F461466

General Info

Members Datasets Scaffolds Average Seq Length
542 329 539 221

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10004482|Ga0081455_1000448216
Length 247
Sequence MDARIKSGHDVSICARSSGLRHMPLIDLTRAHSAEPSKDCPLCPRLVQFRKDNRKAHPDWFNGAVPSFGPETARLLIVGLAPGLKGANRTGRPFLGDYAGELLYGTLLKVGLARGRHDPAAPQELELVDCMISNAVRCVPPANKPTPEEVGNCRQFLAGRIHALPELRAILALGRIAHDGVLDALQVRRRDFPFAHGARHVLLSGLLLFDSYHCSRQNTSTGRLTTPMFETVVSEVAASLRGPPETG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
203 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
204 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
307 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
313 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
316 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
319 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
320 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
321 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
325 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
329 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0.37
Rhizoplane 9.04
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1806315 2162886007 Bacteria 1280
2 SwRhRL2b_contig_2605276 2162886007 Bacteria 1147
3 JGI24746J21847_1008036 3300001977 Unclassified 1601
4 JGI24739J22299_10033922 3300001989 Unclassified 1742
5 JGI24737J22298_10028612 3300001990 Unclassified 1751
6 JGI24750J21931_1000903 3300002070 Bacteria 4032
7 JGI24738J21930_10008109 3300002075 Unclassified 2398
8 JGI25153J46596_10037647 3300003215 Bacteria 1535
9 Ga0070658_10031372 3300005327 Bacteria 4267
10 Ga0070676_10007925 3300005328 Bacteria 5710
11 Ga0070690_100000780 3300005330 Bacteria 16166
12 Ga0070690_100380366 3300005330 Bacteria 1032
13 Ga0070670_100001837 3300005331 Bacteria 17301
14 Ga0070677_10039552 3300005333 Unclassified 1851
15 Ga0068869_100004906 3300005334 Bacteria 8371
16 Ga0070666_10002181 3300005335 Bacteria 11896
17 Ga0070680_100052784 3300005336 Bacteria 3317
18 Ga0070682_100000868 3300005337 Bacteria 17634
19 Ga0068868_100002238 3300005338 Bacteria 13379
20 Ga0068868_100286232 3300005338 Unclassified 1396
21 Ga0070660_100000822 3300005339 Bacteria 20602
22 Ga0070689_100001665 3300005340 Bacteria 14184
23 Ga0070691_10001014 3300005341 Bacteria 11527
24 Ga0070687_100014448 3300005343 Bacteria 3547
25 Ga0070661_100000197 3300005344 Bacteria 50071
26 Ga0070692_10029717 3300005345 Bacteria 2726
27 Ga0070668_100000339 3300005347 Bacteria 30929
28 Ga0070669_100000542 3300005353 Bacteria 28160
29 Ga0070675_100005758 3300005354 Bacteria 9479
30 Ga0070671_100003157 3300005355 Bacteria 12848
31 Ga0070674_100011081 3300005356 Bacteria 5473
32 Ga0070673_100000612 3300005364 Bacteria 19530
33 Ga0070688_100000119 3300005365 Bacteria 41289
34 Ga0070659_100002119 3300005366 Bacteria 14126
35 Ga0070667_100000028 3300005367 Bacteria 180376
36 Ga0070667_100060908 3300005367 Bacteria 3195
37 Ga0070667_100098848 3300005367 Bacteria 2518
38 Ga0070709_10000481 3300005434 Bacteria 23495
39 Ga0070714_100002193 3300005435 Bacteria 14373
40 Ga0070713_100009063 3300005436 Bacteria 7097
41 Ga0070713_100713526 3300005436 Unclassified 958
42 Ga0070710_10001367 3300005437 Bacteria 11521
43 Ga0070701_10000488 3300005438 Bacteria 13564
44 Ga0070701_10039677 3300005438 Bacteria 2390
45 Ga0070711_100000677 3300005439 Bacteria 17860
46 Ga0070711_100016397 3300005439 Bacteria 4705
47 Ga0070711_100234492 3300005439 Bacteria 1432
48 Ga0070705_100000494 3300005440 Bacteria 22730
49 Ga0070700_100003352 3300005441 Bacteria 8262
50 Ga0070694_100021641 3300005444 Bacteria 4112
51 Ga0070694_100579684 3300005444 Bacteria 901
52 Ga0070663_100000855 3300005455 Bacteria 16513
53 Ga0070678_100000183 3300005456 Bacteria 27374
54 Ga0070662_100066073 3300005457 Unclassified 2653
55 Ga0070662_100302037 3300005457 Bacteria 1301
56 Ga0070681_10146084 3300005458 Bacteria 2294
57 Ga0068867_100014445 3300005459 Bacteria 5597
58 Ga0070698_100076013 3300005471 Bacteria 3362
59 Ga0070699_100117932 3300005518 Unclassified 2333
60 Ga0070679_100038121 3300005530 Bacteria 4778
61 Ga0070684_100046137 3300005535 Bacteria 3775
62 Ga0070697_100002769 3300005536 Bacteria 13494
63 Ga0068853_100000537 3300005539 Bacteria 25735
64 Ga0070672_100085295 3300005543 Unclassified 2538
65 Ga0070672_100139993 3300005543 Bacteria 1995
66 Ga0070686_100154702 3300005544 Bacteria 1609
67 Ga0070686_100428489 3300005544 Bacteria 1012
68 Ga0070695_100007432 3300005545 Bacteria 6499
69 Ga0070695_100013353 3300005545 Bacteria 4934
70 Ga0070695_100211989 3300005545 Bacteria 1391
71 Ga0070696_100001626 3300005546 Bacteria 14749
72 Ga0070693_100000106 3300005547 Bacteria 37502
73 Ga0070665_100105925 3300005548 Bacteria 2814
74 Ga0070704_100001004 3300005549 Bacteria 14418
75 Ga0070704_100234108 3300005549 Bacteria 1500
76 Ga0068855_100012257 3300005563 Bacteria 10361
77 Ga0070664_100000182 3300005564 Bacteria 44467
78 Ga0068857_100000505 3300005577 Bacteria 27976
79 Ga0068854_100022193 3300005578 Bacteria 4320
80 Ga0068856_100020684 3300005614 Bacteria 6393
81 Ga0068856_100375434 3300005614 Bacteria 1441
82 Ga0070702_100000684 3300005615 Bacteria 12743
83 Ga0070702_100037692 3300005615 Bacteria 2685
84 Ga0068852_100002310 3300005616 Bacteria 13102
85 Ga0068852_100803384 3300005616 Bacteria 955
86 Ga0068859_100005071 3300005617 Bacteria 13373
87 Ga0068859_100412148 3300005617 Bacteria 1447
88 Ga0068864_100150302 3300005618 Bacteria 2109
89 Ga0068866_10003533 3300005718 Bacteria 6402
90 Ga0068866_10085206 3300005718 Bacteria 1707
91 Ga0068861_100000179 3300005719 Bacteria 33782
92 Ga0068861_100012716 3300005719 Bacteria 5874
93 Ga0068851_10010050 3300005834 Bacteria 4408
94 Ga0068863_100014960 3300005841 Bacteria 7452
95 Ga0068858_100005862 3300005842 Bacteria 11998
96 Ga0068858_100032058 3300005842 Bacteria 4882
97 Ga0068860_100001853 3300005843 Bacteria 22493
98 Ga0068860_100214006 3300005843 Bacteria 1870
99 Ga0068862_100001564 3300005844 Bacteria 20887
100 Ga0068862_100202146 3300005844 Bacteria 1792
101 Ga0068862_100210439 3300005844 Bacteria 1757
102 Ga0081455_10004482 3300005937 Bacteria 15630
103 Ga0070717_10027719 3300006028 Bacteria 4529
104 Ga0070715_10000596 3300006163 Bacteria 9523
105 Ga0070716_100000486 3300006173 Bacteria 16463
106 Ga0070712_100007148 3300006175 Bacteria 6962
107 Ga0070712_100042094 3300006175 Bacteria 3140
108 Ga0070712_100381355 3300006175 Bacteria 1161
109 Ga0097621_100391783 3300006237 Bacteria 1242
110 Ga0068871_100051199 3300006358 Unclassified 3343
111 Ga0075431_100423907 3300006847 Unclassified 1329
112 Ga0075433_10370255 3300006852 Bacteria 1265
113 Ga0075434_100052916 3300006871 Bacteria 4035
114 Ga0075429_100012905 3300006880 Bacteria 7249
115 Ga0068865_100001379 3300006881 Bacteria 14127
116 Ga0068865_100220136 3300006881 Bacteria 1484
117 Ga0097620_100005071 3300006931 Bacteria 13373
118 Ga0097620_100412169 3300006931 Bacteria 1447
119 Ga0105244_10092703 3300009036 Unclassified 1484
120 Ga0105250_10011711 3300009092 Unclassified 3634
121 Ga0111539_10001601 3300009094 Bacteria 30196
122 Ga0111539_10206003 3300009094 Bacteria 2292
123 Ga0105245_10024137 3300009098 Bacteria 5339
124 Ga0105245_10992185 3300009098 Bacteria 884
125 Ga0105247_10001527 3300009101 Bacteria 16538
126 Ga0105247_10003457 3300009101 Bacteria 10297
127 Ga0105247_10021733 3300009101 Bacteria 3861
128 Ga0105247_10131204 3300009101 Bacteria 1633
129 Ga0114129_10453078 3300009147 Bacteria 1682
130 Ga0105243_10002927 3300009148 Bacteria 14121
131 Ga0105243_10264163 3300009148 Bacteria 1542
132 Ga0105243_10535022 3300009148 Bacteria 1117
133 Ga0105241_10000695 3300009174 Bacteria 25382
134 Ga0105241_10288873 3300009174 Bacteria 1403
135 Ga0105242_10004028 3300009176 Bacteria 11421
