836 | Bacteria | 8797 |
| 320 | Ga0466967_0242163 | 3300045976 | Bacteria | 1721 |
| 321 | Ga0495603_0000627 | 3300046455 | Bacteria | 19818 |
| 322 | Ga0495603_0225118 | 3300046455 | Bacteria | 1082 |
| 323 | Ga0495603_0267224 | 3300046455 | Bacteria | 984 |
| 324 | Ga0495629_0000108 | 3300046459 | Bacteria | 73826 |
| 325 | Ga0495629_0333225 | 3300046459 | Bacteria | 1037 |
| 326 | Ga0495641_0014389 | 3300046461 | Bacteria | 4284 |
| 327 | Ga0495651_0219277 | 3300046462 | Bacteria | 1318 |
| 328 | Ga0495653_0123340 | 3300046463 | Bacteria | 1843 |
| 329 | Ga0495582_0002320 | 3300046473 | Bacteria | 10664 |
| 330 | Ga0495639_0003785 | 3300046475 | Bacteria | 6497 |
| 331 | Ga0495639_0047790 | 3300046475 | Bacteria | 1940 |
| 332 | Ga0495664_0000913 | 3300046477 | Bacteria | 15191 |
| 333 | Ga0495584_0054272 | 3300046491 | Bacteria | 2017 |
| 334 | Ga0495585_0159802 | 3300046492 | Bacteria | 1170 |
| 335 | Ga0495594_0000131 | 3300046499 | Bacteria | 35452 |
| 336 | Ga0495608_0017576 | 3300046511 | Bacteria | 4946 |
| 337 | Ga0495608_0071114 | 3300046511 | Bacteria | 2270 |
| 338 | Ga0495648_0236852 | 3300046524 | Bacteria | 890 |
| 339 | Ga0495642_0066362 | 3300046528 | Bacteria | 1504 |
| 340 | Ga0495640_0120852 | 3300046533 | Bacteria | 1703 |
| 341 | Ga0495640_0270618 | 3300046533 | Bacteria | 1060 |
| 342 | Ga0495587_0039403 | 3300046536 | Bacteria | 2828 |
| 343 | Ga0495645_0000977 | 3300046543 | Bacteria | 19476 |
| 344 | Ga0495622_0002289 | 3300046557 | Bacteria | 9314 |
| 345 | Ga0495667_0014051 | 3300046559 | Bacteria | 5404 |
| 346 | Ga0495667_0035914 | 3300046559 | Bacteria | 3311 |
| 347 | Ga0495667_0571471 | 3300046559 | Bacteria | 705 |
| 348 | Ga0495634_0030817 | 3300046642 | Bacteria | 3699 |
| 349 | Ga0495635_0152832 | 3300046663 | Bacteria | 1571 |
| 350 | Ga0495588_0005127 | 3300046674 | Bacteria | 5819 |
| 351 | Ga0495599_0067125 | 3300046678 | Bacteria | 2240 |
| 352 | Ga0495623_0469846 | 3300046679 | Bacteria | 667 |
| 353 | Ga0495647_0170884 | 3300046681 | Bacteria | 941 |
| 354 | Ga0495658_0002461 | 3300046683 | Bacteria | 9324 |
| 355 | Ga0495613_0003651 | 3300046689 | Bacteria | 11531 |
| 356 | Ga0495581_0376990 | 3300047315 | Bacteria | 828 |
| 357 | Ga0495604_0009634 | 3300047317 | Bacteria | 7638 |
| 358 | Ga0495604_0404735 | 3300047317 | Bacteria | 898 |
| 359 | Ga0495674_0012361 | 3300047319 | Bacteria | 8041 |
| 360 | Ga0495680_0016038 | 3300047322 | Bacteria | 6445 |
| 361 | Ga0495675_0003841 | 3300047444 | Bacteria | 9095 |
| 362 | Ga0495684_0147893 | 3300047471 | Bacteria | 1758 |
| 363 | Ga0495593_0001789 | 3300047673 | Bacteria | 12745 |
| 364 | Ga0495602_0000695 | 3300048088 | Bacteria | 31609 |
| 365 | Ga0495602_0029666 | 3300048088 | Bacteria | 5202 |
| 366 | Ga0495602_0094354 | 3300048088 | Bacteria | 2473 |
| 367 | Ga0495614_0004916 | 3300048089 | Bacteria | 6029 |
| 368 | Ga0496100_0008410 | 3300048903 | Bacteria | 5755 |
| 369 | Ga0496100_0062856 | 3300048903 | Bacteria | 2452 |
| 370 | Ga0496100_0142028 | 3300048903 | Bacteria | 1703 |
| 371 | Ga0496101_0018815 | 3300048904 | Bacteria | 4703 |
| 372 | Ga0496101_0082327 | 3300048904 | Bacteria | 2382 |
| 373 | Ga0496101_0084385 | 3300048904 | Bacteria | 2352 |
| 374 | Ga0496102_0037946 | 3300048905 | Bacteria | 4346 |
| 375 | Ga0496102_0104126 | 3300048905 | Bacteria | 2639 |
| 376 | Ga0496102_0161872 | 3300048905 | Bacteria | 2105 |
| 377 | Ga0496102_0244693 | 3300048905 | Bacteria | 1691 |
| 378 | Ga0496102_0807625 | 3300048905 | Bacteria | 860 |
| 379 | Ga0496103_0048133 | 3300048906 | Bacteria | 2634 |
| 380 | Ga0496104_0015552 | 3300048907 | Bacteria | 6893 |
| 381 | Ga0496104_0034302 | 3300048907 | Bacteria | 4731 |
| 382 | Ga0496104_0057463 | 3300048907 | Bacteria | 3681 |
| 383 | Ga0496104_0072172 | 3300048907 | Bacteria | 3282 |
| 384 | Ga0496105_0004809 | 3300048908 | Bacteria | 10203 |
| 385 | Ga0496105_0048412 | 3300048908 | Bacteria | 3508 |
| 386 | Ga0496105_0204983 | 3300048908 | Bacteria | 1609 |
| 387 | Ga0496105_0217912 | 3300048908 | Bacteria | 1554 |
| 388 | Ga0496105_0229246 | 3300048908 | Bacteria | 1510 |
| 389 | Ga0496106_0376429 | 3300048909 | Bacteria | 1141 |
| 390 | Ga0496107_0028111 | 3300048910 | Bacteria | 3995 |
| 391 | Ga0496107_0050277 | 3300048910 | Bacteria | 3005 |
| 392 | Ga0496107_0748066 | 3300048910 | Bacteria | 717 |
| 393 | Ga0496108_0166751 | 3300048911 | Bacteria | 1904 |
| 394 | Ga0496109_0005664 | 3300048912 | Bacteria | 10451 |
| 395 | Ga0496109_0009037 | 3300048912 | Bacteria | 8488 |
| 396 | Ga0496109_0020042 | 3300048912 | Bacteria | 5906 |
| 397 | Ga0496109_0636397 | 3300048912 | Bacteria | 1003 |
| 398 | Ga0496110_0134197 | 3300048913 | Unclassified | 2236 |
| 399 | Ga0496110_0520265 | 3300048913 | Bacteria | 1082 |
| 400 | Ga0496111_0014406 | 3300048914 | Bacteria | 5400 |
| 401 | Ga0496111_0081335 | 3300048914 | Unclassified | 2364 |
| 402 | Ga0496111_0391215 | 3300048914 | Bacteria | 1028 |
| 403 | Ga0496112_0008045 | 3300048915 | Bacteria | 9408 |
| 404 | Ga0496112_0015126 | 3300048915 | Bacteria | 7189 |
| 405 | Ga0496112_0021110 | 3300048915 | Bacteria | 6187 |
| 406 | Ga0496112_0077952 | 3300048915 | Bacteria | 3277 |
| 407 | Ga0496112_0141800 | 3300048915 | Bacteria | 2372 |
| 408 | Ga0496112_0253125 | 3300048915 | Bacteria | 1712 |
| 409 | Ga0496113_0011669 | 3300048916 | Bacteria | 5876 |
| 410 | Ga0496113_0113918 | 3300048916 | Bacteria | 2108 |
| 411 | Ga0496113_0658997 | 3300048916 | Bacteria | 837 |
| 412 | Ga0496114_0051367 | 3300048917 | Bacteria | 3432 |
| 413 | Ga0496114_0644286 | 3300048917 | Bacteria | 932 |
| 414 | Ga0496115_0069189 | 3300048918 | Bacteria | 2859 |
| 415 | Ga0496115_0081268 | 3300048918 | Bacteria | 2639 |
| 416 | Ga0496115_0091910 | 3300048918 | Bacteria | 2480 |
| 417 | Ga0496117_0150319 | 3300048920 | Bacteria | 1379 |
| 418 | Ga0496118_0022713 | 3300048921 | Bacteria | 5472 |
| 419 | Ga0496119_0047664 | 3300048922 | Bacteria | 2664 |
| 420 | Ga0496121_0006918 | 3300048924 | Bacteria | 13826 |
| 421 | Ga0501031_0036204 | 3300049568 | Bacteria | 3220 |
| 422 | Ga0501031_0063709 | 3300049568 | Bacteria | 2401 |
| 423 | Ga0501031_0147723 | 3300049568 | Bacteria | 1536 |
| 424 | Ga0501031_0160858 | 3300049568 | Bacteria | 1468 |
| 425 | Ga0501032_0047964 | 3300049569 | Bacteria | 2884 |
| 426 | Ga0501034_0356217 | 3300049571 | Bacteria | 1391 |
| 427 | Ga0501036_0017879 | 3300049572 | Bacteria | 5935 |
| 428 | Ga0501036_0058717 | 3300049572 | Bacteria | 3259 |
| 429 | Ga0501036_0059150 | 3300049572 | Bacteria | 3247 |
| 430 | Ga0501037_0096695 | 3300049573 | Bacteria | 2134 |
| 431 | Ga0501038_0160916 | 3300049574 | Bacteria | 1824 |
| 432 | Ga0501038_0239571 | 3300049574 | Bacteria | 1441 |
| 433 | Ga0501039_0070544 | 3300049575 | Bacteria | 2714 |
| 434 | Ga0501039_0253092 | 3300049575 | Bacteria | 1385 |
| 435 | Ga0501040_0023993 | 3300049576 | Bacteria | 4092 |
| 436 | Ga0501040_0026777 | 3300049576 | Bacteria | 3878 |
| 437 | Ga0501041_0103965 | 3300049577 | Bacteria | 1759 |
| 438 | Ga0501041_0262667 | 3300049577 | Bacteria | 1086 |
| 439 | Ga0501042_0013323 | 3300049578 | Bacteria | 5593 |
| 440 | Ga0501042_0067484 | 3300049578 | Bacteria | 2557 |
| 441 | Ga0501042_0226804 | 3300049578 | Bacteria | 1347 |
| 442 | Ga0501043_0035736 | 3300049579 | Bacteria | 3909 |
| 443 | Ga0501046_0012918 | 3300049580 | Bacteria | 7099 |
| 444 | Ga0501046_0025395 | 3300049580 | Bacteria | 4849 |
| 445 | Ga0501046_0109221 | 3300049580 | Bacteria | 2115 |
| 446 | Ga0501046_0162944 | 3300049580 | Bacteria | 1676 |
| 447 | Ga0501047_0006069 | 3300049581 | Bacteria | 11358 |
| 448 | Ga0501048_0015303 | 3300049582 | Bacteria | 5665 |
| 449 | Ga0501048_0097007 | 3300049582 | Bacteria | 2079 |
| 450 | Ga0501067_0145237 | 3300049583 | Bacteria | 1322 |
| 451 | Ga0501068_0345474 | 3300049584 | Bacteria | 956 |
| 452 | Ga0501068_0496248 | 3300049584 | Bacteria | 792 |
| 453 | Ga0501070_0006872 | 3300049586 | Bacteria | 9679 |
| 454 | Ga0501071_0019202 | 3300049587 | Bacteria | 4742 |
| 455 | Ga0501071_0260680 | 3300049587 | Bacteria | 1309 |
| 456 | Ga0501071_0488692 | 3300049587 | Bacteria | 944 |
| 457 | Ga0501072_0002082 | 3300049588 | Bacteria | 14892 |
| 458 | Ga0501072_0011838 | 3300049588 | Bacteria | 6665 |
| 459 | Ga0501072_0034108 | 3300049588 | Bacteria | 3988 |
| 460 | Ga0501073_0148812 | 3300049589 | Bacteria | 1623 |
| 461 | Ga0501073_0486557 | 3300049589 | Bacteria | 853 |
| 462 | Ga0501074_0052687 | 3300049590 | Bacteria | 2936 |
| 463 | Ga0501074_0113001 | 3300049590 | Bacteria | 1943 |
| 464 | Ga0501075_0020334 | 3300049591 | Bacteria | 4827 |
| 465 | Ga0501075_0032984 | 3300049591 | Bacteria | 3851 |
| 466 | Ga0501075_0323662 | 3300049591 | Bacteria | 1175 |
| 467 | Ga0501076_0004312 | 3300049592 | Bacteria | 10092 |
| 468 | Ga0501076_0011455 | 3300049592 | Bacteria | 6607 |
| 469 | Ga0501076_0196708 | 3300049592 | Bacteria | 1646 |
| 470 | Ga0501076_0216961 | 3300049592 | Bacteria | 1564 |
| 471 | Ga0501076_0254114 | 3300049592 | Bacteria | 1438 |
| 472 | Ga0501076_0277445 | 3300049592 | Bacteria | 1373 |
| 473 | Ga0501077_0070587 | 3300049593 | Bacteria | 2213 |
| 474 | Ga0501079_0076427 | 3300049741 | Bacteria | 2590 |
| 475 | Ga0501079_0086865 | 3300049741 | Bacteria | 2421 |
| 476 | Ga0501079_0097883 | 3300049741 | Bacteria | 2274 |
| 477 | Ga0501079_0224622 | 3300049741 | Bacteria | 1467 |
| 478 | Ga0501079_0237349 | 3300049741 | Bacteria | 1424 |
| 479 | Ga0501080_0005832 | 3300049742 | Bacteria | 11021 |
| 480 | Ga0501080_0073886 | 3300049742 | Bacteria | 3172 |
| 481 | Ga0501080_0118384 | 3300049742 | Bacteria | 2456 |
| 482 | Ga0501080_0398776 | 3300049742 | Bacteria | 1238 |
| 483 | Ga0501081_0028321 | 3300049743 | Bacteria | 3780 |
| 484 | Ga0501081_0060831 | 3300049743 | Bacteria | 2617 |
| 485 | Ga0501081_0118134 | 3300049743 | Bacteria | 1886 |
| 486 | Ga0501083_0158520 | 3300049744 | Bacteria | 1481 |
| 487 | Ga0501035_0067440 | 3300049822 | Bacteria | 3175 |
| 488 | Ga0501035_0141581 | 3300049822 | Bacteria | 2091 |
| 489 | Ga0501035_0446177 | 3300049822 | Bacteria | 1071 |
| 490 | Ga0501044_0063738 | 3300049823 | Bacteria | 3764 |
| 491 | Ga0501045_0026020 | 3300049824 | Bacteria | 4207 |
| 492 | Ga0501045_0058467 | 3300049824 | Bacteria | 2823 |
| 493 | Ga0501045_0685090 | 3300049824 | Bacteria | 757 |
| 494 | nmdc:mga05p37_254974_c1 | 3300050507 | Unclassified | 2103 |
| 495 | nmdc:mga06r32_24408_c1 | 3300050510 | Bacteria | 5612 |
| 496 | nmdc:mga08y16_234504_c1 | 3300050511 | Unclassified | 1898 |
| 497 | nmdc:mga08y16_539_c1 | 3300050511 | Bacteria | 35073 |
| 498 | nmdc:mga0n895_217567_c1 | 3300050512 | Unclassified | 1940 |
| 499 | nmdc:mga0n895_64149_c1 | 3300050512 | Bacteria | 3633 |
| 500 | nmdc:mga0rr50_3609_c1 | 3300050513 | Bacteria | 8944 |
| 501 | nmdc:mga0a205_160923_c1 | 3300050515 | Bacteria | 2141 |
| 502 | nmdc:mga0a205_97692_c1 | 3300050515 | Unclassified | 2836 |
| 503 | Ga0495601_0001469 | 3300053077 | Bacteria | 12990 |
| 504 | Ga0495601_0150469 | 3300053077 | Bacteria | 1519 |
| 505 | Ga0495612_0004354 | 3300053078 | Bacteria | 5875 |
| 506 | Ga0495612_0018522 | 3300053078 | Bacteria | 2788 |
| 507 | Ga0500635_0055802 | 3300053080 | Bacteria | 1365 |
| 508 | Ga0495655_0000735 | 3300053083 | Bacteria | 5219 |
| 509 | Ga0495595_0080905 | 3300053084 | Bacteria | 1547 |
| 510 | Ga0495619_0018831 | 3300053085 | Bacteria | 4383 |
| 511 | Ga0495619_0032408 | 3300053085 | Bacteria | 3391 |
| 512 | Ga0500578_0136865 | 3300053086 | Bacteria | 1533 |
| 513 | Ga0500651_0003810 | 3300053093 | Bacteria | 8328 |
| 514 | Ga0500566_0000085 | 3300053094 | Bacteria | 46377 |
| 515 | Ga0500640_000865 | 3300053095 | Bacteria | 8390 |
| 516 | Ga0500641_0202181 | 3300053096 | Bacteria | 848 |
| 517 | Ga0500572_001257 | 3300053111 | Bacteria | 7146 |
| 518 | Ga0500591_036603 | 3300053115 | Bacteria | 2354 |
| 519 | Ga0500568_0109114 | 3300053139 | Bacteria | 1035 |
| 520 | Ga0500603_002747 | 3300053150 | Bacteria | 3823 |
| 521 | Ga0500630_000339 | 3300053159 | Bacteria | 19545 |
| 522 | Ga0500638_012729 | 3300053162 | Bacteria | 3779 |
| 523 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 524 | Ga0500636_0035109 | 3300053177 | Bacteria | 2968 |
| 525 | Ga0500637_0059036 | 3300053178 | Bacteria | 2195 |
| 526 | Ga0500596_000828 | 3300053735 | Bacteria | 6131 |
| 527 | Ga0500601_004843 | 3300053737 | Bacteria | 1473 |
| 528 | Ga0501084_0008187 | 3300054114 | Bacteria | 8622 |
| 529 | Ga0501084_0012678 | 3300054114 | Bacteria | 6985 |
| 530 | Ga0501084_0241590 | 3300054114 | Bacteria | 1524 |
| 531 | Ga0501084_0448594 | 3300054114 | Bacteria | 1091 |
| 532 | Ga0501084_0700383 | 3300054114 | Bacteria | 854 |
| 533 | Ga0501082_0007239 | 3300060353 | Bacteria | 9569 |
| 534 | Ga0501082_0142108 | 3300060353 | Bacteria | 2083 |
| 535 | Ga0501082_0188886 | 3300060353 | Bacteria | 1792 |
| 536 | Ga0501082_0457848 | 3300060353 | Bacteria | 1115 |
| 537 | Ga0530510_0062320 | 3300061734 | Bacteria | 2700 |
| 538 | Ga0530510_0074535 | 3300061734 | Bacteria | 2464 |
| 539 | Ga0530510_0666168 | 3300061734 | Bacteria | 792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0353415 | Ga0373947_0353415_88_639 | 165 |
| 2 | 3300048903 | Ga0496100_0062856 | Ga0496100_0062856_45_596 | 165 |
| 3 | 3300048905 | Ga0496102_0161872 | Ga0496102_0161872_659_1210 | 165 |
| 4 | 3300048907 | Ga0496104_0015552 | Ga0496104_0015552_3505_4056 | 165 |
| 5 | 3300048908 | Ga0496105_0004809 | Ga0496105_0004809_3271_3822 | 165 |
| 6 | 3300048914 | Ga0496111_0014406 | Ga0496111_0014406_4538_5089 | 165 |
| 7 | 3300048915 | Ga0496112_0008045 | Ga0496112_0008045_8765_9316 | 165 |