136 Ga0105242_10630185 3300009176 Bacteria 1040
137 Ga0105248_10001513 3300009177 Bacteria 25875
138 Ga0105248_10010219 3300009177 Bacteria 10334
139 Ga0105237_10003743 3300009545 Bacteria 17920
140 Ga0105237_10279611 3300009545 Bacteria 1672
141 Ga0105237_10572911 3300009545 Bacteria 1136
142 Ga0105237_11196233 3300009545 Bacteria 767
143 Ga0105238_10123312 3300009551 Bacteria 2570
144 Ga0105238_10351032 3300009551 Bacteria 1464
145 Ga0105249_10001563 3300009553 Bacteria 20095
146 Ga0105249_10009909 3300009553 Bacteria 8352
147 Ga0105239_10008110 3300010375 Bacteria 11988
148 Ga0105246_10000499 3300011119 Bacteria 21360
149 Ga0105246_10067183 3300011119 Bacteria 2512
150 Ga0105246_10283735 3300011119 Bacteria 1330
151 Ga0157373_10004826 3300013100 Bacteria 10143
152 Ga0157371_10002971 3300013102 Bacteria 15741
153 Ga0157370_10040198 3300013104 Bacteria 4516
154 Ga0157369_10007447 3300013105 Bacteria 12606
155 Ga0157374_10015936 3300013296 Bacteria 6604
156 Ga0157378_10000352 3300013297 Bacteria 45160
157 Ga0157378_10073211 3300013297 Bacteria 3080
158 Ga0163162_10021080 3300013306 Bacteria 6410
159 Ga0163162_10560727 3300013306 Bacteria 1270
160 Ga0157372_10004794 3300013307 Bacteria 14369
161 Ga0157375_10024932 3300013308 Bacteria 5545
162 Ga0157375_10025195 3300013308 Bacteria 5521
163 Ga0163163_10004442 3300014325 Bacteria 11963
164 Ga0163163_10028487 3300014325 Bacteria 5365
165 Ga0163163_10280619 3300014325 Bacteria 1717
166 Ga0157380_10117920 3300014326 Bacteria 2243
167 Ga0157380_10715275 3300014326 Bacteria 1008
168 Ga0182008_10036900 3300014497 Bacteria 2446
169 Ga0182008_10093911 3300014497 Bacteria 1480
170 Ga0157377_10003807 3300014745 Bacteria 6854
171 Ga0157379_10000158 3300014968 Bacteria 50531
172 Ga0157379_10017064 3300014968 Bacteria 6392
173 Ga0157379_10063495 3300014968 Bacteria 3301
174 Ga0157379_10066825 3300014968 Bacteria 3214
175 Ga0157379_10163155 3300014968 Bacteria 2011
176 Ga0157376_10000303 3300014969 Bacteria 33063
177 Ga0157376_10110608 3300014969 Bacteria 2417
178 Ga0163161_10006616 3300017792 Bacteria 8026
179 Ga0163161_10019758 3300017792 Bacteria 4726
180 Ga0163161_10206328 3300017792 Bacteria 1516
181 Ga0213872_10017327 3300021361 Bacteria 3331
182 Ga0207656_10042694 3300025321 Unclassified 1931
183 Ga0207653_10104538 3300025885 Unclassified 1005
184 Ga0207682_10069868 3300025893 Unclassified 1486
185 Ga0207692_10002053 3300025898 Bacteria 7687
186 Ga0207710_10004383 3300025900 Bacteria 6166
187 Ga0207710_10032357 3300025900 Bacteria 2290
188 Ga0207710_10056684 3300025900 Bacteria 1768
189 Ga0207688_10000241 3300025901 Bacteria 24846
190 Ga0207688_10162135 3300025901 Bacteria 1326
191 Ga0207680_10049756 3300025903 Unclassified 2496
192 Ga0207647_10001633 3300025904 Bacteria 17238
193 Ga0207685_10000595 3300025905 Bacteria 6302
194 Ga0207645_10028041 3300025907 Bacteria 3635
195 Ga0207705_10031736 3300025909 Bacteria 3772
196 Ga0207707_10124175 3300025912 Bacteria 2257
197 Ga0207695_10537749 3300025913 Bacteria 1050
198 Ga0207693_10000238 3300025915 Bacteria 50667
199 Ga0207693_10433087 3300025915 Bacteria 1028
200 Ga0207662_10002553 3300025918 Bacteria 9166
201 Ga0207657_10000279 3300025919 Bacteria 54382
202 Ga0207649_10005852 3300025920 Bacteria 6662
203 Ga0207681_10025475 3300025923 Bacteria 3805
204 Ga0207694_10198113 3300025924 Unclassified 1633
205 Ga0207694_10253781 3300025924 Bacteria 1440
206 Ga0207650_10021771 3300025925 Unclassified 4533
207 Ga0207659_10059941 3300025926 Unclassified 2737
208 Ga0207687_10013340 3300025927 Bacteria 5365
209 Ga0207700_10021851 3300025928 Bacteria 4378
210 Ga0207700_10112785 3300025928 Bacteria 2191
211 Ga0207664_10015131 3300025929 Bacteria 5590
212 Ga0207644_10017693 3300025931 Bacteria 4819
213 Ga0207690_10001432 3300025932 Bacteria 14930
214 Ga0207706_10000298 3300025933 Bacteria 53969
215 Ga0207706_10399361 3300025933 Bacteria 1192
216 Ga0207686_10075307 3300025934 Unclassified 2184
217 Ga0207709_10001191 3300025935 Bacteria 18784
218 Ga0207669_10061713 3300025937 Bacteria 2305
219 Ga0207669_10179712 3300025937 Unclassified 1515
220 Ga0207669_10261141 3300025937 Bacteria 1295
221 Ga0207704_10013740 3300025938 Bacteria 4065
222 Ga0207704_10122340 3300025938 Bacteria 1784
223 Ga0207665_10000284 3300025939 Bacteria 35246
224 Ga0207691_10085392 3300025940 Unclassified 2833
225 Ga0207691_10382831 3300025940 Bacteria 1201
226 Ga0207711_10026025 3300025941 Bacteria 4907
227 Ga0207711_10063391 3300025941 Unclassified 3190
228 Ga0207689_10006893 3300025942 Bacteria 9990
229 Ga0207661_10265804 3300025944 Unclassified 1529
230 Ga0207679_10003035 3300025945 Bacteria 10398
231 Ga0207651_10016117 3300025960 Bacteria 4366
232 Ga0207712_10001524 3300025961 Bacteria 15682
233 Ga0207712_10083788 3300025961 Bacteria 2328
234 Ga0207640_10003161 3300025981 Bacteria 8864
235 Ga0207658_10000054 3300025986 Bacteria 125062
236 Ga0207658_10035985 3300025986 Bacteria 3549
237 Ga0207658_10038862 3300025986 Bacteria 3432
238 Ga0207658_10192485 3300025986 Unclassified 1696
239 Ga0207677_10007579 3300026023 Bacteria 6021
240 Ga0207703_10002953 3300026035 Bacteria 14420
241 Ga0207703_10019705 3300026035 Bacteria 5273
242 Ga0207703_10242917 3300026035 Bacteria 1619
243 Ga0207703_10541309 3300026035 Bacteria 1097
244 Ga0207639_10002918 3300026041 Bacteria 11492
245 Ga0207639_10717766 3300026041 Bacteria 928
246 Ga0207678_10000147 3300026067 Bacteria 57839
247 Ga0207708_10014662 3300026075 Bacteria 5866
248 Ga0207708_10047523 3300026075 Bacteria 3266
249 Ga0207702_10021467 3300026078 Bacteria 5346
250 Ga0207641_10002538 3300026088 Bacteria 16796
251 Ga0207648_10007041 3300026089 Bacteria 11116
252 Ga0207648_10099390 3300026089 Bacteria 2548
253 Ga0207674_10008721 3300026116 Bacteria 11673
254 Ga0207675_100000256 3300026118 Bacteria 50777
255 Ga0207675_100577396 3300026118 Bacteria 1125
256 Ga0207683_10001913 3300026121 Bacteria 18440
257 Ga0207683_10390414 3300026121 Bacteria 1280
258 Ga0207683_10539369 3300026121 Bacteria 1078
259 Ga0207698_10389714 3300026142 Unclassified 1328
260 Ga0207428_10004621 3300027907 Bacteria 13054
261 Ga0268265_10023565 3300028380 Bacteria 4340
262 Ga0268265_10112108 3300028380 Bacteria 2229
263 Ga0268265_10352264 3300028380 Bacteria 1345
264 Ga0307408_100349405 3300031548 Bacteria 1254
265 Ga0265314_10336768 3300031711 Bacteria 834
266 Ga0307409_100087034 3300031995 Bacteria 2545
267 Ga0307416_100290349 3300032002 Bacteria 1618
268 Ga0373923_0028703 3300035111 Bacteria 2227
269 Ga0373936_0055609 3300035113 Bacteria 1607
270 Ga0373941_0046731 3300035115 Bacteria 1361
271 Ga0373953_0023137 3300035117 Bacteria 2350
272 Ga0373956_0134441 3300035119 Bacteria 1159
273 Ga0373943_0050510 3300035170 Bacteria 2044
274 Ga0373961_0026324 3300035241 Unclassified 1589
275 Ga0373924_0098401 3300035410 Bacteria 1257
276 Ga0373931_0006372 3300035691 Bacteria 5510
277 Ga0373931_0079411 3300035691 Bacteria 1807
278 Ga0373935_0065872 3300035692 Bacteria 2326
279 Ga0373927_0031719 3300035695 Bacteria 3443
280 Ga0373927_0384298 3300035695 Bacteria 926
281 Ga0373933_0006192 3300035724 Bacteria 6513
282 Ga0373933_0021820 3300035724 Bacteria 3642
283 Ga0373933_0555575 3300035724 Bacteria 753
284 Ga0373947_0030940 3300035725 Bacteria 3147
285 Ga0373947_0190308 3300035725 Bacteria 1339
286 Ga0373947_0353415 3300035725 Bacteria 986
287 Ga0373937_0001999 3300036401 Bacteria 17052
288 Ga0373937_0031629 3300036401 Bacteria 4796
289 Ga0373937_0077997 3300036401 Bacteria 3061
290 Ga0373937_0327040 3300036401 Bacteria 1451
291 Ga0373925_0034512 3300037068 Bacteria 3729
292 Ga0373925_0054716 3300037068 Bacteria 2985
293 Ga0395900_0017819 3300037418 Bacteria 7249
294 Ga0395898_0031751 3300037466 Bacteria 5275
295 Ga0395898_0033548 3300037466 Bacteria 5122