| 8 | 3300048918 | Ga0496115_0091910 | Ga0496115_0091910_1034_1585 | 165 |
| 9 | 3300046524 | Ga0495648_0236852 | Ga0495648_0236852_188_754 | 173 |
| 10 | 3300026041 | Ga0207639_10717766 | Ga0207639_107177662 | 176 |
| 11 | 3300037853 | Ga0436364_1090756 | Ga0436364_1090756_141_725 | 179 |
| 12 | 3300053150 | Ga0500603_002747 | Ga0500603_002747_81_665 | 179 |
| 13 | 3300009545 | Ga0105237_10279611 | Ga0105237_102796112 | 182 |
| 14 | iso_pu_bacteria | 2522572158 | 2523102701 | 183 |
| 15 | 3300054114 | Ga0501084_0700383 | Ga0501084_0700383_40_642 | 185 |
| 16 | 3300046679 | Ga0495623_0469846 | Ga0495623_0469846_15_647 | 189 |
| 17 | 3300009094 | Ga0111539_10001601 | Ga0111539_100016018 | 194 |
| 18 | 3300027907 | Ga0207428_10004621 | Ga0207428_100046218 | 194 |
| 19 | 3300044712 | Ga0453684_0012589 | Ga0453684_0012589_11460_12089 | 194 |
| 20 | 3300046462 | Ga0495651_0219277 | Ga0495651_0219277_44_718 | 194 |
| 21 | 3300046533 | Ga0495640_0120852 | Ga0495640_0120852_268_909 | 194 |
| 22 | 3300046559 | Ga0495667_0571471 | Ga0495667_0571471_40_690 | 194 |
| 23 | 3300050511 | nmdc:mga08y16_539_c1 | nmdc:mga08y16_539_c1_7190_7819 | 194 |
| 24 | iso_pu_bacteria | 2874604998 | 2874609460 | 194 |
| 25 | iso_pu_bacteria | 8006994254 | 8006996342 | 194 |
| 26 | 3300021361 | Ga0213872_10017327 | Ga0213872_100173272 | 195 |
| 27 | 3300038735 | Ga0400485_03784 | Ga0400485_03784_646_1278 | 195 |
| 28 | 3300039447 | Ga0436361_1095379 | Ga0436361_1095379_245_880 | 195 |
| 29 | 3300005458 | Ga0070681_10146084 | Ga0070681_101460843 | 196 |
| 30 | 3300005614 | Ga0068856_100375434 | Ga0068856_1003754342 | 196 |
| 31 | 3300025912 | Ga0207707_10124175 | Ga0207707_101241753 | 196 |
| 32 | 3300025924 | Ga0207694_10253781 | Ga0207694_102537812 | 196 |
| 33 | 3300031711 | Ga0265314_10336768 | Ga0265314_103367682 | 196 |
| 34 | 3300035113 | Ga0373936_0055609 | Ga0373936_0055609_584_1267 | 196 |
| 35 | 3300039062 | Ga0400483_100782 | Ga0400483_100782_1550_2191 | 196 |
| 36 | 3300039062 | Ga0400483_181595 | Ga0400483_181595_11243_11908 | 196 |
| 37 | 3300044712 | Ga0453684_0025003 | Ga0453684_0025003_77_715 | 196 |
| 38 | 3300044842 | Ga0466957_0615952 | Ga0466957_0615952_15_653 | 196 |
| 39 | 3300045836 | Ga0466958_0002853 | Ga0466958_0002853_7362_8000 | 196 |
| 40 | 3300045976 | Ga0466967_0242163 | Ga0466967_0242163_492_1151 | 196 |
| 41 | 3300048920 | Ga0496117_0150319 | Ga0496117_0150319_128_820 | 196 |
| 42 | 3300048921 | Ga0496118_0022713 | Ga0496118_0022713_4147_4839 | 196 |
| 43 | 3300048922 | Ga0496119_0047664 | Ga0496119_0047664_1865_2557 | 196 |
| 44 | 3300048924 | Ga0496121_0006918 | Ga0496121_0006918_6976_7668 | 196 |
| 45 | 3300049580 | Ga0501046_0012918 | Ga0501046_0012918_2237_2926 | 196 |
| 46 | 3300049581 | Ga0501047_0006069 | Ga0501047_0006069_7867_8556 | 196 |
| 47 | 3300049586 | Ga0501070_0006872 | Ga0501070_0006872_5825_6514 | 196 |
| 48 | 3300049590 | Ga0501074_0052687 | Ga0501074_0052687_27_716 | 196 |
| 49 | 3300049741 | Ga0501079_0237349 | Ga0501079_0237349_81_770 | 196 |
| 50 | 3300049742 | Ga0501080_0005832 | Ga0501080_0005832_6138_6827 | 196 |
| 51 | 3300049823 | Ga0501044_0063738 | Ga0501044_0063738_61_750 | 196 |
| 52 | 3300053080 | Ga0500635_0055802 | Ga0500635_0055802_578_1261 | 196 |
| 53 | 3300053086 | Ga0500578_0136865 | Ga0500578_0136865_264_956 | 196 |
| 54 | 3300053093 | Ga0500651_0003810 | Ga0500651_0003810_7003_7695 | 196 |
| 55 | 3300053094 | Ga0500566_0000085 | Ga0500566_0000085_22491_23174 | 196 |
| 56 | 3300053095 | Ga0500640_000865 | Ga0500640_000865_6312_6995 | 196 |
| 57 | 3300053096 | Ga0500641_0202181 | Ga0500641_0202181_132_824 | 196 |
| 58 | 3300053111 | Ga0500572_001257 | Ga0500572_001257_3042_3725 | 196 |
| 59 | 3300053115 | Ga0500591_036603 | Ga0500591_036603_467_1150 | 196 |
| 60 | 3300053139 | Ga0500568_0109114 | Ga0500568_0109114_319_1011 | 196 |
| 61 | 3300053159 | Ga0500630_000339 | Ga0500630_000339_3046_3729 | 196 |
| 62 | 3300053162 | Ga0500638_012729 | Ga0500638_012729_2383_3066 | 196 |
| 63 | 3300053163 | Ga0500639_000004 | Ga0500639_000004_174319_175002 | 196 |
| 64 | 3300053177 | Ga0500636_0035109 | Ga0500636_0035109_979_1671 | 196 |
| 65 | 3300053178 | Ga0500637_0059036 | Ga0500637_0059036_1402_2085 | 196 |
| 66 | 3300053735 | Ga0500596_000828 | Ga0500596_000828_1275_1958 | 196 |
| 67 | 3300053737 | Ga0500601_004843 | Ga0500601_004843_171_854 | 196 |
| 68 | 3300037466 | Ga0395898_0033548 | Ga0395898_0033548_3493_4149 | 197 |
| 69 | 3300039062 | Ga0400483_064186 | Ga0400483_064186_17097_17765 | 197 |
| 70 | 3300039062 | Ga0400483_201439 | Ga0400483_201439_3963_4631 | 197 |
| 71 | 3300044694 | Ga0466963_0101096 | Ga0466963_0101096_884_1579 | 197 |
| 72 | 3300047317 | Ga0495604_0404735 | Ga0495604_0404735_57_704 | 197 |
| 73 | 3300048088 | Ga0495602_0094354 | Ga0495602_0094354_1650_2297 | 197 |
| 74 | 3300053077 | Ga0495601_0150469 | Ga0495601_0150469_664_1311 | 197 |
| 75 | 3300053078 | Ga0495612_0018522 | Ga0495612_0018522_1924_2571 | 197 |
| 76 | 3300053084 | Ga0495595_0080905 | Ga0495595_0080905_693_1340 | 197 |
| 77 | 3300053085 | Ga0495619_0018831 | Ga0495619_0018831_805_1452 | 197 |
| 78 | 3300003215 | JGI25153J46596_10037647 | JGI25153J46596_100376472 | 198 |
| 79 | 3300005457 | Ga0070662_100302037 | Ga0070662_1003020373 | 198 |
| 80 | 3300025913 | Ga0207695_10537749 | Ga0207695_105377492 | 198 |
| 81 | 3300035725 | Ga0373947_0190308 | Ga0373947_0190308_214_867 | 198 |
| 82 | 3300038742 | Ga0400486_26293 | Ga0400486_26293_376_1029 | 198 |
| 83 | 3300039062 | Ga0400483_211969 | Ga0400483_211969_772_1443 | 198 |
| 84 | 3300039447 | Ga0436361_0670010 | Ga0436361_0670010_32997_33641 | 198 |
| 85 | 3300049574 | Ga0501038_0239571 | Ga0501038_0239571_34_699 | 198 |
| 86 | 3300049575 | Ga0501039_0253092 | Ga0501039_0253092_623_1288 | 198 |
| 87 | 3300049591 | Ga0501075_0323662 | Ga0501075_0323662_283_948 | 198 |
| 88 | 3300049592 | Ga0501076_0196708 | Ga0501076_0196708_350_1015 | 198 |
| 89 | 3300005338 | Ga0068868_100286232 | Ga0068868_1002862322 | 199 |
| 90 | 3300005471 | Ga0070698_100076013 | Ga0070698_1000760132 | 199 |
| 91 | 3300006028 | Ga0070717_10027719 | Ga0070717_100277195 | 199 |
| 92 | 3300011119 | Ga0105246_10283735 | Ga0105246_102837352 | 199 |
| 93 | 3300014497 | Ga0182008_10036900 | Ga0182008_100369004 | 199 |
| 94 | 3300025928 | Ga0207700_10112785 | Ga0207700_101127853 | 199 |
| 95 | 3300036401 | Ga0373937_0327040 | Ga0373937_0327040_273_962 | 199 |
| 96 | 3300048904 | Ga0496101_0082327 | Ga0496101_0082327_1607_2281 | 199 |
| 97 | 3300048915 | Ga0496112_0253125 | Ga0496112_0253125_85_738 | 199 |
| 98 | 3300001977 | JGI24746J21847_1008036 | JGI24746J21847_10080362 | 200 |
| 99 | 3300001989 | JGI24739J22299_10033922 | JGI24739J22299_100339221 | 200 |
| 100 | 3300001990 | JGI24737J22298_10028612 | JGI24737J22298_100286122 | 200 |
| 101 | 3300002070 | JGI24750J21931_1000903 | JGI24750J21931_10009036 | 200 |
| 102 | 3300002075 | JGI24738J21930_10008109 | JGI24738J21930_100081093 | 200 |
| 103 | 3300005327 | Ga0070658_10031372 | Ga0070658_100313722 | 200 |
| 104 | 3300005328 | Ga0070676_10007925 | Ga0070676_100079254 | 200 |
| 105 | 3300005330 | Ga0070690_100000780 | Ga0070690_1000007806 | 200 |
| 106 | 3300005331 | Ga0070670_100001837 | Ga0070670_1000018375 | 200 |
| 107 | 3300005333 | Ga0070677_10039552 | Ga0070677_100395522 | 200 |
| 108 | 3300005334 | Ga0068869_100004906 | Ga0068869_1000049069 | 200 |
| 109 | 3300005335 | Ga0070666_10002181 | Ga0070666_100021813 | 200 |
| 110 | 3300005336 | Ga0070680_100052784 | Ga0070680_1000527842 | 200 |
| 111 | 3300005337 | Ga0070682_100000868 | Ga0070682_10000086813 | 200 |
| 112 | 3300005338 | Ga0068868_100002238 | Ga0068868_1000022388 | 200 |
| 113 | 3300005339 | Ga0070660_100000822 | Ga0070660_1000008228 | 200 |
| 114 | 3300005340 | Ga0070689_100001665 | Ga0070689_1000016653 | 200 |
| 115 | 3300005341 | Ga0070691_10001014 | Ga0070691_100010145 | 200 |
| 116 | 3300005343 | Ga0070687_100014448 | Ga0070687_1000144482 | 200 |
| 117 | 3300005344 | Ga0070661_100000197 | Ga0070661_10000019712 | 200 |
| 118 | 3300005345 | Ga0070692_10029717 | Ga0070692_100297175 | 200 |
| 119 | 3300005347 | Ga0070668_100000339 | Ga0070668_10000033923 | 200 |
| 120 | 3300005353 | Ga0070669_100000542 | Ga0070669_10000054225 | 200 |
| 121 | 3300005354 | Ga0070675_100005758 | Ga0070675_10000575810 | 200 |
| 122 | 3300005355 | Ga0070671_100003157 | Ga0070671_1000031578 | 200 |
| 123 | 3300005356 | Ga0070674_100011081 | Ga0070674_1000110813 | 200 |
| 124 | 3300005364 | Ga0070673_100000612 | Ga0070673_10000061218 | 200 |
| 125 | 3300005365 | Ga0070688_100000119 | Ga0070688_10000011943 | 200 |
| 126 | 3300005366 | Ga0070659_100002119 | Ga0070659_1000021194 | 200 |
| 127 | 3300005367 | Ga0070667_100060908 | Ga0070667_1000609082 | 200 |
| 128 | 3300005367 | Ga0070667_100098848 | Ga0070667_1000988482 | 200 |
| 129 | 3300005434 | Ga0070709_10000481 | Ga0070709_100004815 | 200 |
| 130 | 3300005435 | Ga0070714_100002193 | Ga0070714_10000219310 | 200 |
| 131 | 3300005436 | Ga0070713_100009063 | Ga0070713_1000090636 | 200 |
| 132 | 3300005437 | Ga0070710_10001367 | Ga0070710_1000136714 | 200 |
| 133 | 3300005438 | Ga0070701_10000488 | Ga0070701_100004884 | 200 |
| 134 | 3300005439 | Ga0070711_100000677 | Ga0070711_1000006773 | 200 |
| 135 | 3300005439 | Ga0070711_100234492 | Ga0070711_1002344922 | 200 |
| 136 | 3300005440 | Ga0070705_100000494 | Ga0070705_10000049414 | 200 |
| 137 | 3300005441 | Ga0070700_100003352 | Ga0070700_1000033527 | 200 |
| 138 | 3300005444 | Ga0070694_100021641 | Ga0070694_1000216412 | 200 |
| 139 | 3300005455 | Ga0070663_100000855 | Ga0070663_1000008557 | 200 |
| 140 | 3300005456 | Ga0070678_100000183 | Ga0070678_10000018324 | 200 |
| 141 | 3300005457 | Ga0070662_100066073 | Ga0070662_1000660733 | 200 |
| 142 | 3300005459 | Ga0068867_100014445 | Ga0068867_1000144456 | 200 |
| 143 | 3300005518 | Ga0070699_100117932 | Ga0070699_1001179322 | 200 |
| 144 | 3300005530 | Ga0070679_100038121 | Ga0070679_1000381212 | 200 |
| 145 | 3300005535 | Ga0070684_100046137 | Ga0070684_1000461373 | 200 |
| 146 | 3300005536 | Ga0070697_100002769 | Ga0070697_10000276913 | 200 |
| 147 | 3300005539 | Ga0068853_100000537 | Ga0068853_10000053718 | 200 |
| 148 | 3300005543 | Ga0070672_100085295 | Ga0070672_1000852952 | 200 |
| 149 | 3300005544 | Ga0070686_100428489 | Ga0070686_1004284892 | 200 |
| 150 | 3300005545 | Ga0070695_100007432 | Ga0070695_1000074327 | 200 |
| 151 | 3300005545 | Ga0070695_100013353 | Ga0070695_1000133536 | 200 |
| 152 | 3300005546 | Ga0070696_100001626 | Ga0070696_1000016266 | 200 |
| 153 | 3300005547 | Ga0070693_100000106 | Ga0070693_10000010639 | 200 |
| 154 | 3300005548 | Ga0070665_100105925 | Ga0070665_1001059253 | 200 |
| 155 | 3300005549 | Ga0070704_100001004 | Ga0070704_10000100412 | 200 |
| 156 | 3300005549 | Ga0070704_100234108 | Ga0070704_1002341082 | 200 |
| 157 | 3300005563 | Ga0068855_100012257 | Ga0068855_1000122579 | 200 |
| 158 | 3300005564 | Ga0070664_100000182 | Ga0070664_10000018242 | 200 |
| 159 | 3300005577 | Ga0068857_100000505 | Ga0068857_1000005055 | 200 |
| 160 | 3300005578 | Ga0068854_100022193 | Ga0068854_1000221935 | 200 |
| 161 | 3300005614 | Ga0068856_100020684 | Ga0068856_1000206845 | 200 |
| 162 | 3300005615 | Ga0070702_100000684 | Ga0070702_10000068412 | 200 |
| 163 | 3300005615 | Ga0070702_100037692 | Ga0070702_1000376922 | 200 |
| 164 | 3300005616 | Ga0068852_100002310 | Ga0068852_1000023105 | 200 |
| 165 | 3300005616 | Ga0068852_100803384 | Ga0068852_1008033841 | 200 |
| 166 | 3300005617 | Ga0068859_100005071 | Ga0068859_1000050715 | 200 |
| 167 | 3300005618 | Ga0068864_100150302 | Ga0068864_1001503023 | 200 |
| 168 | 3300005718 | Ga0068866_10003533 | Ga0068866_100035334 | 200 |
| 169 | 3300005719 | Ga0068861_100000179 | Ga0068861_10000017929 | 200 |
| 170 | 3300005834 | Ga0068851_10010050 | Ga0068851_100100502 | 200 |
| 171 | 3300005841 | Ga0068863_100014960 | Ga0068863_1000149603 | 200 |
| 172 | 3300005842 | Ga0068858_100005862 | Ga0068858_1000058625 | 200 |
| 173 | 3300005842 | Ga0068858_100032058 | Ga0068858_1000320585 | 200 |
| 174 | 3300005843 | Ga0068860_100001853 | Ga0068860_10000185318 | 200 |
| 175 | 3300005844 | Ga0068862_100001564 | Ga0068862_10000156411 | 200 |
| 176 | 3300005844 | Ga0068862_100210439 | Ga0068862_1002104393 | 200 |
| 177 | 3300006163 | Ga0070715_10000596 | Ga0070715_100005962 | 200 |
| 178 | 3300006173 | Ga0070716_100000486 | Ga0070716_1000004866 | 200 |
| 179 | 3300006175 | Ga0070712_100007148 | Ga0070712_1000071486 | 200 |
| 180 | 3300006175 | Ga0070712_100381355 | Ga0070712_1003813551 | 200 |
| 181 | 3300006358 | Ga0068871_100051199 | Ga0068871_1000511993 | 200 |
| 182 | 3300006847 | Ga0075431_100423907 | Ga0075431_1004239072 | 200 |
| 183 | 3300006852 | Ga0075433_10370255 | Ga0075433_103702552 | 200 |
| 184 | 3300006871 | Ga0075434_100052916 | Ga0075434_1000529166 | 200 |
| 185 | 3300006880 | Ga0075429_100012905 | Ga0075429_1000129057 | 200 |
| 186 | 3300006881 | Ga0068865_100001379 | Ga0068865_10000137914 | 200 |
| 187 | 3300006881 | Ga0068865_100220136 | Ga0068865_1002201363 | 200 |
| 188 | 3300006931 | Ga0097620_100005071 | Ga0097620_1000050715 | 200 |
| 189 | 3300009036 | Ga0105244_10092703 | Ga0105244_100927032 | 200 |
| 190 | 3300009092 | Ga0105250_10011711 | Ga0105250_100117113 | 200 |
| 191 | 3300009098 | Ga0105245_10024137 | Ga0105245_100241373 | 200 |
| 192 | 3300009101 | Ga0105247_10001527 | Ga0105247_1000152710 | 200 |
| 193 | 3300009101 | Ga0105247_10003457 | Ga0105247_100034572 | 200 |
| 194 | 3300009101 | Ga0105247_10021733 | Ga0105247_100217336 | 200 |