296 Ga0395905_0006470 3300037471 Bacteria 11788
297 Ga0395905_0096605 3300037471 Bacteria 2774
298 Ga0436364_0113032 3300037853 Bacteria 1979
299 Ga0436364_0394424 3300037853 Bacteria 2650
300 Ga0436364_1005063 3300037853 Bacteria 4859
301 Ga0436364_1087062 3300037853 Bacteria 3407
302 Ga0436364_1090756 3300037853 Bacteria 759
303 Ga0395901_0002999 3300038443 Bacteria 17024
304 Ga0395901_0895899 3300038443 Bacteria 869
305 Ga0400485_03784 3300038735 Bacteria 1835
306 Ga0400486_26293 3300038742 Bacteria 1788
307 Ga0400483_064186 3300039062 Bacteria 26495
308 Ga0400483_100782 3300039062 Bacteria 3855
309 Ga0400483_181595 3300039062 Bacteria 28212
310 Ga0400483_201439 3300039062 Bacteria 21086
311 Ga0400483_211969 3300039062 Bacteria 11271
312 Ga0436361_0195517 3300039447 Bacteria 2217
313 Ga0436361_0670010 3300039447 Bacteria 47567
314 Ga0436361_1095379 3300039447 Bacteria 3333
315 Ga0466963_0101096 3300044694 Bacteria 1974
316 Ga0453684_0012589 3300044712 Bacteria 13917
317 Ga0453684_0025003 3300044712 Bacteria 8691
318 Ga0466957_0615952 3300044842 Bacteria 761
319 Ga0466958_0002853 3300045836 Bacteria 8797
320 Ga0466967_0242163 3300045976 Bacteria 1721
321 Ga0495603_0000627 3300046455 Bacteria 19818
322 Ga0495603_0225118 3300046455 Bacteria 1082
323 Ga0495603_0267224 3300046455 Bacteria 984
324 Ga0495629_0000108 3300046459 Bacteria 73826
325 Ga0495629_0333225 3300046459 Bacteria 1037
326 Ga0495641_0014389 3300046461 Bacteria 4284
327 Ga0495651_0219277 3300046462 Bacteria 1318
328 Ga0495653_0123340 3300046463 Bacteria 1843
329 Ga0495582_0002320 3300046473 Bacteria 10664
330 Ga0495639_0003785 3300046475 Bacteria 6497
331 Ga0495639_0047790 3300046475 Bacteria 1940
332 Ga0495664_0000913 3300046477 Bacteria 15191
333 Ga0495584_0054272 3300046491 Bacteria 2017
334 Ga0495585_0159802 3300046492 Bacteria 1170
335 Ga0495594_0000131 3300046499 Bacteria 35452
336 Ga0495608_0017576 3300046511 Bacteria 4946
337 Ga0495608_0071114 3300046511 Bacteria 2270
338 Ga0495648_0236852 3300046524 Bacteria 890
339 Ga0495642_0066362 3300046528 Bacteria 1504
340 Ga0495640_0120852 3300046533 Bacteria 1703
341 Ga0495640_0270618 3300046533 Bacteria 1060
342 Ga0495587_0039403 3300046536 Bacteria 2828
343 Ga0495645_0000977 3300046543 Bacteria 19476
344 Ga0495622_0002289 3300046557 Bacteria 9314
345 Ga0495667_0014051 3300046559 Bacteria 5404
346 Ga0495667_0035914 3300046559 Bacteria 3311
347 Ga0495667_0571471 3300046559 Bacteria 705
348 Ga0495634_0030817 3300046642 Bacteria 3699
349 Ga0495635_0152832 3300046663 Bacteria 1571
350 Ga0495588_0005127 3300046674 Bacteria 5819
351 Ga0495599_0067125 3300046678 Bacteria 2240
352 Ga0495623_0469846 3300046679 Bacteria 667
353 Ga0495647_0170884 3300046681 Bacteria 941
354 Ga0495658_0002461 3300046683 Bacteria 9324
355 Ga0495613_0003651 3300046689 Bacteria 11531
356 Ga0495581_0376990 3300047315 Bacteria 828
357 Ga0495604_0009634 3300047317 Bacteria 7638
358 Ga0495604_0404735 3300047317 Bacteria 898
359 Ga0495674_0012361 3300047319 Bacteria 8041
360 Ga0495680_0016038 3300047322 Bacteria 6445
361 Ga0495675_0003841 3300047444 Bacteria 9095
362 Ga0495684_0147893 3300047471 Bacteria 1758
363 Ga0495593_0001789 3300047673 Bacteria 12745
364 Ga0495602_0000695 3300048088 Bacteria 31609
365 Ga0495602_0029666 3300048088 Bacteria 5202
366 Ga0495602_0094354 3300048088 Bacteria 2473
367 Ga0495614_0004916 3300048089 Bacteria 6029
368 Ga0496100_0008410 3300048903 Bacteria 5755
369 Ga0496100_0062856 3300048903 Bacteria 2452
370 Ga0496100_0142028 3300048903 Bacteria 1703
371 Ga0496101_0018815 3300048904 Bacteria 4703
372 Ga0496101_0082327 3300048904 Bacteria 2382
373 Ga0496101_0084385 3300048904 Bacteria 2352
374 Ga0496102_0037946 3300048905 Bacteria 4346
375 Ga0496102_0104126 3300048905 Bacteria 2639
376 Ga0496102_0161872 3300048905 Bacteria 2105
377 Ga0496102_0244693 3300048905 Bacteria 1691
378 Ga0496102_0807625 3300048905 Bacteria 860
379 Ga0496103_0048133 3300048906 Bacteria 2634
380 Ga0496104_0015552 3300048907 Bacteria 6893
381 Ga0496104_0034302 3300048907 Bacteria 4731
382 Ga0496104_0057463 3300048907 Bacteria 3681
383 Ga0496104_0072172 3300048907 Bacteria 3282
384 Ga0496105_0004809 3300048908 Bacteria 10203
385 Ga0496105_0048412 3300048908 Bacteria 3508
386 Ga0496105_0204983 3300048908 Bacteria 1609
387 Ga0496105_0217912 3300048908 Bacteria 1554
388 Ga0496105_0229246 3300048908 Bacteria 1510
389 Ga0496106_0376429 3300048909 Bacteria 1141
390 Ga0496107_0028111 3300048910 Bacteria 3995
391 Ga0496107_0050277 3300048910 Bacteria 3005
392 Ga0496107_0748066 3300048910 Bacteria 717
393 Ga0496108_0166751 3300048911 Bacteria 1904
394 Ga0496109_0005664 3300048912 Bacteria 10451
395 Ga0496109_0009037 3300048912 Bacteria 8488
396 Ga0496109_0020042 3300048912 Bacteria 5906
397 Ga0496109_0636397 3300048912 Bacteria 1003
398 Ga0496110_0134197 3300048913 Unclassified 2236
399 Ga0496110_0520265 3300048913 Bacteria 1082
400 Ga0496111_0014406 3300048914 Bacteria 5400
401 Ga0496111_0081335 3300048914 Unclassified 2364
402 Ga0496111_0391215 3300048914 Bacteria 1028
403 Ga0496112_0008045 3300048915 Bacteria 9408
404 Ga0496112_0015126 3300048915 Bacteria 7189
405 Ga0496112_0021110 3300048915 Bacteria 6187
406 Ga0496112_0077952 3300048915 Bacteria 3277
407 Ga0496112_0141800 3300048915 Bacteria 2372
408 Ga0496112_0253125 3300048915 Bacteria 1712
409 Ga0496113_0011669 3300048916 Bacteria 5876
410 Ga0496113_0113918 3300048916 Bacteria 2108
411 Ga0496113_0658997 3300048916 Bacteria 837
412 Ga0496114_0051367 3300048917 Bacteria 3432
413 Ga0496114_0644286 3300048917 Bacteria 932
414 Ga0496115_0069189 3300048918 Bacteria 2859
415 Ga0496115_0081268 3300048918 Bacteria 2639
416 Ga0496115_0091910 3300048918 Bacteria 2480
417 Ga0496117_0150319 3300048920 Bacteria 1379
418 Ga0496118_0022713 3300048921 Bacteria 5472
419 Ga0496119_0047664 3300048922 Bacteria 2664
420 Ga0496121_0006918 3300048924 Bacteria 13826
421 Ga0501031_0036204 3300049568 Bacteria 3220
422 Ga0501031_0063709 3300049568 Bacteria 2401
423 Ga0501031_0147723 3300049568 Bacteria 1536
424 Ga0501031_0160858 3300049568 Bacteria 1468
425 Ga0501032_0047964 3300049569 Bacteria 2884
426 Ga0501034_0356217 3300049571 Bacteria 1391
427 Ga0501036_0017879 3300049572 Bacteria 5935
428 Ga0501036_0058717 3300049572 Bacteria 3259
429 Ga0501036_0059150 3300049572 Bacteria 3247
430 Ga0501037_0096695 3300049573 Bacteria 2134
431 Ga0501038_0160916 3300049574 Bacteria 1824
432 Ga0501038_0239571 3300049574 Bacteria 1441
433 Ga0501039_0070544 3300049575 Bacteria 2714
434 Ga0501039_0253092 3300049575 Bacteria 1385
435 Ga0501040_0023993 3300049576 Bacteria 4092
436 Ga0501040_0026777 3300049576 Bacteria 3878
437 Ga0501041_0103965 3300049577 Bacteria 1759
438 Ga0501041_0262667 3300049577 Bacteria 1086
439 Ga0501042_0013323 3300049578 Bacteria 5593
440 Ga0501042_0067484 3300049578 Bacteria 2557
441 Ga0501042_0226804 3300049578 Bacteria 1347
442 Ga0501043_0035736 3300049579 Bacteria 3909
443 Ga0501046_0012918 3300049580 Bacteria 7099
444 Ga0501046_0025395 3300049580 Bacteria 4849
445 Ga0501046_0109221 3300049580 Bacteria 2115
446 Ga0501046_0162944 3300049580 Bacteria 1676
447 Ga0501047_0006069 3300049581 Bacteria 11358
448 Ga0501048_0015303 3300049582 Bacteria 5665
449 Ga0501048_0097007 3300049582 Bacteria 2079
450 Ga0501067_0145237 3300049583 Bacteria 1322
451 Ga0501068_0345474 3300049584 Bacteria 956
452 Ga0501068_0496248 3300049584 Bacteria 792
453 Ga0501070_0006872 3300049586 Bacteria 9679
454 Ga0501071_0019202 3300049587 Bacteria 4742
455 Ga0501071_0260680 3300049587 Bacteria 1309
456 Ga0501071_0488692 3300049587 Bacteria 944
457 Ga0501072_0002082 3300049588 Bacteria 14892
458 Ga0501072_0011838 3300049588 Bacteria 6665
459 Ga0501072_0034108 3300049588 Bacteria 3988