| 195 | 3300009147 | Ga0114129_10453078 | Ga0114129_104530782 | 200 |
| 196 | 3300009148 | Ga0105243_10002927 | Ga0105243_100029274 | 200 |
| 197 | 3300009148 | Ga0105243_10535022 | Ga0105243_105350221 | 200 |
| 198 | 3300009174 | Ga0105241_10000695 | Ga0105241_1000069518 | 200 |
| 199 | 3300009174 | Ga0105241_10288873 | Ga0105241_102888732 | 200 |
| 200 | 3300009176 | Ga0105242_10004028 | Ga0105242_100040282 | 200 |
| 201 | 3300009176 | Ga0105242_10630185 | Ga0105242_106301852 | 200 |
| 202 | 3300009177 | Ga0105248_10001513 | Ga0105248_1000151313 | 200 |
| 203 | 3300009177 | Ga0105248_10010219 | Ga0105248_100102199 | 200 |
| 204 | 3300009545 | Ga0105237_10003743 | Ga0105237_100037433 | 200 |
| 205 | 3300009545 | Ga0105237_10572911 | Ga0105237_105729112 | 200 |
| 206 | 3300009551 | Ga0105238_10123312 | Ga0105238_101233122 | 200 |
| 207 | 3300009551 | Ga0105238_10351032 | Ga0105238_103510322 | 200 |
| 208 | 3300009553 | Ga0105249_10001563 | Ga0105249_1000156312 | 200 |
| 209 | 3300010375 | Ga0105239_10008110 | Ga0105239_100081108 | 200 |
| 210 | 3300011119 | Ga0105246_10000499 | Ga0105246_1000049915 | 200 |
| 211 | 3300013100 | Ga0157373_10004826 | Ga0157373_100048267 | 200 |
| 212 | 3300013102 | Ga0157371_10002971 | Ga0157371_1000297116 | 200 |
| 213 | 3300013104 | Ga0157370_10040198 | Ga0157370_100401984 | 200 |
| 214 | 3300013105 | Ga0157369_10007447 | Ga0157369_100074473 | 200 |
| 215 | 3300013296 | Ga0157374_10015936 | Ga0157374_100159365 | 200 |
| 216 | 3300013297 | Ga0157378_10000352 | Ga0157378_1000035212 | 200 |
| 217 | 3300013306 | Ga0163162_10021080 | Ga0163162_100210804 | 200 |
| 218 | 3300013307 | Ga0157372_10004794 | Ga0157372_1000479415 | 200 |
| 219 | 3300013308 | Ga0157375_10024932 | Ga0157375_100249324 | 200 |
| 220 | 3300014325 | Ga0163163_10004442 | Ga0163163_100044429 | 200 |
| 221 | 3300014325 | Ga0163163_10028487 | Ga0163163_100284872 | 200 |
| 222 | 3300014497 | Ga0182008_10093911 | Ga0182008_100939111 | 200 |
| 223 | 3300014745 | Ga0157377_10003807 | Ga0157377_100038076 | 200 |
| 224 | 3300014968 | Ga0157379_10000158 | Ga0157379_1000015812 | 200 |
| 225 | 3300014968 | Ga0157379_10017064 | Ga0157379_100170645 | 200 |
| 226 | 3300014968 | Ga0157379_10063495 | Ga0157379_100634955 | 200 |
| 227 | 3300014969 | Ga0157376_10000303 | Ga0157376_1000030327 | 200 |
| 228 | 3300017792 | Ga0163161_10006616 | Ga0163161_100066164 | 200 |
| 229 | 3300017792 | Ga0163161_10206328 | Ga0163161_102063283 | 200 |
| 230 | 3300025321 | Ga0207656_10042694 | Ga0207656_100426943 | 200 |
| 231 | 3300025885 | Ga0207653_10104538 | Ga0207653_101045382 | 200 |
| 232 | 3300025893 | Ga0207682_10069868 | Ga0207682_100698681 | 200 |
| 233 | 3300025898 | Ga0207692_10002053 | Ga0207692_100020531 | 200 |
| 234 | 3300025900 | Ga0207710_10004383 | Ga0207710_100043835 | 200 |
| 235 | 3300025900 | Ga0207710_10056684 | Ga0207710_100566842 | 200 |
| 236 | 3300025901 | Ga0207688_10000241 | Ga0207688_100002415 | 200 |
| 237 | 3300025903 | Ga0207680_10049756 | Ga0207680_100497563 | 200 |
| 238 | 3300025904 | Ga0207647_10001633 | Ga0207647_100016335 | 200 |
| 239 | 3300025905 | Ga0207685_10000595 | Ga0207685_100005956 | 200 |
| 240 | 3300025907 | Ga0207645_10028041 | Ga0207645_100280415 | 200 |
| 241 | 3300025909 | Ga0207705_10031736 | Ga0207705_100317366 | 200 |
| 242 | 3300025915 | Ga0207693_10000238 | Ga0207693_1000023813 | 200 |
| 243 | 3300025915 | Ga0207693_10433087 | Ga0207693_104330871 | 200 |
| 244 | 3300025918 | Ga0207662_10002553 | Ga0207662_100025539 | 200 |
| 245 | 3300025919 | Ga0207657_10000279 | Ga0207657_1000027919 | 200 |
| 246 | 3300025920 | Ga0207649_10005852 | Ga0207649_100058522 | 200 |
| 247 | 3300025923 | Ga0207681_10025475 | Ga0207681_100254755 | 200 |
| 248 | 3300025924 | Ga0207694_10198113 | Ga0207694_101981132 | 200 |
| 249 | 3300025925 | Ga0207650_10021771 | Ga0207650_100217714 | 200 |
| 250 | 3300025926 | Ga0207659_10059941 | Ga0207659_100599412 | 200 |
| 251 | 3300025927 | Ga0207687_10013340 | Ga0207687_100133403 | 200 |
| 252 | 3300025929 | Ga0207664_10015131 | Ga0207664_100151317 | 200 |
| 253 | 3300025931 | Ga0207644_10017693 | Ga0207644_100176935 | 200 |
| 254 | 3300025932 | Ga0207690_10001432 | Ga0207690_100014325 | 200 |
| 255 | 3300025933 | Ga0207706_10000298 | Ga0207706_1000029818 | 200 |
| 256 | 3300025933 | Ga0207706_10399361 | Ga0207706_103993612 | 200 |
| 257 | 3300025934 | Ga0207686_10075307 | Ga0207686_100753072 | 200 |
| 258 | 3300025935 | Ga0207709_10001191 | Ga0207709_1000119115 | 200 |
| 259 | 3300025937 | Ga0207669_10179712 | Ga0207669_101797123 | 200 |
| 260 | 3300025937 | Ga0207669_10261141 | Ga0207669_102611412 | 200 |
| 261 | 3300025938 | Ga0207704_10013740 | Ga0207704_100137405 | 200 |
| 262 | 3300025938 | Ga0207704_10122340 | Ga0207704_101223403 | 200 |
| 263 | 3300025939 | Ga0207665_10000284 | Ga0207665_1000028415 | 200 |
| 264 | 3300025940 | Ga0207691_10085392 | Ga0207691_100853923 | 200 |
| 265 | 3300025941 | Ga0207711_10026025 | Ga0207711_100260257 | 200 |
| 266 | 3300025941 | Ga0207711_10063391 | Ga0207711_100633913 | 200 |
| 267 | 3300025942 | Ga0207689_10006893 | Ga0207689_1000689311 | 200 |
| 268 | 3300025944 | Ga0207661_10265804 | Ga0207661_102658042 | 200 |
| 269 | 3300025945 | Ga0207679_10003035 | Ga0207679_100030355 | 200 |
| 270 | 3300025960 | Ga0207651_10016117 | Ga0207651_100161171 | 200 |
| 271 | 3300025961 | Ga0207712_10001524 | Ga0207712_1000152412 | 200 |
| 272 | 3300025981 | Ga0207640_10003161 | Ga0207640_100031613 | 200 |
| 273 | 3300025986 | Ga0207658_10035985 | Ga0207658_100359853 | 200 |
| 274 | 3300025986 | Ga0207658_10038862 | Ga0207658_100388622 | 200 |
| 275 | 3300025986 | Ga0207658_10192485 | Ga0207658_101924852 | 200 |
| 276 | 3300026023 | Ga0207677_10007579 | Ga0207677_100075795 | 200 |
| 277 | 3300026035 | Ga0207703_10002953 | Ga0207703_100029536 | 200 |
| 278 | 3300026035 | Ga0207703_10242917 | Ga0207703_102429172 | 200 |
| 279 | 3300026035 | Ga0207703_10541309 | Ga0207703_105413092 | 200 |
| 280 | 3300026041 | Ga0207639_10002918 | Ga0207639_100029185 | 200 |
| 281 | 3300026067 | Ga0207678_10000147 | Ga0207678_1000014718 | 200 |
| 282 | 3300026075 | Ga0207708_10014662 | Ga0207708_100146626 | 200 |
| 283 | 3300026078 | Ga0207702_10021467 | Ga0207702_100214673 | 200 |
| 284 | 3300026088 | Ga0207641_10002538 | Ga0207641_1000253818 | 200 |
| 285 | 3300026089 | Ga0207648_10007041 | Ga0207648_100070419 | 200 |
| 286 | 3300026116 | Ga0207674_10008721 | Ga0207674_1000872112 | 200 |
| 287 | 3300026118 | Ga0207675_100000256 | Ga0207675_10000025615 | 200 |
| 288 | 3300026118 | Ga0207675_100577396 | Ga0207675_1005773961 | 200 |
| 289 | 3300026121 | Ga0207683_10001913 | Ga0207683_1000191318 | 200 |
| 290 | 3300026121 | Ga0207683_10539369 | Ga0207683_105393692 | 200 |
| 291 | 3300026142 | Ga0207698_10389714 | Ga0207698_103897143 | 200 |
| 292 | 3300028380 | Ga0268265_10023565 | Ga0268265_100235652 | 200 |
| 293 | 3300035111 | Ga0373923_0028703 | Ga0373923_0028703_71_730 | 200 |
| 294 | 3300035241 | Ga0373961_0026324 | Ga0373961_0026324_461_1141 | 200 |
| 295 | 3300035691 | Ga0373931_0006372 | Ga0373931_0006372_1918_2598 | 200 |
| 296 | 3300035724 | Ga0373933_0555575 | Ga0373933_0555575_60_719 | 200 |
| 297 | 3300037068 | Ga0373925_0054716 | Ga0373925_0054716_839_1498 | 200 |
| 298 | 3300037418 | Ga0395900_0017819 | Ga0395900_0017819_2806_3486 | 200 |
| 299 | 3300037466 | Ga0395898_0031751 | Ga0395898_0031751_36_716 | 200 |
| 300 | 3300037471 | Ga0395905_0006470 | Ga0395905_0006470_9327_10007 | 200 |
| 301 | 3300037471 | Ga0395905_0096605 | Ga0395905_0096605_1574_2239 | 200 |
| 302 | 3300038443 | Ga0395901_0002999 | Ga0395901_0002999_4453_5133 | 200 |
| 303 | 3300038443 | Ga0395901_0895899 | Ga0395901_0895899_22_687 | 200 |
| 304 | 3300039447 | Ga0436361_0195517 | Ga0436361_0195517_687_1358 | 200 |
| 305 | 3300046459 | Ga0495629_0333225 | Ga0495629_0333225_130_789 | 200 |
| 306 | 3300046475 | Ga0495639_0047790 | Ga0495639_0047790_256_933 | 200 |
| 307 | 3300046491 | Ga0495584_0054272 | Ga0495584_0054272_208_873 | 200 |
| 308 | 3300046492 | Ga0495585_0159802 | Ga0495585_0159802_70_735 | 200 |
| 309 | 3300046528 | Ga0495642_0066362 | Ga0495642_0066362_248_913 | 200 |
| 310 | 3300047315 | Ga0495581_0376990 | Ga0495581_0376990_152_811 | 200 |
| 311 | 3300048903 | Ga0496100_0008410 | Ga0496100_0008410_3417_4097 | 200 |
| 312 | 3300048904 | Ga0496101_0018815 | Ga0496101_0018815_1481_2161 | 200 |
| 313 | 3300048905 | Ga0496102_0037946 | Ga0496102_0037946_1508_2173 | 200 |
| 314 | 3300048905 | Ga0496102_0104126 | Ga0496102_0104126_26_706 | 200 |
| 315 | 3300048905 | Ga0496102_0244693 | Ga0496102_0244693_70_735 | 200 |
| 316 | 3300048906 | Ga0496103_0048133 | Ga0496103_0048133_1797_2462 | 200 |
| 317 | 3300048907 | Ga0496104_0072172 | Ga0496104_0072172_2577_3257 | 200 |
| 318 | 3300048908 | Ga0496105_0048412 | Ga0496105_0048412_1298_1978 | 200 |
| 319 | 3300048908 | Ga0496105_0204983 | Ga0496105_0204983_721_1386 | 200 |
| 320 | 3300048911 | Ga0496108_0166751 | Ga0496108_0166751_1042_1719 | 200 |
| 321 | 3300048912 | Ga0496109_0005664 | Ga0496109_0005664_7710_8390 | 200 |
| 322 | 3300048912 | Ga0496109_0009037 | Ga0496109_0009037_80_757 | 200 |
| 323 | 3300048912 | Ga0496109_0020042 | Ga0496109_0020042_3094_3759 | 200 |
| 324 | 3300048913 | Ga0496110_0134197 | Ga0496110_0134197_26_706 | 200 |
| 325 | 3300048913 | Ga0496110_0520265 | Ga0496110_0520265_86_751 | 200 |
| 326 | 3300048914 | Ga0496111_0081335 | Ga0496111_0081335_26_706 | 200 |
| 327 | 3300048914 | Ga0496111_0391215 | Ga0496111_0391215_52_717 | 200 |
| 328 | 3300048915 | Ga0496112_0015126 | Ga0496112_0015126_3741_4406 | 200 |
| 329 | 3300048915 | Ga0496112_0077952 | Ga0496112_0077952_2264_2926 | 200 |
| 330 | 3300048916 | Ga0496113_0011669 | Ga0496113_0011669_2498_3175 | 200 |
| 331 | 3300048916 | Ga0496113_0113918 | Ga0496113_0113918_300_965 | 200 |
| 332 | 3300048917 | Ga0496114_0051367 | Ga0496114_0051367_2661_3326 | 200 |
| 333 | 3300048918 | Ga0496115_0081268 | Ga0496115_0081268_26_706 | 200 |
| 334 | 3300049568 | Ga0501031_0063709 | Ga0501031_0063709_205_870 | 200 |
| 335 | 3300049568 | Ga0501031_0147723 | Ga0501031_0147723_464_1129 | 200 |
| 336 | 3300049568 | Ga0501031_0160858 | Ga0501031_0160858_322_987 | 200 |
| 337 | 3300049572 | Ga0501036_0017879 | Ga0501036_0017879_327_992 | 200 |
| 338 | 3300049572 | Ga0501036_0058717 | Ga0501036_0058717_77_742 | 200 |
| 339 | 3300049575 | Ga0501039_0070544 | Ga0501039_0070544_860_1525 | 200 |
| 340 | 3300049576 | Ga0501040_0023993 | Ga0501040_0023993_700_1365 | 200 |
| 341 | 3300049578 | Ga0501042_0067484 | Ga0501042_0067484_385_1050 | 200 |
| 342 | 3300049578 | Ga0501042_0226804 | Ga0501042_0226804_439_1104 | 200 |
| 343 | 3300049580 | Ga0501046_0025395 | Ga0501046_0025395_1760_2425 | 200 |
| 344 | 3300049580 | Ga0501046_0109221 | Ga0501046_0109221_1205_1870 | 200 |
| 345 | 3300049582 | Ga0501048_0015303 | Ga0501048_0015303_2161_2826 | 200 |
| 346 | 3300049583 | Ga0501067_0145237 | Ga0501067_0145237_612_1277 | 200 |
| 347 | 3300049584 | Ga0501068_0345474 | Ga0501068_0345474_56_721 | 200 |
| 348 | 3300049587 | Ga0501071_0260680 | Ga0501071_0260680_392_1057 | 200 |
| 349 | 3300049587 | Ga0501071_0488692 | Ga0501071_0488692_134_799 | 200 |
| 350 | 3300049588 | Ga0501072_0011838 | Ga0501072_0011838_507_1172 | 200 |
| 351 | 3300049588 | Ga0501072_0034108 | Ga0501072_0034108_2008_2673 | 200 |
| 352 | 3300049589 | Ga0501073_0148812 | Ga0501073_0148812_516_1181 | 200 |
| 353 | 3300049590 | Ga0501074_0113001 | Ga0501074_0113001_1038_1703 | 200 |
| 354 | 3300049591 | Ga0501075_0020334 | Ga0501075_0020334_682_1347 | 200 |
| 355 | 3300049592 | Ga0501076_0004312 | Ga0501076_0004312_6673_7338 | 200 |
| 356 | 3300049592 | Ga0501076_0216961 | Ga0501076_0216961_606_1271 | 200 |
| 357 | 3300049592 | Ga0501076_0254114 | Ga0501076_0254114_241_906 | 200 |
| 358 | 3300049592 | Ga0501076_0277445 | Ga0501076_0277445_297_962 | 200 |
| 359 | 3300049741 | Ga0501079_0086865 | Ga0501079_0086865_958_1623 | 200 |
| 360 | 3300049741 | Ga0501079_0097883 | Ga0501079_0097883_974_1639 | 200 |
| 361 | 3300049741 | Ga0501079_0224622 | Ga0501079_0224622_308_973 | 200 |
| 362 | 3300049742 | Ga0501080_0073886 | Ga0501080_0073886_234_899 | 200 |
| 363 | 3300049742 | Ga0501080_0398776 | Ga0501080_0398776_283_948 | 200 |
| 364 | 3300049743 | Ga0501081_0028321 | Ga0501081_0028321_1548_2213 | 200 |
| 365 | 3300049743 | Ga0501081_0118134 | Ga0501081_0118134_385_1050 | 200 |
| 366 | 3300049822 | Ga0501035_0067440 | Ga0501035_0067440_525_1190 | 200 |
| 367 | 3300049822 | Ga0501035_0446177 | Ga0501035_0446177_169_834 | 200 |
| 368 | 3300049824 | Ga0501045_0026020 | Ga0501045_0026020_1491_2156 | 200 |
| 369 | 3300050507 | nmdc:mga05p37_254974_c1 | nmdc:mga05p37_254974_c1_1143_1823 | 200 |
| 370 | 3300050510 | nmdc:mga06r32_24408_c1 | nmdc:mga06r32_24408_c1_14_679 | 200 |
| 371 | 3300050511 | nmdc:mga08y16_234504_c1 | nmdc:mga08y16_234504_c1_11_676 | 200 |
| 372 | 3300050512 | nmdc:mga0n895_217567_c1 | nmdc:mga0n895_217567_c1_38_718 | 200 |
| 373 | 3300050512 | nmdc:mga0n895_64149_c1 | nmdc:mga0n895_64149_c1_1252_1917 | 200 |
| 374 | 3300050513 | nmdc:mga0rr50_3609_c1 | nmdc:mga0rr50_3609_c1_332_1012 | 200 |
| 375 | 3300050515 | nmdc:mga0a205_160923_c1 | nmdc:mga0a205_160923_c1_1264_1929 | 200 |
| 376 | 3300050515 | nmdc:mga0a205_97692_c1 | nmdc:mga0a205_97692_c1_606_1286 | 200 |
| 377 | 3300054114 | Ga0501084_0008187 | Ga0501084_0008187_6108_6773 | 200 |
| 378 | 3300054114 | Ga0501084_0012678 | Ga0501084_0012678_799_1464 | 200 |
| 379 | 3300060353 | Ga0501082_0007239 | Ga0501082_0007239_327_992 | 200 |