460 Ga0501073_0148812 3300049589 Bacteria 1623
461 Ga0501073_0486557 3300049589 Bacteria 853
462 Ga0501074_0052687 3300049590 Bacteria 2936
463 Ga0501074_0113001 3300049590 Bacteria 1943
464 Ga0501075_0020334 3300049591 Bacteria 4827
465 Ga0501075_0032984 3300049591 Bacteria 3851
466 Ga0501075_0323662 3300049591 Bacteria 1175
467 Ga0501076_0004312 3300049592 Bacteria 10092
468 Ga0501076_0011455 3300049592 Bacteria 6607
469 Ga0501076_0196708 3300049592 Bacteria 1646
470 Ga0501076_0216961 3300049592 Bacteria 1564
471 Ga0501076_0254114 3300049592 Bacteria 1438
472 Ga0501076_0277445 3300049592 Bacteria 1373
473 Ga0501077_0070587 3300049593 Bacteria 2213
474 Ga0501079_0076427 3300049741 Bacteria 2590
475 Ga0501079_0086865 3300049741 Bacteria 2421
476 Ga0501079_0097883 3300049741 Bacteria 2274
477 Ga0501079_0224622 3300049741 Bacteria 1467
478 Ga0501079_0237349 3300049741 Bacteria 1424
479 Ga0501080_0005832 3300049742 Bacteria 11021
480 Ga0501080_0073886 3300049742 Bacteria 3172
481 Ga0501080_0118384 3300049742 Bacteria 2456
482 Ga0501080_0398776 3300049742 Bacteria 1238
483 Ga0501081_0028321 3300049743 Bacteria 3780
484 Ga0501081_0060831 3300049743 Bacteria 2617
485 Ga0501081_0118134 3300049743 Bacteria 1886
486 Ga0501083_0158520 3300049744 Bacteria 1481
487 Ga0501035_0067440 3300049822 Bacteria 3175
488 Ga0501035_0141581 3300049822 Bacteria 2091
489 Ga0501035_0446177 3300049822 Bacteria 1071
490 Ga0501044_0063738 3300049823 Bacteria 3764
491 Ga0501045_0026020 3300049824 Bacteria 4207
492 Ga0501045_0058467 3300049824 Bacteria 2823
493 Ga0501045_0685090 3300049824 Bacteria 757
494 nmdc:mga05p37_254974_c1 3300050507 Unclassified 2103
495 nmdc:mga06r32_24408_c1 3300050510 Bacteria 5612
496 nmdc:mga08y16_234504_c1 3300050511 Unclassified 1898
497 nmdc:mga08y16_539_c1 3300050511 Bacteria 35073
498 nmdc:mga0n895_217567_c1 3300050512 Unclassified 1940
499 nmdc:mga0n895_64149_c1 3300050512 Bacteria 3633
500 nmdc:mga0rr50_3609_c1 3300050513 Bacteria 8944
501 nmdc:mga0a205_160923_c1 3300050515 Bacteria 2141
502 nmdc:mga0a205_97692_c1 3300050515 Unclassified 2836
503 Ga0495601_0001469 3300053077 Bacteria 12990
504 Ga0495601_0150469 3300053077 Bacteria 1519
505 Ga0495612_0004354 3300053078 Bacteria 5875
506 Ga0495612_0018522 3300053078 Bacteria 2788
507 Ga0500635_0055802 3300053080 Bacteria 1365
508 Ga0495655_0000735 3300053083 Bacteria 5219
509 Ga0495595_0080905 3300053084 Bacteria 1547
510 Ga0495619_0018831 3300053085 Bacteria 4383
511 Ga0495619_0032408 3300053085 Bacteria 3391
512 Ga0500578_0136865 3300053086 Bacteria 1533
513 Ga0500651_0003810 3300053093 Bacteria 8328
514 Ga0500566_0000085 3300053094 Bacteria 46377
515 Ga0500640_000865 3300053095 Bacteria 8390
516 Ga0500641_0202181 3300053096 Bacteria 848
517 Ga0500572_001257 3300053111 Bacteria 7146
518 Ga0500591_036603 3300053115 Bacteria 2354
519 Ga0500568_0109114 3300053139 Bacteria 1035
520 Ga0500603_002747 3300053150 Bacteria 3823
521 Ga0500630_000339 3300053159 Bacteria 19545
522 Ga0500638_012729 3300053162 Bacteria 3779
523 Ga0500639_000004 3300053163 Bacteria 216921
524 Ga0500636_0035109 3300053177 Bacteria 2968
525 Ga0500637_0059036 3300053178 Bacteria 2195
526 Ga0500596_000828 3300053735 Bacteria 6131
527 Ga0500601_004843 3300053737 Bacteria 1473
528 Ga0501084_0008187 3300054114 Bacteria 8622
529 Ga0501084_0012678 3300054114 Bacteria 6985
530 Ga0501084_0241590 3300054114 Bacteria 1524
531 Ga0501084_0448594 3300054114 Bacteria 1091
532 Ga0501084_0700383 3300054114 Bacteria 854
533 Ga0501082_0007239 3300060353 Bacteria 9569
534 Ga0501082_0142108 3300060353 Bacteria 2083
535 Ga0501082_0188886 3300060353 Bacteria 1792
536 Ga0501082_0457848 3300060353 Bacteria 1115
537 Ga0530510_0062320 3300061734 Bacteria 2700
538 Ga0530510_0074535 3300061734 Bacteria 2464
539 Ga0530510_0666168 3300061734 Bacteria 792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0353415 Ga0373947_0353415_88_639 165
2 3300048903 Ga0496100_0062856 Ga0496100_0062856_45_596 165
3 3300048905 Ga0496102_0161872 Ga0496102_0161872_659_1210 165
4 3300048907 Ga0496104_0015552 Ga0496104_0015552_3505_4056 165
5 3300048908 Ga0496105_0004809 Ga0496105_0004809_3271_3822 165
6 3300048914 Ga0496111_0014406 Ga0496111_0014406_4538_5089 165
7 3300048915 Ga0496112_0008045 Ga0496112_0008045_8765_9316 165
8 3300048918 Ga0496115_0091910 Ga0496115_0091910_1034_1585 165
9 3300046524 Ga0495648_0236852 Ga0495648_0236852_188_754 173
10 3300026041 Ga0207639_10717766 Ga0207639_107177662 176
11 3300037853 Ga0436364_1090756 Ga0436364_1090756_141_725 179
12 3300053150 Ga0500603_002747 Ga0500603_002747_81_665 179
13 3300009545 Ga0105237_10279611 Ga0105237_102796112 182
14 iso_pu_bacteria 2522572158 2523102701 183
15 3300054114 Ga0501084_0700383 Ga0501084_0700383_40_642 185
16 3300046679 Ga0495623_0469846 Ga0495623_0469846_15_647 189
17 3300009094 Ga0111539_10001601 Ga0111539_100016018 194
18 3300027907 Ga0207428_10004621 Ga0207428_100046218 194
19 3300044712 Ga0453684_0012589 Ga0453684_0012589_11460_12089 194
20 3300046462 Ga0495651_0219277 Ga0495651_0219277_44_718 194
21 3300046533 Ga0495640_0120852 Ga0495640_0120852_268_909 194
22 3300046559 Ga0495667_0571471 Ga0495667_0571471_40_690 194
23 3300050511 nmdc:mga08y16_539_c1 nmdc:mga08y16_539_c1_7190_7819 194
24 iso_pu_bacteria 2874604998 2874609460 194
25 iso_pu_bacteria 8006994254 8006996342 194
26 3300021361 Ga0213872_10017327 Ga0213872_100173272 195
27 3300038735 Ga0400485_03784 Ga0400485_03784_646_1278 195
28 3300039447 Ga0436361_1095379 Ga0436361_1095379_245_880 195
29 3300005458 Ga0070681_10146084 Ga0070681_101460843 196
30 3300005614 Ga0068856_100375434 Ga0068856_1003754342 196
31 3300025912 Ga0207707_10124175 Ga0207707_101241753 196
32 3300025924 Ga0207694_10253781 Ga0207694_102537812 196
33 3300031711 Ga0265314_10336768 Ga0265314_103367682 196
34 3300035113 Ga0373936_0055609 Ga0373936_0055609_584_1267 196
35 3300039062 Ga0400483_100782 Ga0400483_100782_1550_2191 196
36 3300039062 Ga0400483_181595 Ga0400483_181595_11243_11908 196
37 3300044712 Ga0453684_0025003 Ga0453684_0025003_77_715 196
38 3300044842 Ga0466957_0615952 Ga0466957_0615952_15_653 196
39 3300045836 Ga0466958_0002853 Ga0466958_0002853_7362_8000 196
40 3300045976 Ga0466967_0242163 Ga0466967_0242163_492_1151 196
41 3300048920 Ga0496117_0150319 Ga0496117_0150319_128_820 196
42 3300048921 Ga0496118_0022713 Ga0496118_0022713_4147_4839 196
43 3300048922 Ga0496119_0047664 Ga0496119_0047664_1865_2557 196
44 3300048924 Ga0496121_0006918 Ga0496121_0006918_6976_7668 196
45 3300049580 Ga0501046_0012918 Ga0501046_0012918_2237_2926 196
46 3300049581 Ga0501047_0006069 Ga0501047_0006069_7867_8556 196
47 3300049586 Ga0501070_0006872 Ga0501070_0006872_5825_6514 196
48 3300049590 Ga0501074_0052687 Ga0501074_0052687_27_716 196
49 3300049741 Ga0501079_0237349 Ga0501079_0237349_81_770 196
50 3300049742 Ga0501080_0005832 Ga0501080_0005832_6138_6827 196
51 3300049823 Ga0501044_0063738 Ga0501044_0063738_61_750 196
52 3300053080 Ga0500635_0055802 Ga0500635_0055802_578_1261 196
53 3300053086 Ga0500578_0136865 Ga0500578_0136865_264_956 196
54 3300053093 Ga0500651_0003810 Ga0500651_0003810_7003_7695 196
55 3300053094 Ga0500566_0000085 Ga0500566_0000085_22491_23174 196
56 3300053095 Ga0500640_000865 Ga0500640_000865_6312_6995 196
57 3300053096 Ga0500641_0202181 Ga0500641_0202181_132_824 196
58 3300053111 Ga0500572_001257 Ga0500572_001257_3042_3725 196
59 3300053115 Ga0500591_036603 Ga0500591_036603_467_1150 196
60 3300053139 Ga0500568_0109114 Ga0500568_0109114_319_1011 196
61 3300053159 Ga0500630_000339 Ga0500630_000339_3046_3729 196
62 3300053162 Ga0500638_012729 Ga0500638_012729_2383_3066 196
63 3300053163 Ga0500639_000004 Ga0500639_000004_174319_175002 196
64 3300053177 Ga0500636_0035109 Ga0500636_0035109_979_1671 196
65 3300053178 Ga0500637_0059036 Ga0500637_0059036_1402_2085 196
66 3300053735 Ga0500596_000828 Ga0500596_000828_1275_1958 196
67 3300053737 Ga0500601_004843 Ga0500601_004843_171_854 196
68 3300037466 Ga0395898_0033548 Ga0395898_0033548_3493_4149 197
69 3300039062 Ga0400483_064186 Ga0400483_064186_17097_17765 197
70 3300039062 Ga0400483_201439 Ga0400483_201439_3963_4631 197
71 3300044694 Ga0466963_0101096 Ga0466963_0101096_884_1579 197
72 3300047317 Ga0495604_0404735 Ga0495604_0404735_57_704 197
73 3300048088 Ga0495602_0094354 Ga0495602_0094354_1650_2297 197
74 3300053077 Ga0495601_0150469 Ga0495601_0150469_664_1311 197
75 3300053078 Ga0495612_0018522 Ga0495612_0018522_1924_2571 197
76 3300053084 Ga0495595_0080905 Ga0495595_0080905_693_1340 197
77 3300053085 Ga0495619_0018831 Ga0495619_0018831_805_1452 197
78 3300003215 JGI25153J46596_10037647 JGI25153J46596_100376472 198
79 3300005457 Ga0070662_100302037 Ga0070662_1003020373 198
80 3300025913 Ga0207695_10537749 Ga0207695_105377492 198
81 3300035725 Ga0373947_0190308 Ga0373947_0190308_214_867 198
82 3300038742 Ga0400486_26293 Ga0400486_26293_376_1029 198
83 3300039062 Ga0400483_211969 Ga0400483_211969_772_1443 198
84 3300039447 Ga0436361_0670010 Ga0436361_0670010_32997_33641 198
85 3300049574 Ga0501038_0239571 Ga0501038_0239571_34_699 198
86 3300049575 Ga0501039_0253092 Ga0501039_0253092_623_1288 198
87 3300049591 Ga0501075_0323662 Ga0501075_0323662_283_948 198
88 3300049592 Ga0501076_0196708 Ga0501076_0196708_350_1015 198
89 3300005338 Ga0068868_100286232 Ga0068868_1002862322 199
90 3300005471 Ga0070698_100076013 Ga0070698_1000760132 199
91 3300006028 Ga0070717_10027719 Ga0070717_100277195 199
92 3300011119 Ga0105246_10283735 Ga0105246_102837352 199
93 3300014497 Ga0182008_10036900 Ga0182008_100369004 199
94 3300025928 Ga0207700_10112785 Ga0207700_101127853 199
95 3300036401 Ga0373937_0327040 Ga0373937_0327040_273_962 199
96 3300048904 Ga0496101_0082327 Ga0496101_0082327_1607_2281 199
97 3300048915 Ga0496112_0253125 Ga0496112_0253125_85_738 199
98 3300001977 JGI24746J21847_1008036 JGI24746J21847_10080362 200
99 3300001989 JGI24739J22299_10033922 JGI24739J22299_100339221 200
100 3300001990 JGI24737J22298_10028612 JGI24737J22298_100286122 200
101 3300002070 JGI24750J21931_1000903 JGI24750J21931_10009036 200
102 3300002075 JGI24738J21930_10008109 JGI24738J21930_100081093 200
103 3300005327 Ga0070658_10031372 Ga0070658_100313722 200
104 3300005328 Ga0070676_10007925 Ga0070676_100079254 200
105 3300005330 Ga0070690_100000780 Ga0070690_1000007806 200
106 3300005331 Ga0070670_100001837 Ga0070670_1000018375 200
107 3300005333 Ga0070677_10039552 Ga0070677_100395522 200
108 3300005334 Ga0068869_100004906 Ga0068869_1000049069 200
109 3300005335 Ga0070666_10002181 Ga0070666_100021813 200
110 3300005336 Ga0070680_100052784 Ga0070680_1000527842 200
111 3300005337 Ga0070682_100000868 Ga0070682_10000086813 200
112 3300005338 Ga0068868_100002238 Ga0068868_1000022388 200
113 3300005339 Ga0070660_100000822 Ga0070660_1000008228 200
114 3300005340 Ga0070689_100001665 Ga0070689_1000016653 200
115 3300005341 Ga0070691_10001014 Ga0070691_100010145 200
116 3300005343 Ga0070687_100014448 Ga0070687_1000144482 200
117 3300005344 Ga0070661_100000197 Ga0070661_10000019712 200
118 3300005345 Ga0070692_10029717 Ga0070692_100297175 200
119 3300005347 Ga0070668_100000339 Ga0070668_10000033923 200
120 3300005353 Ga0070669_100000542 Ga0070669_10000054225 200
121 3300005354 Ga0070675_100005758 Ga0070675_10000575810 200
122 3300005355 Ga0070671_100003157 Ga0070671_1000031578 200
123 3300005356 Ga0070674_100011081 Ga0070674_1000110813 200
124 3300005364 Ga0070673_100000612 Ga0070673_10000061218 200
125 3300005365 Ga0070688_100000119 Ga0070688_10000011943 200
126 3300005366 Ga0070659_100002119 Ga0070659_1000021194 200
127 3300005367 Ga0070667_100060908 Ga0070667_1000609082 200
128 3300005367 Ga0070667_100098848 Ga0070667_1000988482 200
129 3300005434 Ga0070709_10000481 Ga0070709_100004815 200
130 3300005435 Ga0070714_100002193 Ga0070714_10000219310 200
131 3300005436 Ga0070713_100009063 Ga0070713_1000090636 200
132 3300005437 Ga0070710_10001367 Ga0070710_1000136714 200
133 3300005438 Ga0070701_10000488 Ga0070701_100004884 200
134 3300005439 Ga0070711_100000677 Ga0070711_1000006773 200
135 3300005439 Ga0070711_100234492 Ga0070711_1002344922 200
136 3300005440 Ga0070705_100000494 Ga0070705_10000049414 200
137 3300005441 Ga0070700_100003352 Ga0070700_1000033527 200
138 3300005444 Ga0070694_100021641 Ga0070694_1000216412 200
139 3300005455 Ga0070663_100000855 Ga0070663_1000008557 200
140 3300005456 Ga0070678_100000183 Ga0070678_10000018324 200
141 3300005457 Ga0070662_100066073 Ga0070662_1000660733 200
142 3300005459 Ga0068867_100014445 Ga0068867_1000144456 200
143 3300005518 Ga0070699_100117932 Ga0070699_1001179322 200
144 3300005530 Ga0070679_100038121 Ga0070679_1000381212 200
145 3300005535 Ga0070684_100046137 Ga0070684_1000461373 200
146 3300005536 Ga0070697_100002769 Ga0070697_10000276913 200
147 3300005539 Ga0068853_100000537 Ga0068853_10000053718 200
148 3300005543 Ga0070672_100085295 Ga0070672_1000852952 200
149 3300005544 Ga0070686_100428489 Ga0070686_1004284892 200
150 3300005545 Ga0070695_100007432 Ga0070695_1000074327 200
151 3300005545 Ga0070695_100013353 Ga0070695_1000133536 200
152 3300005546 Ga0070696_100001626 Ga0070696_1000016266 200
153 3300005547 Ga0070693_100000106 Ga0070693_10000010639 200
154 3300005548 Ga0070665_100105925 Ga0070665_1001059253 200
155 3300005549 Ga0070704_100001004 Ga0070704_10000100412 200
156 3300005549 Ga0070704_100234108 Ga0070704_1002341082 200
157 3300005563 Ga0068855_100012257 Ga0068855_1000122579 200
158 3300005564 Ga0070664_100000182 Ga0070664_10000018242 200
159 3300005577 Ga0068857_100000505 Ga0068857_1000005055 200
160 3300005578 Ga0068854_100022193 Ga0068854_1000221935 200
161 3300005614 Ga0068856_100020684 Ga0068856_1000206845 200
162 3300005615 Ga0070702_100000684 Ga0070702_10000068412 200
163 3300005615 Ga0070702_100037692 Ga0070702_1000376922 200
164 3300005616 Ga0068852_100002310 Ga0068852_1000023105 200
165 3300005616 Ga0068852_100803384 Ga0068852_1008033841 200
166 3300005617 Ga0068859_100005071 Ga0068859_1000050715 200
167 3300005618 Ga0068864_100150302 Ga0068864_1001503023 200
168 3300005718 Ga0068866_10003533 Ga0068866_100035334 200
169 3300005719 Ga0068861_100000179 Ga0068861_10000017929 200
170 3300005834 Ga0068851_10010050 Ga0068851_100100502 200
171 3300005841 Ga0068863_100014960 Ga0068863_1000149603 200
172 3300005842 Ga0068858_100005862 Ga0068858_1000058625 200
173 3300005842 Ga0068858_100032058 Ga0068858_1000320585 200
174 3300005843 Ga0068860_100001853 Ga0068860_10000185318 200
175 3300005844 Ga0068862_100001564 Ga0068862_10000156411 200
176 3300005844 Ga0068862_100210439 Ga0068862_1002104393 200
177 3300006163 Ga0070715_10000596 Ga0070715_100005962 200
178 3300006173 Ga0070716_100000486 Ga0070716_1000004866 200
179 3300006175 Ga0070712_100007148 Ga0070712_1000071486 200
180 3300006175 Ga0070712_100381355 Ga0070712_1003813551 200
181 3300006358 Ga0068871_100051199 Ga0068871_1000511993 200
182 3300006847 Ga0075431_100423907 Ga0075431_1004239072 200
183 3300006852 Ga0075433_10370255 Ga0075433_103702552 200
184 3300006871 Ga0075434_100052916 Ga0075434_1000529166 200
185 3300006880 Ga0075429_100012905 Ga0075429_1000129057 200
186 3300006881 Ga0068865_100001379 Ga0068865_10000137914 200
187 3300006881 Ga0068865_100220136 Ga0068865_1002201363 200
188 3300006931 Ga0097620_100005071 Ga0097620_1000050715 200
189 3300009036 Ga0105244_10092703 Ga0105244_100927032 200
190 3300009092 Ga0105250_10011711 Ga0105250_100117113 200
191 3300009098 Ga0105245_10024137 Ga0105245_100241373 200
192 3300009101 Ga0105247_10001527 Ga0105247_1000152710 200
193 3300009101 Ga0105247_10003457 Ga0105247_100034572 200
194 3300009101 Ga0105247_10021733 Ga0105247_100217336 200
195 3300009147 Ga0114129_10453078 Ga0114129_104530782 200
196 3300009148 Ga0105243_10002927 Ga0105243_100029274 200
197 3300009148 Ga0105243_10535022 Ga0105243_105350221 200
198 3300009174 Ga0105241_10000695 Ga0105241_1000069518 200
199 3300009174 Ga0105241_10288873 Ga0105241_102888732 200
200 3300009176 Ga0105242_10004028 Ga0105242_100040282 200
201 3300009176 Ga0105242_10630185 Ga0105242_106301852 200
202 3300009177 Ga0105248_10001513 Ga0105248_1000151313 200
203 3300009177 Ga0105248_10010219 Ga0105248_100102199 200
204 3300009545 Ga0105237_10003743 Ga0105237_100037433 200
205 3300009545 Ga0105237_10572911 Ga0105237_105729112 200
206 3300009551 Ga0105238_10123312 Ga0105238_101233122 200
207 3300009551 Ga0105238_10351032 Ga0105238_103510322 200
208 3300009553 Ga0105249_10001563 Ga0105249_1000156312 200
209 3300010375 Ga0105239_10008110 Ga0105239_100081108 200
210 3300011119 Ga0105246_10000499 Ga0105246_1000049915 200
211 3300013100 Ga0157373_10004826 Ga0157373_100048267 200
212 3300013102 Ga0157371_10002971 Ga0157371_1000297116 200
213 3300013104 Ga0157370_10040198 Ga0157370_100401984 200
214 3300013105 Ga0157369_10007447 Ga0157369_100074473 200
215 3300013296 Ga0157374_10015936 Ga0157374_100159365 200
216 3300013297 Ga0157378_10000352 Ga0157378_1000035212 200
217 3300013306 Ga0163162_10021080 Ga0163162_100210804 200
218 3300013307 Ga0157372_10004794 Ga0157372_1000479415 200
219 3300013308 Ga0157375_10024932 Ga0157375_100249324 200
220 3300014325 Ga0163163_10004442 Ga0163163_100044429 200
221 3300014325 Ga0163163_10028487 Ga0163163_100284872 200
222 3300014497 Ga0182008_10093911 Ga0182008_100939111 200
223 3300014745 Ga0157377_10003807 Ga0157377_100038076 200
224 3300014968 Ga0157379_10000158 Ga0157379_1000015812 200
225 3300014968 Ga0157379_10017064 Ga0157379_100170645 200
226 3300014968 Ga0157379_10063495 Ga0157379_100634955 200
227 3300014969 Ga0157376_10000303 Ga0157376_1000030327 200
228 3300017792 Ga0163161_10006616 Ga0163161_100066164 200
229 3300017792 Ga0163161_10206328 Ga0163161_102063283 200
230 3300025321 Ga0207656_10042694 Ga0207656_100426943 200
231 3300025885 Ga0207653_10104538 Ga0207653_101045382 200
232 3300025893 Ga0207682_10069868 Ga0207682_100698681 200
233 3300025898 Ga0207692_10002053 Ga0207692_100020531 200
234 3300025900 Ga0207710_10004383 Ga0207710_100043835 200
235 3300025900 Ga0207710_10056684 Ga0207710_100566842 200
236 3300025901 Ga0207688_10000241 Ga0207688_100002415 200
237 3300025903 Ga0207680_10049756 Ga0207680_100497563 200
238 3300025904 Ga0207647_10001633 Ga0207647_100016335 200
239 3300025905 Ga0207685_10000595 Ga0207685_100005956 200
240 3300025907 Ga0207645_10028041 Ga0207645_100280415 200
241 3300025909 Ga0207705_10031736 Ga0207705_100317366 200
242 3300025915 Ga0207693_10000238 Ga0207693_1000023813 200
243 3300025915 Ga0207693_10433087 Ga0207693_104330871 200
244 3300025918 Ga0207662_10002553 Ga0207662_100025539 200
245 3300025919 Ga0207657_10000279 Ga0207657_1000027919 200
246 3300025920 Ga0207649_10005852 Ga0207649_100058522 200
247 3300025923 Ga0207681_10025475 Ga0207681_100254755 200
248 3300025924 Ga0207694_10198113 Ga0207694_101981132 200
249 3300025925 Ga0207650_10021771 Ga0207650_100217714 200
250 3300025926 Ga0207659_10059941 Ga0207659_100599412 200
251 3300025927 Ga0207687_10013340 Ga0207687_100133403 200
252 3300025929 Ga0207664_10015131 Ga0207664_100151317 200
253 3300025931 Ga0207644_10017693 Ga0207644_100176935 200
254 3300025932 Ga0207690_10001432 Ga0207690_100014325 200
255 3300025933 Ga0207706_10000298 Ga0207706_1000029818 200
256 3300025933 Ga0207706_10399361 Ga0207706_103993612 200
257 3300025934 Ga0207686_10075307 Ga0207686_100753072 200
258 3300025935 Ga0207709_10001191 Ga0207709_1000119115 200
259 3300025937 Ga0207669_10179712 Ga0207669_101797123 200
260 3300025937 Ga0207669_10261141 Ga0207669_102611412 200
261 3300025938 Ga0207704_10013740 Ga0207704_100137405 200
262 3300025938 Ga0207704_10122340 Ga0207704_101223403 200
263 3300025939 Ga0207665_10000284 Ga0207665_1000028415 200
264 3300025940 Ga0207691_10085392 Ga0207691_100853923 200
265 3300025941 Ga0207711_10026025 Ga0207711_100260257 200
266 3300025941 Ga0207711_10063391 Ga0207711_100633913 200
267 3300025942 Ga0207689_10006893 Ga0207689_1000689311 200
268 3300025944 Ga0207661_10265804 Ga0207661_102658042 200
269 3300025945 Ga0207679_10003035 Ga0207679_100030355 200
270 3300025960 Ga0207651_10016117 Ga0207651_100161171 200
271 3300025961 Ga0207712_10001524 Ga0207712_1000152412 200
272 3300025981 Ga0207640_10003161 Ga0207640_100031613 200
273 3300025986 Ga0207658_10035985 Ga0207658_100359853 200
274 3300025986 Ga0207658_10038862 Ga0207658_100388622 200
275 3300025986 Ga0207658_10192485 Ga0207658_101924852 200
276 3300026023 Ga0207677_10007579 Ga0207677_100075795 200
277 3300026035 Ga0207703_10002953 Ga0207703_100029536 200
278 3300026035 Ga0207703_10242917 Ga0207703_102429172 200
279 3300026035 Ga0207703_10541309 Ga0207703_105413092 200
280 3300026041 Ga0207639_10002918 Ga0207639_100029185 200
281 3300026067 Ga0207678_10000147 Ga0207678_1000014718 200
282 3300026075 Ga0207708_10014662 Ga0207708_100146626 200
283 3300026078 Ga0207702_10021467 Ga0207702_100214673 200
284 3300026088 Ga0207641_10002538 Ga0207641_1000253818 200
285 3300026089 Ga0207648_10007041 Ga0207648_100070419 200
286 3300026116 Ga0207674_10008721 Ga0207674_1000872112 200
287 3300026118 Ga0207675_100000256 Ga0207675_10000025615 200
288 3300026118 Ga0207675_100577396 Ga0207675_1005773961 200
289 3300026121 Ga0207683_10001913 Ga0207683_1000191318 200
290 3300026121 Ga0207683_10539369 Ga0207683_105393692 200
291 3300026142 Ga0207698_10389714 Ga0207698_103897143 200
292 3300028380 Ga0268265_10023565 Ga0268265_100235652 200
293 3300035111 Ga0373923_0028703 Ga0373923_0028703_71_730 200
294 3300035241 Ga0373961_0026324 Ga0373961_0026324_461_1141 200
295 3300035691 Ga0373931_0006372 Ga0373931_0006372_1918_2598 200
296 3300035724 Ga0373933_0555575 Ga0373933_0555575_60_719 200
297 3300037068 Ga0373925_0054716 Ga0373925_0054716_839_1498 200
298 3300037418 Ga0395900_0017819 Ga0395900_0017819_2806_3486 200
299 3300037466 Ga0395898_0031751 Ga0395898_0031751_36_716 200
300 3300037471 Ga0395905_0006470 Ga0395905_0006470_9327_10007 200
301 3300037471 Ga0395905_0096605 Ga0395905_0096605_1574_2239 200
302 3300038443 Ga0395901_0002999 Ga0395901_0002999_4453_5133 200
303 3300038443 Ga0395901_0895899 Ga0395901_0895899_22_687 200
304 3300039447 Ga0436361_0195517 Ga0436361_0195517_687_1358 200
305 3300046459 Ga0495629_0333225 Ga0495629_0333225_130_789 200
306 3300046475 Ga0495639_0047790 Ga0495639_0047790_256_933 200
307 3300046491 Ga0495584_0054272 Ga0495584_0054272_208_873 200
308 3300046492 Ga0495585_0159802 Ga0495585_0159802_70_735 200
309 3300046528 Ga0495642_0066362 Ga0495642_0066362_248_913 200
310 3300047315 Ga0495581_0376990 Ga0495581_0376990_152_811 200
311 3300048903 Ga0496100_0008410 Ga0496100_0008410_3417_4097 200
312 3300048904 Ga0496101_0018815 Ga0496101_0018815_1481_2161 200
313 3300048905 Ga0496102_0037946 Ga0496102_0037946_1508_2173 200
314 3300048905 Ga0496102_0104126 Ga0496102_0104126_26_706 200
315 3300048905 Ga0496102_0244693 Ga0496102_0244693_70_735 200
316 3300048906 Ga0496103_0048133 Ga0496103_0048133_1797_2462 200
317 3300048907 Ga0496104_0072172 Ga0496104_0072172_2577_3257 200
318 3300048908 Ga0496105_0048412 Ga0496105_0048412_1298_1978 200
319 3300048908 Ga0496105_0204983 Ga0496105_0204983_721_1386 200
320 3300048911 Ga0496108_0166751 Ga0496108_0166751_1042_1719 200
321 3300048912 Ga0496109_0005664 Ga0496109_0005664_7710_8390 200
322 3300048912 Ga0496109_0009037 Ga0496109_0009037_80_757 200
323 3300048912 Ga0496109_0020042 Ga0496109_0020042_3094_3759 200
324 3300048913 Ga0496110_0134197 Ga0496110_0134197_26_706 200
325 3300048913 Ga0496110_0520265 Ga0496110_0520265_86_751 200
326 3300048914 Ga0496111_0081335 Ga0496111_0081335_26_706 200
327 3300048914 Ga0496111_0391215 Ga0496111_0391215_52_717 200
328 3300048915 Ga0496112_0015126 Ga0496112_0015126_3741_4406 200
329 3300048915 Ga0496112_0077952 Ga0496112_0077952_2264_2926 200
330 3300048916 Ga0496113_0011669 Ga0496113_0011669_2498_3175 200
331 3300048916 Ga0496113_0113918 Ga0496113_0113918_300_965 200
332 3300048917 Ga0496114_0051367 Ga0496114_0051367_2661_3326 200
333 3300048918 Ga0496115_0081268 Ga0496115_0081268_26_706 200
334 3300049568 Ga0501031_0063709 Ga0501031_0063709_205_870 200
335 3300049568 Ga0501031_0147723 Ga0501031_0147723_464_1129 200
336 3300049568 Ga0501031_0160858 Ga0501031_0160858_322_987 200
337 3300049572 Ga0501036_0017879 Ga0501036_0017879_327_992 200
338 3300049572 Ga0501036_0058717 Ga0501036_0058717_77_742 200
339 3300049575 Ga0501039_0070544 Ga0501039_0070544_860_1525 200
340 3300049576 Ga0501040_0023993 Ga0501040_0023993_700_1365 200
341 3300049578 Ga0501042_0067484 Ga0501042_0067484_385_1050 200
342 3300049578 Ga0501042_0226804 Ga0501042_0226804_439_1104 200
343 3300049580 Ga0501046_0025395 Ga0501046_0025395_1760_2425 200
344 3300049580 Ga0501046_0109221 Ga0501046_0109221_1205_1870 200
345 3300049582 Ga0501048_0015303 Ga0501048_0015303_2161_2826 200
346 3300049583 Ga0501067_0145237 Ga0501067_0145237_612_1277 200
347 3300049584 Ga0501068_0345474 Ga0501068_0345474_56_721 200
348 3300049587 Ga0501071_0260680 Ga0501071_0260680_392_1057 200
349 3300049587 Ga0501071_0488692 Ga0501071_0488692_134_799 200
350 3300049588 Ga0501072_0011838 Ga0501072_0011838_507_1172 200
351 3300049588 Ga0501072_0034108 Ga0501072_0034108_2008_2673 200
352 3300049589 Ga0501073_0148812 Ga0501073_0148812_516_1181 200
353 3300049590 Ga0501074_0113001 Ga0501074_0113001_1038_1703 200
354 3300049591 Ga0501075_0020334 Ga0501075_0020334_682_1347 200
355 3300049592 Ga0501076_0004312 Ga0501076_0004312_6673_7338 200
356 3300049592 Ga0501076_0216961 Ga0501076_0216961_606_1271 200
357 3300049592 Ga0501076_0254114 Ga0501076_0254114_241_906 200
358 3300049592 Ga0501076_0277445 Ga0501076_0277445_297_962 200
359 3300049741 Ga0501079_0086865 Ga0501079_0086865_958_1623 200
360 3300049741 Ga0501079_0097883 Ga0501079_0097883_974_1639 200
361 3300049741 Ga0501079_0224622 Ga0501079_0224622_308_973 200
362 3300049742 Ga0501080_0073886 Ga0501080_0073886_234_899 200
363 3300049742 Ga0501080_0398776 Ga0501080_0398776_283_948 200
364 3300049743 Ga0501081_0028321 Ga0501081_0028321_1548_2213 200
365 3300049743 Ga0501081_0118134 Ga0501081_0118134_385_1050 200
366 3300049822 Ga0501035_0067440 Ga0501035_0067440_525_1190 200
367 3300049822 Ga0501035_0446177 Ga0501035_0446177_169_834 200
368 3300049824 Ga0501045_0026020 Ga0501045_0026020_1491_2156 200
369 3300050507 nmdc:mga05p37_254974_c1 nmdc:mga05p37_254974_c1_1143_1823 200
370 3300050510 nmdc:mga06r32_24408_c1 nmdc:mga06r32_24408_c1_14_679 200
371 3300050511 nmdc:mga08y16_234504_c1 nmdc:mga08y16_234504_c1_11_676 200
372 3300050512 nmdc:mga0n895_217567_c1 nmdc:mga0n895_217567_c1_38_718 200
373 3300050512 nmdc:mga0n895_64149_c1 nmdc:mga0n895_64149_c1_1252_1917 200
374 3300050513 nmdc:mga0rr50_3609_c1 nmdc:mga0rr50_3609_c1_332_1012 200
375 3300050515 nmdc:mga0a205_160923_c1 nmdc:mga0a205_160923_c1_1264_1929 200
376 3300050515 nmdc:mga0a205_97692_c1 nmdc:mga0a205_97692_c1_606_1286 200
377 3300054114 Ga0501084_0008187 Ga0501084_0008187_6108_6773 200
378 3300054114 Ga0501084_0012678 Ga0501084_0012678_799_1464 200
379 3300060353 Ga0501082_0007239 Ga0501082_0007239_327_992 200
380 3300060353 Ga0501082_0188886 Ga0501082_0188886_540_1205 200
381 3300061734 Ga0530510_0062320 Ga0530510_0062320_1418_2083 200
382 3300061734 Ga0530510_0666168 Ga0530510_0666168_34_699 200
383 3300005436 Ga0070713_100713526 Ga0070713_1007135262 201
384 3300005439 Ga0070711_100016397 Ga0070711_1000163973 201
385 3300006175 Ga0070712_100042094 Ga0070712_1000420946 201
386 3300025928 Ga0207700_10021851 Ga0207700_100218516 201
387 3300035117 Ga0373953_0023137 Ga0373953_0023137_1081_1743 201
388 3300035119 Ga0373956_0134441 Ga0373956_0134441_139_801 201
389 3300035410 Ga0373924_0098401 Ga0373924_0098401_241_903 201
390 3300035692 Ga0373935_0065872 Ga0373935_0065872_624_1286 201
391 3300035695 Ga0373927_0384298 Ga0373927_0384298_18_680 201
392 3300035724 Ga0373933_0006192 Ga0373933_0006192_630_1292 201
393 3300035724 Ga0373933_0021820 Ga0373933_0021820_543_1205 201
394 3300036401 Ga0373937_0001999 Ga0373937_0001999_319_981 201
395 3300036401 Ga0373937_0031629 Ga0373937_0031629_3513_4175 201
396 3300037853 Ga0436364_0394424 Ga0436364_0394424_1154_1825 201
397 3300037853 Ga0436364_1005063 Ga0436364_1005063_3095_3745 201
398 3300037853 Ga0436364_1087062 Ga0436364_1087062_873_1523 201
399 3300046463 Ga0495653_0123340 Ga0495653_0123340_1167_1829 201
400 3300046477 Ga0495664_0000913 Ga0495664_0000913_12402_13064 201
401 3300046511 Ga0495608_0017576 Ga0495608_0017576_614_1276 201
402 3300046511 Ga0495608_0071114 Ga0495608_0071114_1472_2134 201
403 3300046533 Ga0495640_0270618 Ga0495640_0270618_81_743 201
404 3300046536 Ga0495587_0039403 Ga0495587_0039403_117_779 201
405 3300046543 Ga0495645_0000977 Ga0495645_0000977_15240_15902 201
406 3300046559 Ga0495667_0014051 Ga0495667_0014051_1222_1884 201
407 3300046559 Ga0495667_0035914 Ga0495667_0035914_1499_2161 201
408 3300046663 Ga0495635_0152832 Ga0495635_0152832_460_1122 201
409 3300046678 Ga0495599_0067125 Ga0495599_0067125_378_1040 201
410 3300047317 Ga0495604_0009634 Ga0495604_0009634_4830_5492 201
411 3300047319 Ga0495674_0012361 Ga0495674_0012361_4433_5095 201
412 3300047444 Ga0495675_0003841 Ga0495675_0003841_4430_5092 201
413 3300047471 Ga0495684_0147893 Ga0495684_0147893_566_1228 201
414 3300048088 Ga0495602_0000695 Ga0495602_0000695_11588_12250 201
415 3300048088 Ga0495602_0029666 Ga0495602_0029666_1850_2512 201
416 3300049584 Ga0501068_0496248 Ga0501068_0496248_30_698 201
417 3300053077 Ga0495601_0001469 Ga0495601_0001469_8354_9016 201
418 3300053078 Ga0495612_0004354 Ga0495612_0004354_1482_2144 201
419 3300053083 Ga0495655_0000735 Ga0495655_0000735_2531_3199 201
420 3300053085 Ga0495619_0032408 Ga0495619_0032408_2107_2769 201
421 3300005367 Ga0070667_100000028 Ga0070667_10000002851 202
422 3300009101 Ga0105247_10131204 Ga0105247_101312042 202
423 3300014325 Ga0163163_10280619 Ga0163163_102806192 202
424 3300014968 Ga0157379_10163155 Ga0157379_101631552 202
425 3300025900 Ga0207710_10032357 Ga0207710_100323572 202
426 3300025986 Ga0207658_10000054 Ga0207658_1000005473 202
427 3300048907 Ga0496104_0057463 Ga0496104_0057463_2119_2781 202
428 3300048908 Ga0496105_0217912 Ga0496105_0217912_862_1524 202
429 3300048908 Ga0496105_0229246 Ga0496105_0229246_327_989 202
430 3300048909 Ga0496106_0376429 Ga0496106_0376429_193_855 202
431 3300048910 Ga0496107_0050277 Ga0496107_0050277_1775_2437 202
432 3300048915 Ga0496112_0021110 Ga0496112_0021110_2817_3479 202
433 3300048915 Ga0496112_0141800 Ga0496112_0141800_1035_1697 202
434 3300048916 Ga0496113_0658997 Ga0496113_0658997_102_764 202
435 3300005444 Ga0070694_100579684 Ga0070694_1005796841 203
436 3300009094 Ga0111539_10206003 Ga0111539_102060033 203
437 3300013306 Ga0163162_10560727 Ga0163162_105607271 203
438 3300026075 Ga0207708_10047523 Ga0207708_100475233 203
439 3300028380 Ga0268265_10352264 Ga0268265_103522642 203
440 3300035115 Ga0373941_0046731 Ga0373941_0046731_524_1198 203
441 3300035170 Ga0373943_0050510 Ga0373943_0050510_88_762 203
442 3300035691 Ga0373931_0079411 Ga0373931_0079411_717_1391 203
443 3300035695 Ga0373927_0031719 Ga0373927_0031719_373_1047 203
444 3300035725 Ga0373947_0030940 Ga0373947_0030940_200_874 203
445 3300036401 Ga0373937_0077997 Ga0373937_0077997_608_1282 203
446 3300037068 Ga0373925_0034512 Ga0373925_0034512_1489_2163 203
447 3300037853 Ga0436364_0113032 Ga0436364_0113032_1142_1819 203
448 3300046455 Ga0495603_0000627 Ga0495603_0000627_6934_7608 203
449 3300046455 Ga0495603_0225118 Ga0495603_0225118_370_1044 203
450 3300046459 Ga0495629_0000108 Ga0495629_0000108_70396_71070 203
451 3300046461 Ga0495641_0014389 Ga0495641_0014389_1764_2438 203
452 3300046473 Ga0495582_0002320 Ga0495582_0002320_6627_7301 203
453 3300046475 Ga0495639_0003785 Ga0495639_0003785_5610_6284 203
454 3300046499 Ga0495594_0000131 Ga0495594_0000131_22430_23104 203
455 3300046557 Ga0495622_0002289 Ga0495622_0002289_3405_4079 203
456 3300046642 Ga0495634_0030817 Ga0495634_0030817_1399_2073 203
457 3300046674 Ga0495588_0005127 Ga0495588_0005127_4887_5561 203
458 3300046681 Ga0495647_0170884 Ga0495647_0170884_255_929 203
459 3300046683 Ga0495658_0002461 Ga0495658_0002461_6767_7441 203
460 3300046689 Ga0495613_0003651 Ga0495613_0003651_8106_8780 203
461 3300047322 Ga0495680_0016038 Ga0495680_0016038_3847_4521 203
462 3300047673 Ga0495593_0001789 Ga0495593_0001789_6017_6691 203
463 3300048089 Ga0495614_0004916 Ga0495614_0004916_1387_2061 203
464 3300048903 Ga0496100_0142028 Ga0496100_0142028_147_821 203
465 3300048905 Ga0496102_0807625 Ga0496102_0807625_136_810 203
466 3300048910 Ga0496107_0748066 Ga0496107_0748066_15_689 203
467 3300048912 Ga0496109_0636397 Ga0496109_0636397_29_703 203
468 3300048917 Ga0496114_0644286 Ga0496114_0644286_144_818 203
469 3300049568 Ga0501031_0036204 Ga0501031_0036204_1916_2590 203
470 3300049569 Ga0501032_0047964 Ga0501032_0047964_501_1175 203
471 3300049571 Ga0501034_0356217 Ga0501034_0356217_232_906 203
472 3300049572 Ga0501036_0059150 Ga0501036_0059150_1632_2306 203
473 3300049573 Ga0501037_0096695 Ga0501037_0096695_974_1648 203
474 3300049574 Ga0501038_0160916 Ga0501038_0160916_490_1164 203
475 3300049576 Ga0501040_0026777 Ga0501040_0026777_2714_3388 203
476 3300049577 Ga0501041_0103965 Ga0501041_0103965_257_931 203
477 3300049577 Ga0501041_0262667 Ga0501041_0262667_149_823 203
478 3300049578 Ga0501042_0013323 Ga0501042_0013323_2476_3150 203
479 3300049579 Ga0501043_0035736 Ga0501043_0035736_466_1140 203
480 3300049580 Ga0501046_0162944 Ga0501046_0162944_520_1194 203
481 3300049582 Ga0501048_0097007 Ga0501048_0097007_893_1567 203
482 3300049587 Ga0501071_0019202 Ga0501071_0019202_3918_4592 203
483 3300049588 Ga0501072_0002082 Ga0501072_0002082_9943_10617 203
484 3300049589 Ga0501073_0486557 Ga0501073_0486557_85_759 203
485 3300049591 Ga0501075_0032984 Ga0501075_0032984_2050_2724 203
486 3300049592 Ga0501076_0011455 Ga0501076_0011455_5678_6352 203
487 3300049593 Ga0501077_0070587 Ga0501077_0070587_838_1512 203
488 3300049741 Ga0501079_0076427 Ga0501079_0076427_722_1396 203
489 3300049742 Ga0501080_0118384 Ga0501080_0118384_1051_1725 203
490 3300049743 Ga0501081_0060831 Ga0501081_0060831_1443_2117 203
491 3300049744 Ga0501083_0158520 Ga0501083_0158520_749_1423 203
492 3300049822 Ga0501035_0141581 Ga0501035_0141581_38_712 203
493 3300049824 Ga0501045_0058467 Ga0501045_0058467_1894_2568 203
494 3300049824 Ga0501045_0685090 Ga0501045_0685090_55_729 203
495 3300054114 Ga0501084_0241590 Ga0501084_0241590_813_1487 203
496 3300054114 Ga0501084_0448594 Ga0501084_0448594_322_996 203
497 3300060353 Ga0501082_0142108 Ga0501082_0142108_1165_1839 203
498 3300060353 Ga0501082_0457848 Ga0501082_0457848_148_822 203
499 3300061734 Ga0530510_0074535 Ga0530510_0074535_676_1350 203
500 3300005330 Ga0070690_100380366 Ga0070690_1003803662 204
501 3300005438 Ga0070701_10039677 Ga0070701_100396773 204
502 3300005543 Ga0070672_100139993 Ga0070672_1001399932 204
503 3300005544 Ga0070686_100154702 Ga0070686_1001547022 204
504 3300005545 Ga0070695_100211989 Ga0070695_1002119892 204
505 3300005617 Ga0068859_100412148 Ga0068859_1004121482 204
506 3300005718 Ga0068866_10085206 Ga0068866_100852063 204
507 3300005719 Ga0068861_100012716 Ga0068861_1000127165 204
508 3300005843 Ga0068860_100214006 Ga0068860_1002140062 204
509 3300005844 Ga0068862_100202146 Ga0068862_1002021461 204
510 3300005937 Ga0081455_10004482 Ga0081455_1000448216 204
511 3300006237 Ga0097621_100391783 Ga0097621_1003917832 204
512 3300006931 Ga0097620_100412169 Ga0097620_1004121692 204
513 3300009098 Ga0105245_10992185 Ga0105245_109921852 204
514 3300009148 Ga0105243_10264163 Ga0105243_102641632 204
515 3300009545 Ga0105237_11196233 Ga0105237_111962331 204
516 3300009553 Ga0105249_10009909 Ga0105249_100099095 204
517 3300011119 Ga0105246_10067183 Ga0105246_100671834 204
518 3300013297 Ga0157378_10073211 Ga0157378_100732115 204
519 3300013308 Ga0157375_10025195 Ga0157375_100251952 204
520 3300014326 Ga0157380_10117920 Ga0157380_101179202 204
521 3300014968 Ga0157379_10066825 Ga0157379_100668254 204
522 3300014969 Ga0157376_10110608 Ga0157376_101106082 204
523 3300017792 Ga0163161_10019758 Ga0163161_100197585 204
524 3300025901 Ga0207688_10162135 Ga0207688_101621353 204
525 3300025937 Ga0207669_10061713 Ga0207669_100617133 204
526 3300025940 Ga0207691_10382831 Ga0207691_103828312 204
527 3300025961 Ga0207712_10083788 Ga0207712_100837882 204
528 3300026035 Ga0207703_10019705 Ga0207703_100197055 204
529 3300026089 Ga0207648_10099390 Ga0207648_100993904 204
530 3300026121 Ga0207683_10390414 Ga0207683_103904142 204
531 3300028380 Ga0268265_10112108 Ga0268265_101121081 204
532 3300046455 Ga0495603_0267224 Ga0495603_0267224_240_902 204
533 3300048904 Ga0496101_0084385 Ga0496101_0084385_1220_1882 204
534 3300048907 Ga0496104_0034302 Ga0496104_0034302_964_1626 204
535 3300048910 Ga0496107_0028111 Ga0496107_0028111_3185_3847 204
536 3300048918 Ga0496115_0069189 Ga0496115_0069189_1296_1958 204
537 3300031548 Ga0307408_100349405 Ga0307408_1003494052 205
538 3300032002 Ga0307416_100290349 Ga0307416_1002903493 205
539 3300014326 Ga0157380_10715275 Ga0157380_107152751 206
540 3300031995 Ga0307409_100087034 Ga0307409_1000870343 206
541 2162886007 SwRhRL2b_contig_1806315 SwRhRL2b_0510.00008480 208
542 2162886007 SwRhRL2b_contig_2605276 SwRhRL2b_0908.00004850 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

66

237

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9048 10 199
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8258 10 199
1ui1-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase from thermus thermophilus hb8 0.7393 10 203
6u15-assembly1.cif.gz_A human thymine dna glycosylase n140a mutant bound to dna with 2'-f-5-carboxyl-dc substrate analog 0.7256 37 201
3uo7-assembly1.cif.gz_A crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.7128 37 201
ID Description Score Start End Superfamily
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9062 10 199 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8915 12 198 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8271 10 199 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8014 12 198 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7235 37 198 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7C5L050-F1-model_v4 Uracil-DNA glycosylase 0.9917 8 108 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A383CLQ7-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9887 8 142 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A350KEA7-F1-model_v4 deleted 0.9882 31 125
AF-A0A6B3CEB1-F1-model_v4 Uracil-DNA glycosylase 0.9878 36 116 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7V8ZNF6-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9874 5 135 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Feature Viewer

pLDDT pTM Quality
92.39 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map