| 380 | 3300060353 | Ga0501082_0188886 | Ga0501082_0188886_540_1205 | 200 |
| 381 | 3300061734 | Ga0530510_0062320 | Ga0530510_0062320_1418_2083 | 200 |
| 382 | 3300061734 | Ga0530510_0666168 | Ga0530510_0666168_34_699 | 200 |
| 383 | 3300005436 | Ga0070713_100713526 | Ga0070713_1007135262 | 201 |
| 384 | 3300005439 | Ga0070711_100016397 | Ga0070711_1000163973 | 201 |
| 385 | 3300006175 | Ga0070712_100042094 | Ga0070712_1000420946 | 201 |
| 386 | 3300025928 | Ga0207700_10021851 | Ga0207700_100218516 | 201 |
| 387 | 3300035117 | Ga0373953_0023137 | Ga0373953_0023137_1081_1743 | 201 |
| 388 | 3300035119 | Ga0373956_0134441 | Ga0373956_0134441_139_801 | 201 |
| 389 | 3300035410 | Ga0373924_0098401 | Ga0373924_0098401_241_903 | 201 |
| 390 | 3300035692 | Ga0373935_0065872 | Ga0373935_0065872_624_1286 | 201 |
| 391 | 3300035695 | Ga0373927_0384298 | Ga0373927_0384298_18_680 | 201 |
| 392 | 3300035724 | Ga0373933_0006192 | Ga0373933_0006192_630_1292 | 201 |
| 393 | 3300035724 | Ga0373933_0021820 | Ga0373933_0021820_543_1205 | 201 |
| 394 | 3300036401 | Ga0373937_0001999 | Ga0373937_0001999_319_981 | 201 |
| 395 | 3300036401 | Ga0373937_0031629 | Ga0373937_0031629_3513_4175 | 201 |
| 396 | 3300037853 | Ga0436364_0394424 | Ga0436364_0394424_1154_1825 | 201 |
| 397 | 3300037853 | Ga0436364_1005063 | Ga0436364_1005063_3095_3745 | 201 |
| 398 | 3300037853 | Ga0436364_1087062 | Ga0436364_1087062_873_1523 | 201 |
| 399 | 3300046463 | Ga0495653_0123340 | Ga0495653_0123340_1167_1829 | 201 |
| 400 | 3300046477 | Ga0495664_0000913 | Ga0495664_0000913_12402_13064 | 201 |
| 401 | 3300046511 | Ga0495608_0017576 | Ga0495608_0017576_614_1276 | 201 |
| 402 | 3300046511 | Ga0495608_0071114 | Ga0495608_0071114_1472_2134 | 201 |
| 403 | 3300046533 | Ga0495640_0270618 | Ga0495640_0270618_81_743 | 201 |
| 404 | 3300046536 | Ga0495587_0039403 | Ga0495587_0039403_117_779 | 201 |
| 405 | 3300046543 | Ga0495645_0000977 | Ga0495645_0000977_15240_15902 | 201 |
| 406 | 3300046559 | Ga0495667_0014051 | Ga0495667_0014051_1222_1884 | 201 |
| 407 | 3300046559 | Ga0495667_0035914 | Ga0495667_0035914_1499_2161 | 201 |
| 408 | 3300046663 | Ga0495635_0152832 | Ga0495635_0152832_460_1122 | 201 |
| 409 | 3300046678 | Ga0495599_0067125 | Ga0495599_0067125_378_1040 | 201 |
| 410 | 3300047317 | Ga0495604_0009634 | Ga0495604_0009634_4830_5492 | 201 |
| 411 | 3300047319 | Ga0495674_0012361 | Ga0495674_0012361_4433_5095 | 201 |
| 412 | 3300047444 | Ga0495675_0003841 | Ga0495675_0003841_4430_5092 | 201 |
| 413 | 3300047471 | Ga0495684_0147893 | Ga0495684_0147893_566_1228 | 201 |
| 414 | 3300048088 | Ga0495602_0000695 | Ga0495602_0000695_11588_12250 | 201 |
| 415 | 3300048088 | Ga0495602_0029666 | Ga0495602_0029666_1850_2512 | 201 |
| 416 | 3300049584 | Ga0501068_0496248 | Ga0501068_0496248_30_698 | 201 |
| 417 | 3300053077 | Ga0495601_0001469 | Ga0495601_0001469_8354_9016 | 201 |
| 418 | 3300053078 | Ga0495612_0004354 | Ga0495612_0004354_1482_2144 | 201 |
| 419 | 3300053083 | Ga0495655_0000735 | Ga0495655_0000735_2531_3199 | 201 |
| 420 | 3300053085 | Ga0495619_0032408 | Ga0495619_0032408_2107_2769 | 201 |
| 421 | 3300005367 | Ga0070667_100000028 | Ga0070667_10000002851 | 202 |
| 422 | 3300009101 | Ga0105247_10131204 | Ga0105247_101312042 | 202 |
| 423 | 3300014325 | Ga0163163_10280619 | Ga0163163_102806192 | 202 |
| 424 | 3300014968 | Ga0157379_10163155 | Ga0157379_101631552 | 202 |
| 425 | 3300025900 | Ga0207710_10032357 | Ga0207710_100323572 | 202 |
| 426 | 3300025986 | Ga0207658_10000054 | Ga0207658_1000005473 | 202 |
| 427 | 3300048907 | Ga0496104_0057463 | Ga0496104_0057463_2119_2781 | 202 |
| 428 | 3300048908 | Ga0496105_0217912 | Ga0496105_0217912_862_1524 | 202 |
| 429 | 3300048908 | Ga0496105_0229246 | Ga0496105_0229246_327_989 | 202 |
| 430 | 3300048909 | Ga0496106_0376429 | Ga0496106_0376429_193_855 | 202 |
| 431 | 3300048910 | Ga0496107_0050277 | Ga0496107_0050277_1775_2437 | 202 |
| 432 | 3300048915 | Ga0496112_0021110 | Ga0496112_0021110_2817_3479 | 202 |
| 433 | 3300048915 | Ga0496112_0141800 | Ga0496112_0141800_1035_1697 | 202 |
| 434 | 3300048916 | Ga0496113_0658997 | Ga0496113_0658997_102_764 | 202 |
| 435 | 3300005444 | Ga0070694_100579684 | Ga0070694_1005796841 | 203 |
| 436 | 3300009094 | Ga0111539_10206003 | Ga0111539_102060033 | 203 |
| 437 | 3300013306 | Ga0163162_10560727 | Ga0163162_105607271 | 203 |
| 438 | 3300026075 | Ga0207708_10047523 | Ga0207708_100475233 | 203 |
| 439 | 3300028380 | Ga0268265_10352264 | Ga0268265_103522642 | 203 |
| 440 | 3300035115 | Ga0373941_0046731 | Ga0373941_0046731_524_1198 | 203 |
| 441 | 3300035170 | Ga0373943_0050510 | Ga0373943_0050510_88_762 | 203 |
| 442 | 3300035691 | Ga0373931_0079411 | Ga0373931_0079411_717_1391 | 203 |
| 443 | 3300035695 | Ga0373927_0031719 | Ga0373927_0031719_373_1047 | 203 |
| 444 | 3300035725 | Ga0373947_0030940 | Ga0373947_0030940_200_874 | 203 |
| 445 | 3300036401 | Ga0373937_0077997 | Ga0373937_0077997_608_1282 | 203 |
| 446 | 3300037068 | Ga0373925_0034512 | Ga0373925_0034512_1489_2163 | 203 |
| 447 | 3300037853 | Ga0436364_0113032 | Ga0436364_0113032_1142_1819 | 203 |
| 448 | 3300046455 | Ga0495603_0000627 | Ga0495603_0000627_6934_7608 | 203 |
| 449 | 3300046455 | Ga0495603_0225118 | Ga0495603_0225118_370_1044 | 203 |
| 450 | 3300046459 | Ga0495629_0000108 | Ga0495629_0000108_70396_71070 | 203 |
| 451 | 3300046461 | Ga0495641_0014389 | Ga0495641_0014389_1764_2438 | 203 |
| 452 | 3300046473 | Ga0495582_0002320 | Ga0495582_0002320_6627_7301 | 203 |
| 453 | 3300046475 | Ga0495639_0003785 | Ga0495639_0003785_5610_6284 | 203 |
| 454 | 3300046499 | Ga0495594_0000131 | Ga0495594_0000131_22430_23104 | 203 |
| 455 | 3300046557 | Ga0495622_0002289 | Ga0495622_0002289_3405_4079 | 203 |
| 456 | 3300046642 | Ga0495634_0030817 | Ga0495634_0030817_1399_2073 | 203 |
| 457 | 3300046674 | Ga0495588_0005127 | Ga0495588_0005127_4887_5561 | 203 |
| 458 | 3300046681 | Ga0495647_0170884 | Ga0495647_0170884_255_929 | 203 |
| 459 | 3300046683 | Ga0495658_0002461 | Ga0495658_0002461_6767_7441 | 203 |
| 460 | 3300046689 | Ga0495613_0003651 | Ga0495613_0003651_8106_8780 | 203 |
| 461 | 3300047322 | Ga0495680_0016038 | Ga0495680_0016038_3847_4521 | 203 |
| 462 | 3300047673 | Ga0495593_0001789 | Ga0495593_0001789_6017_6691 | 203 |
| 463 | 3300048089 | Ga0495614_0004916 | Ga0495614_0004916_1387_2061 | 203 |
| 464 | 3300048903 | Ga0496100_0142028 | Ga0496100_0142028_147_821 | 203 |
| 465 | 3300048905 | Ga0496102_0807625 | Ga0496102_0807625_136_810 | 203 |
| 466 | 3300048910 | Ga0496107_0748066 | Ga0496107_0748066_15_689 | 203 |
| 467 | 3300048912 | Ga0496109_0636397 | Ga0496109_0636397_29_703 | 203 |
| 468 | 3300048917 | Ga0496114_0644286 | Ga0496114_0644286_144_818 | 203 |
| 469 | 3300049568 | Ga0501031_0036204 | Ga0501031_0036204_1916_2590 | 203 |
| 470 | 3300049569 | Ga0501032_0047964 | Ga0501032_0047964_501_1175 | 203 |
| 471 | 3300049571 | Ga0501034_0356217 | Ga0501034_0356217_232_906 | 203 |
| 472 | 3300049572 | Ga0501036_0059150 | Ga0501036_0059150_1632_2306 | 203 |
| 473 | 3300049573 | Ga0501037_0096695 | Ga0501037_0096695_974_1648 | 203 |
| 474 | 3300049574 | Ga0501038_0160916 | Ga0501038_0160916_490_1164 | 203 |
| 475 | 3300049576 | Ga0501040_0026777 | Ga0501040_0026777_2714_3388 | 203 |
| 476 | 3300049577 | Ga0501041_0103965 | Ga0501041_0103965_257_931 | 203 |
| 477 | 3300049577 | Ga0501041_0262667 | Ga0501041_0262667_149_823 | 203 |
| 478 | 3300049578 | Ga0501042_0013323 | Ga0501042_0013323_2476_3150 | 203 |
| 479 | 3300049579 | Ga0501043_0035736 | Ga0501043_0035736_466_1140 | 203 |
| 480 | 3300049580 | Ga0501046_0162944 | Ga0501046_0162944_520_1194 | 203 |
| 481 | 3300049582 | Ga0501048_0097007 | Ga0501048_0097007_893_1567 | 203 |
| 482 | 3300049587 | Ga0501071_0019202 | Ga0501071_0019202_3918_4592 | 203 |
| 483 | 3300049588 | Ga0501072_0002082 | Ga0501072_0002082_9943_10617 | 203 |
| 484 | 3300049589 | Ga0501073_0486557 | Ga0501073_0486557_85_759 | 203 |
| 485 | 3300049591 | Ga0501075_0032984 | Ga0501075_0032984_2050_2724 | 203 |
| 486 | 3300049592 | Ga0501076_0011455 | Ga0501076_0011455_5678_6352 | 203 |
| 487 | 3300049593 | Ga0501077_0070587 | Ga0501077_0070587_838_1512 | 203 |
| 488 | 3300049741 | Ga0501079_0076427 | Ga0501079_0076427_722_1396 | 203 |
| 489 | 3300049742 | Ga0501080_0118384 | Ga0501080_0118384_1051_1725 | 203 |
| 490 | 3300049743 | Ga0501081_0060831 | Ga0501081_0060831_1443_2117 | 203 |
| 491 | 3300049744 | Ga0501083_0158520 | Ga0501083_0158520_749_1423 | 203 |
| 492 | 3300049822 | Ga0501035_0141581 | Ga0501035_0141581_38_712 | 203 |
| 493 | 3300049824 | Ga0501045_0058467 | Ga0501045_0058467_1894_2568 | 203 |
| 494 | 3300049824 | Ga0501045_0685090 | Ga0501045_0685090_55_729 | 203 |
| 495 | 3300054114 | Ga0501084_0241590 | Ga0501084_0241590_813_1487 | 203 |
| 496 | 3300054114 | Ga0501084_0448594 | Ga0501084_0448594_322_996 | 203 |
| 497 | 3300060353 | Ga0501082_0142108 | Ga0501082_0142108_1165_1839 | 203 |
| 498 | 3300060353 | Ga0501082_0457848 | Ga0501082_0457848_148_822 | 203 |
| 499 | 3300061734 | Ga0530510_0074535 | Ga0530510_0074535_676_1350 | 203 |
| 500 | 3300005330 | Ga0070690_100380366 | Ga0070690_1003803662 | 204 |
| 501 | 3300005438 | Ga0070701_10039677 | Ga0070701_100396773 | 204 |
| 502 | 3300005543 | Ga0070672_100139993 | Ga0070672_1001399932 | 204 |
| 503 | 3300005544 | Ga0070686_100154702 | Ga0070686_1001547022 | 204 |
| 504 | 3300005545 | Ga0070695_100211989 | Ga0070695_1002119892 | 204 |
| 505 | 3300005617 | Ga0068859_100412148 | Ga0068859_1004121482 | 204 |
| 506 | 3300005718 | Ga0068866_10085206 | Ga0068866_100852063 | 204 |
| 507 | 3300005719 | Ga0068861_100012716 | Ga0068861_1000127165 | 204 |
| 508 | 3300005843 | Ga0068860_100214006 | Ga0068860_1002140062 | 204 |
| 509 | 3300005844 | Ga0068862_100202146 | Ga0068862_1002021461 | 204 |
| 510 | 3300005937 | Ga0081455_10004482 | Ga0081455_1000448216 | 204 |
| 511 | 3300006237 | Ga0097621_100391783 | Ga0097621_1003917832 | 204 |
| 512 | 3300006931 | Ga0097620_100412169 | Ga0097620_1004121692 | 204 |
| 513 | 3300009098 | Ga0105245_10992185 | Ga0105245_109921852 | 204 |
| 514 | 3300009148 | Ga0105243_10264163 | Ga0105243_102641632 | 204 |
| 515 | 3300009545 | Ga0105237_11196233 | Ga0105237_111962331 | 204 |
| 516 | 3300009553 | Ga0105249_10009909 | Ga0105249_100099095 | 204 |
| 517 | 3300011119 | Ga0105246_10067183 | Ga0105246_100671834 | 204 |
| 518 | 3300013297 | Ga0157378_10073211 | Ga0157378_100732115 | 204 |
| 519 | 3300013308 | Ga0157375_10025195 | Ga0157375_100251952 | 204 |
| 520 | 3300014326 | Ga0157380_10117920 | Ga0157380_101179202 | 204 |
| 521 | 3300014968 | Ga0157379_10066825 | Ga0157379_100668254 | 204 |
| 522 | 3300014969 | Ga0157376_10110608 | Ga0157376_101106082 | 204 |
| 523 | 3300017792 | Ga0163161_10019758 | Ga0163161_100197585 | 204 |
| 524 | 3300025901 | Ga0207688_10162135 | Ga0207688_101621353 | 204 |
| 525 | 3300025937 | Ga0207669_10061713 | Ga0207669_100617133 | 204 |
| 526 | 3300025940 | Ga0207691_10382831 | Ga0207691_103828312 | 204 |
| 527 | 3300025961 | Ga0207712_10083788 | Ga0207712_100837882 | 204 |
| 528 | 3300026035 | Ga0207703_10019705 | Ga0207703_100197055 | 204 |
| 529 | 3300026089 | Ga0207648_10099390 | Ga0207648_100993904 | 204 |
| 530 | 3300026121 | Ga0207683_10390414 | Ga0207683_103904142 | 204 |
| 531 | 3300028380 | Ga0268265_10112108 | Ga0268265_101121081 | 204 |
| 532 | 3300046455 | Ga0495603_0267224 | Ga0495603_0267224_240_902 | 204 |
| 533 | 3300048904 | Ga0496101_0084385 | Ga0496101_0084385_1220_1882 | 204 |
| 534 | 3300048907 | Ga0496104_0034302 | Ga0496104_0034302_964_1626 | 204 |
| 535 | 3300048910 | Ga0496107_0028111 | Ga0496107_0028111_3185_3847 | 204 |
| 536 | 3300048918 | Ga0496115_0069189 | Ga0496115_0069189_1296_1958 | 204 |
| 537 | 3300031548 | Ga0307408_100349405 | Ga0307408_1003494052 | 205 |
| 538 | 3300032002 | Ga0307416_100290349 | Ga0307416_1002903493 | 205 |
| 539 | 3300014326 | Ga0157380_10715275 | Ga0157380_107152751 | 206 |
| 540 | 3300031995 | Ga0307409_100087034 | Ga0307409_1000870343 | 206 |
| 541 | 2162886007 | SwRhRL2b_contig_1806315 | SwRhRL2b_0510.00008480 | 208 |
| 542 | 2162886007 | SwRhRL2b_contig_2605276 | SwRhRL2b_0908.00004850 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.9048 | 10 | 199 |
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.8258 | 10 | 199 |
| 1ui1-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 | 0.7393 | 10 | 203 |
| 6u15-assembly1.cif.gz_A | human thymine dna glycosylase n140a mutant bound to dna with 2'-f-5-carboxyl-dc substrate analog | 0.7256 | 37 | 201 |
| 3uo7-assembly1.cif.gz_A | crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine | 0.7128 | 37 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9062 | 10 | 199 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8915 | 12 | 198 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8271 | 10 | 199 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8014 | 12 | 198 | 3.40.470.10 |
| af_O59825_127_324_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7235 | 37 | 198 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5L050-F1-model_v4 | Uracil-DNA glycosylase | 0.9917 | 8 | 108 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A383CLQ7-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.9887 | 8 | 142 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A350KEA7-F1-model_v4 | deleted | 0.9882 | 31 | 125 |
|
| AF-A0A6B3CEB1-F1-model_v4 | Uracil-DNA glycosylase | 0.9878 | 36 | 116 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A7V8ZNF6-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.9874 | 5 | 135 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar