F461451

General Info

Members Datasets Scaffolds Average Seq Length
542 308 540 92

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100754032|Ga0070683_1007540321
Length 108
Sequence LSARPELGYLARMCRNIRTLYNFDPPTSSDEVHEAALQYVRKVSGMNKPSRANQEVFDRAVHEIAHLTEHLLADLVTTAPPRDREVEAEKARARSALRFARPSGSSAA

Samples

Sample ID Description Type Environment
1 2773857759 Microbacterium sp. 1294 Isolate Unclassified
2 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
201 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 13.65
Rhizosphere 83.58
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10067934 3300002075 Bacteria 736
2 JGI24751J29686_10037306 3300002459 Bacteria 1006
3 JGI25406J46586_10057059 3300003203 Bacteria 1278
4 Ga0070676_10032239 3300005328 Bacteria 3001
5 Ga0070683_100042259 3300005329 Bacteria 4197
6 Ga0070683_100297633 3300005329 Bacteria 1535
7 Ga0070683_100754032 3300005329 Bacteria 933
8 Ga0070670_100409901 3300005331 Bacteria 1197
9 Ga0070670_101363156 3300005331 Bacteria 650
10 Ga0070666_10533599 3300005335 Bacteria 853
11 Ga0070682_100130254 3300005337 Bacteria 1702
12 Ga0068868_100005695 3300005338 Bacteria 8770
13 Ga0068868_100930139 3300005338 Bacteria 792
14 Ga0068868_100938831 3300005338 Bacteria 788
15 Ga0068868_102108992 3300005338 Bacteria 536
16 Ga0070660_100001771 3300005339 Bacteria 14831
17 Ga0070660_100917999 3300005339 Bacteria 738
18 Ga0070689_100328759 3300005340 Bacteria 1278
19 Ga0070691_10063005 3300005341 Bacteria 1787
20 Ga0070687_101267920 3300005343 Bacteria 546
21 Ga0070692_10536475 3300005345 Bacteria 764
22 Ga0070692_10760779 3300005345 Bacteria 658
23 Ga0070668_101055254 3300005347 Bacteria 732
24 Ga0070675_100524563 3300005354 Bacteria 1069
25 Ga0070671_100291843 3300005355 Bacteria 1388
26 Ga0070674_100324731 3300005356 Bacteria 1235
27 Ga0070674_101062495 3300005356 Bacteria 713
28 Ga0070674_101482757 3300005356 Bacteria 609
29 Ga0070688_100119814 3300005365 Bacteria 1761
30 Ga0070688_100454878 3300005365 Bacteria 958
31 Ga0070659_100031418 3300005366 Bacteria 4112
32 Ga0070659_101597330 3300005366 Bacteria 582
33 Ga0070659_101913298 3300005366 Bacteria 532
34 Ga0070667_100309163 3300005367 Bacteria 1424
35 Ga0070714_100169950 3300005435 Bacteria 1978
36 Ga0070714_100541955 3300005435 Bacteria 1113
37 Ga0070714_101845273 3300005435 Unclassified 590
38 Ga0070713_100230851 3300005436 Bacteria 1682
39 Ga0070713_101055205 3300005436 Bacteria 785
40 Ga0070713_101180848 3300005436 Bacteria 741
41 Ga0070710_10112834 3300005437 Bacteria 1635
42 Ga0070710_10500809 3300005437 Bacteria 831
43 Ga0070701_10283752 3300005438 Bacteria 1012
44 Ga0070711_100216803 3300005439 Bacteria 1485
45 Ga0070711_100319693 3300005439 Bacteria 1240
46 Ga0070711_101323581 3300005439 Bacteria 625
47 Ga0070700_100156797 3300005441 Bacteria 1563
48 Ga0070700_100669079 3300005441 Bacteria 822
49 Ga0070694_100261933 3300005444 Bacteria 1312
50 Ga0070708_101165529 3300005445 Bacteria 721
51 Ga0070678_100037838 3300005456 Bacteria 3392
52 Ga0070662_100343769 3300005457 Bacteria 1221
53 Ga0070662_100668854 3300005457 Bacteria 877
54 Ga0070662_101605896 3300005457 Bacteria 561
55 Ga0070685_10049684 3300005466 Bacteria 2420
56 Ga0070685_10638779 3300005466 Bacteria 770
57 Ga0070706_100398022 3300005467 Bacteria 1282
58 Ga0070706_101914860 3300005467 Bacteria 538
59 Ga0070698_100141589 3300005471 Bacteria 2356
60 Ga0070698_101270215 3300005471 Bacteria 686
61 Ga0070679_101244215 3300005530 Bacteria 690
62 Ga0070684_100199473 3300005535 Bacteria 1822
63 Ga0068853_100030908 3300005539 Bacteria 4526
64 Ga0068853_100216604 3300005539 Bacteria 1747
65 Ga0070672_102100002 3300005543 Bacteria 509
66 Ga0070686_100483738 3300005544 Bacteria 958
67 Ga0070686_100658770 3300005544 Bacteria 831
68 Ga0070686_101915988 3300005544 Bacteria 506
69 Ga0070695_101405336 3300005545 Bacteria 579
70 Ga0070696_101228115 3300005546 Bacteria 634
71 Ga0070665_100179203 3300005548 Bacteria 2120
72 Ga0070665_102565836 3300005548 Bacteria 511
73 Ga0070704_100356712 3300005549 Bacteria 1236
74 Ga0068855_100069956 3300005563 Bacteria 4083
75 Ga0070664_100265845 3300005564 Bacteria 1544
76 Ga0068857_100034823 3300005577 Bacteria 4455
77 Ga0068857_100320319 3300005577 Bacteria 1432
78 Ga0068854_100620944 3300005578 Bacteria 925
79 Ga0068856_100651355 3300005614 Bacteria 1074
80 Ga0070702_100545166 3300005615 Bacteria 860
81 Ga0068852_100056540 3300005616 Bacteria 3391
82 Ga0068852_100814081 3300005616 Unclassified 948
83 Ga0068852_100914624 3300005616 Unclassified 895
84 Ga0068852_101799960 3300005616 Bacteria 635
85 Ga0068859_100113683 3300005617 Bacteria 2771
86 Ga0068859_100884878 3300005617 Unclassified 978
87 Ga0068864_100140609 3300005618 Bacteria 2177
88 Ga0068864_100815244 3300005618 Bacteria 918
89 Ga0068866_10575145 3300005718 Bacteria 757
90 Ga0068861_100912484 3300005719 Bacteria 833
91 Ga0068870_10035197 3300005840 Bacteria 2568
92 Ga0068870_10353423 3300005840 Bacteria 944
93 Ga0068863_100856039 3300005841 Bacteria 908
94 Ga0068858_100025098 3300005842 Bacteria 5547
95 Ga0068858_100872606 3300005842 Bacteria 879
96 Ga0068858_102503557 3300005842 Bacteria 510
97 Ga0068860_101627244 3300005843 Bacteria 668
98 Ga0068862_102404794 3300005844 Bacteria 539
99 Ga0081539_10002150 3300005985 Bacteria 29119
100 Ga0081539_10195150 3300005985 Bacteria 939
101 Ga0070717_10006834 3300006028 Bacteria 8418
102 Ga0070717_10043513 3300006028 Bacteria 3666
103 Ga0070717_12038109 3300006028 Bacteria 517
104 Ga0075365_10128010 3300006038 Bacteria 1756
105 Ga0075365_10684873 3300006038 Bacteria 724
106 Ga0075365_10734140 3300006038 Bacteria 697
107 Ga0070716_100359349 3300006173 Bacteria 1034
108 Ga0075362_10059361 3300006177 Bacteria 1727
109 Ga0075369_10108589 3300006186 Bacteria 1250
110 Ga0075366_10243904 3300006195 Bacteria 1095
111 Ga0097621_101046761 3300006237 Bacteria 765
112 Ga0075428_101004408 3300006844 Bacteria 883
113 Ga0075433_10284211 3300006852 Bacteria 1465
114 Ga0075433_11358146 3300006852 Bacteria 615
115 Ga0075434_100000189 3300006871 Bacteria 40699
116 Ga0075434_100006313 3300006871 Bacteria 10864
117 Ga0068865_100230730 3300006881 Bacteria 1452
118 Ga0068865_100383075 3300006881 Bacteria 1147
119 Ga0075436_100040261 3300006914 Bacteria 3225
120 Ga0097620_100113680 3300006931 Bacteria 2771
121 Ga0097620_100884812 3300006931 Unclassified 978
122 Ga0075435_100001011 3300007076 Bacteria 17837
123 Ga0075435_100005187 3300007076 Bacteria 9062
124 Ga0099795_10437150 3300007788 Bacteria 600
125 Ga0105250_10237254 3300009092 Bacteria 777
126 Ga0105240_10091627 3300009093 Bacteria 3713
127 Ga0111539_10071796 3300009094 Bacteria 4084
128 Ga0111539_11084439 3300009094 Bacteria 931
129 Ga0111539_12617096 3300009094 Bacteria 585
130 Ga0111539_12701016 3300009094 Bacteria 575
131 Ga0105245_10012419 3300009098 Bacteria 7412
132 Ga0105245_10153633 3300009098 Bacteria 2178
133 Ga0105245_10329144 3300009098 Bacteria 1507
134 Ga0105245_11683138 3300009098 Bacteria 687
135 Ga0105245_13143907 3300009098 Bacteria 512
136 Ga0114129_10101632 3300009147 Bacteria 3978
137 Ga0114129_11270526 3300009147 Bacteria 914
138 Ga0105243_10111085 3300009148 Bacteria 2294
139 Ga0105241_10644503 3300009174 Unclassified 961
140 Ga0105242_10069422 3300009176 Bacteria 2918
141 Ga0105242_10621253 3300009176 Bacteria 1047
142 Ga0105242_12533343 3300009176 Bacteria 561
143 Ga0105248_10089873 3300009177 Bacteria 3458
144 Ga0105238_10006910 3300009551 Bacteria 11335
145 Ga0105249_10154311 3300009553 Bacteria 2213
146 Ga0105239_10003251 3300010375 Bacteria 20061
147 Ga0105239_10742212 3300010375 Bacteria 1123
148 Ga0105239_10868695 3300010375 Bacteria 1035
149 Ga0105246_10001045 3300011119 Bacteria 15971
150 Ga0157371_10399650 3300013102 Bacteria 1005
151 Ga0157369_10320311 3300013105 Bacteria 1612
152 Ga0157369_12124527 3300013105 Bacteria 569
153 Ga0157374_10006009 3300013296 Bacteria 10274
154 Ga0157374_10021831 3300013296 Bacteria 5703
155 Ga0157378_10150876 3300013297 Bacteria 2165
156 Ga0163162_10584117 3300013306 Bacteria 1244
157 Ga0163162_11111538 3300013306 Bacteria 896
158 Ga0157372_10401586 3300013307 Bacteria 1597
159 Ga0157375_10077649 3300013308 Bacteria 3351
160 Ga0163163_10001642 3300014325 Bacteria 18835
161 Ga0163163_11022722 3300014325 Bacteria 890
162 Ga0157380_13303346 3300014326 Unclassified 516
163 Ga0157377_10008393 3300014745 Bacteria 5037
164 Ga0157377_10358014 3300014745 Bacteria 981
165 Ga0157377_10670367 3300014745 Bacteria 749
166 Ga0157379_10030343 3300014968 Bacteria 4812
167 Ga0157376_11429265 3300014969 Bacteria 724
168 Ga0163161_11974680 3300017792 Bacteria 519
169 Ga0213874_10239111 3300021377 Bacteria 666
170 Ga0213871_10023265 3300021441 Bacteria 1559
171 Ga0207692_10188351 3300025898 Bacteria 1206
172 Ga0207692_10255529 3300025898 Bacteria 1052
173 Ga0207642_10623424 3300025899 Bacteria 673
174 Ga0207688_10006244 3300025901 Bacteria 6484
175 Ga0207688_10392626 3300025901 Bacteria 860
176 Ga0207647_10331495 3300025904 Bacteria 863
177 Ga0207685_10102665 3300025905 Bacteria 1225
178 Ga0207699_10097550 3300025906 Bacteria 1858
179 Ga0207645_10564360 3300025907 Bacteria 772
180 Ga0207643_10025546 3300025908 Bacteria 3265
181 Ga0207643_10084922 3300025908 Bacteria 1838
182 Ga0207684_10322805 3300025910 Bacteria 1331
183 Ga0207684_10902855 3300025910 Bacteria 743
184 Ga0207684_11404422 3300025910 Bacteria 571
185 Ga0207654_10910807 3300025911 Unclassified 638
186 Ga0207695_10193365 3300025913 Bacteria 1951
187 Ga0207671_11005587 3300025914 Bacteria 657
188 Ga0207660_10809604 3300025917 Unclassified 764
189 Ga0207657_10001049 3300025919 Bacteria 29285
190 Ga0207657_11225544 3300025919 Bacteria 569
191 Ga0207649_11356332 3300025920 Bacteria 563
192 Ga0207652_10876877 3300025921 Bacteria 794
193 Ga0207646_10695860 3300025922 Bacteria 909
194 Ga0207694_10039435 3300025924 Bacteria 3635
195 Ga0207650_10472213 3300025925 Bacteria 1046
196 Ga0207659_10305818 3300025926 Bacteria 1307
197 Ga0207659_10409199 3300025926 Bacteria 1136
198 Ga0207687_10020792 3300025927 Bacteria 4355
199 Ga0207687_10110524 3300025927 Bacteria 2038
200 Ga0207687_11841939 3300025927 Bacteria 518
201 Ga0207700_10037642 3300025928 Bacteria 3505
202 Ga0207700_10421943 3300025928 Bacteria 1172
203 Ga0207700_11824688 3300025928 Bacteria 534
204 Ga0207664_10095178 3300025929 Bacteria 2449
205 Ga0207664_10726901 3300025929 Bacteria 893
206 Ga0207644_10160317 3300025931 Bacteria 1748
207 Ga0207690_10028340 3300025932 Bacteria 3550
208 Ga0207706_10024837 3300025933 Bacteria 5371
209 Ga0207686_10623185 3300025934 Bacteria 851
210 Ga0207709_10317500 3300025935 Bacteria 1165
211 Ga0207669_10581209 3300025937 Bacteria 908
212 Ga0207669_10772154 3300025937 Bacteria 795
213 Ga0207669_10935066 3300025937 Bacteria 726
214 Ga0207704_10051755 3300025938 Bacteria 2486
215 Ga0207704_11029628 3300025938 Bacteria 697
216 Ga0207665_10031459 3300025939 Bacteria 3511
217 Ga0207691_10220183 3300025940 Bacteria 1646
218 Ga0207711_10061669 3300025941 Bacteria 3234
219 Ga0207689_10208081 3300025942 Bacteria 1616
220 Ga0207661_10065260 3300025944 Bacteria 2955
221 Ga0207661_10816448 3300025944 Unclassified 859
222 Ga0207679_10297107 3300025945 Bacteria 1391
223 Ga0207667_10004544 3300025949 Bacteria 17001
224 Ga0207667_11580857 3300025949 Bacteria 625
225 Ga0207651_10363684 3300025960 Bacteria 1222
226 Ga0207712_10201098 3300025961 Bacteria 1580
227 Ga0207640_10206862 3300025981 Bacteria 1492
228 Ga0207640_12035861 3300025981 Bacteria 520
229 Ga0207677_10002013 3300026023 Bacteria 10722
230 Ga0207677_11611351 3300026023 Bacteria 601
231 Ga0207703_10307646 3300026035 Bacteria 1447
232 Ga0207703_11394231 3300026035 Bacteria 674
233 Ga0207678_10078179 3300026067 Bacteria 2833
234 Ga0207678_10412808 3300026067 Bacteria 1170
235 Ga0207708_10035751 3300026075 Bacteria 3780
236 Ga0207708_10151155 3300026075 Bacteria 1828
237 Ga0207708_11505793 3300026075 Bacteria 591
238 Ga0207708_11691983 3300026075 Bacteria 556
239 Ga0207702_10305355 3300026078 Bacteria 1511
240 Ga0207702_10368648 3300026078 Bacteria 1378
241 Ga0207702_11287347 3300026078 Bacteria 725
242 Ga0207641_10300236 3300026088 Bacteria 1517
243 Ga0207648_12060660 3300026089 Bacteria 532
244 Ga0207676_10124554 3300026095 Bacteria 2180
245 Ga0207676_10942821 3300026095 Bacteria 848
246 Ga0207674_10001018 3300026116 Bacteria 36636
247 Ga0207675_100547777 3300026118 Bacteria 1156
248 Ga0207675_102079195 3300026118 Bacteria 585
249 Ga0207683_10040124 3300026121 Bacteria 4083
250 Ga0207698_10069789 3300026142 Bacteria 2781
251 Ga0207428_10733337 3300027907 Bacteria 705
252 Ga0207428_11101913 3300027907 Bacteria 555
253 Ga0268266_10091270 3300028379 Bacteria 2671
254 Ga0268266_11956747 3300028379 Bacteria 560
255 Ga0268266_12321045 3300028379 Bacteria 508
256 Ga0268265_11495515 3300028380 Bacteria 679
257 Ga0268264_10225292 3300028381 Bacteria 1728
258 Ga0265319_1010138 3300028563 Bacteria 3950
259 Ga0265319_1013685 3300028563 Bacteria 3212
260 Ga0265318_10046383 3300028577 Bacteria 1640
261 Ga0265318_10357673 3300028577 Bacteria 533
262 Ga0265338_10118007 3300028800 Bacteria 2121
263 Ga0265324_10149267 3300029957 Bacteria 794
264 Ga0265328_10239280 3300031239 Bacteria 694
265 Ga0265320_10050042 3300031240 Bacteria 2033
266 Ga0265320_10341635 3300031240 Bacteria 661
267 Ga0265327_10124503 3300031251 Bacteria 1218
268 Ga0307413_10318792 3300031824 Bacteria 1186
269 Ga0307410_11858405 3300031852 Bacteria 536
270 Ga0307406_10065282 3300031901 Bacteria 2365
271 Ga0307409_100102095 3300031995 Bacteria 2382
272 Ga0373926_0080961 3300035083 Bacteria 1201
273 Ga0373934_0034137 3300035086 Bacteria 1999
274 Ga0373934_0196210 3300035086 Bacteria 831
275 Ga0373944_0050110 3300035089 Bacteria 1314
276 Ga0373949_0019875 3300035090 Bacteria 1534
277 Ga0373923_0058336 3300035111 Bacteria 1634
278 Ga0373945_0005625 3300035116 Bacteria 4019
279 Ga0373953_0234024 3300035117 Bacteria 797
280 Ga0373956_0152500 3300035119 Bacteria 1088
281 Ga0373956_0361785 3300035119 Bacteria 692
282 Ga0373957_0287264 3300035120 Bacteria 696
283 Ga0373943_0015921 3300035170 Bacteria 3422
284 Ga0373946_0017134 3300035171 Bacteria 2768
285 Ga0373946_0406597 3300035171 Bacteria 688
286 Ga0373924_0019913 3300035410 Bacteria 2603
287 Ga0373924_0464077 3300035410 Bacteria 568
288 Ga0373935_0037167 3300035692 Bacteria 3046
289 Ga0373927_0082991 3300035695 Bacteria 2078
290 Ga0373927_0268299 3300035695 Bacteria 1122
291 Ga0373933_0056851 3300035724 Bacteria 2350
292 Ga0373933_0084793 3300035724 Bacteria 1947
293 Ga0373933_0729379 3300035724 Bacteria 652
294 Ga0373947_0024767 3300035725 Bacteria 3499
295 Ga0373937_0057717 3300036401 Bacteria 3566
296 Ga0373937_1223085 3300036401 Bacteria 699
297 Ga0373937_1853928 3300036401 Bacteria 549
298 Ga0373925_0027481 3300037068 Bacteria 4164
299 Ga0373925_0667056 3300037068 Bacteria 857
300 Ga0395899_0921214 3300037312 Bacteria 532
301 Ga0395900_0167599 3300037418 Bacteria 2238
302 Ga0395898_0486964 3300037466 Bacteria 1173
303 Ga0395898_0871128 3300037466 Bacteria 839
304 Ga0395898_1390213 3300037466 Bacteria 630
305 Ga0395905_0353301 3300037471 Bacteria 1362
306 Ga0395901_1829141 3300038443 Bacteria 556
307 Ga0436365_1271021 3300039437 Bacteria 2261
308 Ga0436360_1218010 3300039438 Bacteria 2787
309 Ga0436363_0007682 3300039450 Bacteria 1125
310 Ga0436362_0725924 3300039453 Bacteria 703
311 Ga0439436_0115998 3300041404 Bacteria 748
312 Ga0451795_0203502 3300041456 Bacteria 756
313 Ga0451807_1280054 3300041486 Bacteria 512
314 Ga0451853_2207647 3300041512 Bacteria 1073
315 Ga0466969_0296161 3300044656 Bacteria 732
316 Ga0466966_0004486 3300044684 Bacteria 9208
317 Ga0466966_0059314 3300044684 Bacteria 2417
318 Ga0466966_0915453 3300044684 Bacteria 529
319 Ga0466961_0002730 3300044693 Bacteria 10974
320 Ga0466963_0003543 3300044694 Bacteria 8962
321 Ga0466963_0058878 3300044694 Bacteria 2563
322 Ga0466963_0289636 3300044694 Bacteria 1151
323 Ga0466963_0616524 3300044694 Bacteria 766
324 Ga0466963_0687214 3300044694 Bacteria 722
325 Ga0466964_0001685 3300044706 Bacteria 7625
326 Ga0466964_0008773 3300044706 Bacteria 3801
327 Ga0466964_0039600 3300044706 Bacteria 1900
328 Ga0466964_0293055 3300044706 Bacteria 817
329 Ga0466964_0616241 3300044706 Bacteria 597
330 Ga0466971_0156503 3300044719 Bacteria 1065
331 Ga0466971_0164706 3300044719 Bacteria 1039
332 Ga0466968_0001498 3300044735 Bacteria 8360
333 Ga0466968_0172129 3300044735 Bacteria 1004
334 Ga0466970_0039835 3300044765 Bacteria 2494
335 Ga0466957_0781379 3300044842 Bacteria 678
336 Ga0466960_0914994 3300044901 Bacteria 536
337 Ga0466959_0109225 3300045049 Bacteria 1975
338 Ga0466959_0537866 3300045049 Bacteria 788
339 Ga0466958_0002290 3300045836 Bacteria 9547
340 Ga0466958_0007101 3300045836 Bacteria 6133
341 Ga0466958_0307139 3300045836 Bacteria 1019
342 Ga0466958_0439861 3300045836 Bacteria 844
343 Ga0466958_0589720 3300045836 Bacteria 723
344 Ga0466967_0001868 3300045976 Bacteria 12700
345 Ga0466967_0046629 3300045976 Bacteria 3775
346 Ga0466967_0108965 3300045976 Bacteria 2542
347 Ga0466967_0330414 3300045976 Bacteria 1472
348 Ga0466967_0566843 3300045976 Bacteria 1118
349 Ga0466967_0985996 3300045976 Bacteria 839
350 Ga0466967_1034840 3300045976 Bacteria 818
351 Ga0466967_1705209 3300045976 Bacteria 627
352 Ga0495592_0046264 3300046454 Bacteria 3244
353 Ga0495603_0195724 3300046455 Bacteria 1168
354 Ga0495603_0284112 3300046455 Bacteria 951
355 Ga0495629_0035450 3300046459 Bacteria 3525
356 Ga0495641_0011902 3300046461 Bacteria 4911
357 Ga0495651_0036396 3300046462 Bacteria 3832
358 Ga0495653_0015711 3300046463 Bacteria 6171
359 Ga0495653_0845642 3300046463 Bacteria 548
360 Ga0495580_0048722 3300046472 Bacteria 2998
361 Ga0495582_0007720 3300046473 Bacteria 5946
362 Ga0495639_0013945 3300046475 Bacteria 3476
363 Ga0495662_0025456 3300046476 Bacteria 2857
364 Ga0495608_0030505 3300046511 Bacteria 3649
365 Ga0495618_0009858 3300046514 Bacteria 5779
366 Ga0495628_0395868 3300046516 Bacteria 1010
367 Ga0495628_0514476 3300046516 Bacteria 863
368 Ga0495628_0816953 3300046516 Bacteria 651
369 Ga0495630_0029648 3300046517 Bacteria 4066
370 Ga0495630_0055545 3300046517 Bacteria 2967
371 Ga0495630_0068661 3300046517 Bacteria 2666
372 Ga0495630_0382118 3300046517 Bacteria 1079
373 Ga0495666_0040911 3300046526 Bacteria 2246
374 Ga0495665_0011188 3300046531 Bacteria 4858
375 Ga0495640_0167234 3300046533 Bacteria 1406
376 Ga0495640_0834387 3300046533 Bacteria 548
377 Ga0495586_0005420 3300046535 Bacteria 6822
378 Ga0495586_0068558 3300046535 Bacteria 1935
379 Ga0495586_0771596 3300046535 Bacteria 555
380 Ga0495587_0500866 3300046536 Bacteria 671
381 Ga0495645_0619252 3300046543 Bacteria 664
382 Ga0495645_0654906 3300046543 Bacteria 641
383 Ga0495622_0457976 3300046557 Bacteria 547
384 Ga0495667_0035681 3300046559 Bacteria 3321
385 Ga0495667_0704501 3300046559 Bacteria 626
386 Ga0495634_0011405 3300046642 Bacteria 6474
387 Ga0495659_0032632 3300046664 Unclassified 1824
388 Ga0495588_0016392 3300046674 Bacteria 3580
389 Ga0495657_0007442 3300046675 Bacteria 8458
390 Ga0495657_0197132 3300046675 Bacteria 1229
391 Ga0495657_0425631 3300046675 Bacteria 779
392 Ga0495599_0086832 3300046678 Bacteria 1953
393 Ga0495623_0650498 3300046679 Bacteria 543
394 Ga0495647_0015941 3300046681 Bacteria 2639
395 Ga0495658_0020947 3300046683 Bacteria 3440
396 Ga0495658_0239795 3300046683 Bacteria 1138
397 Ga0495658_0305184 3300046683 Bacteria 1007
398 Ga0495613_0004045 3300046689 Bacteria 10967
399 Ga0495613_0265287 3300046689 Bacteria 1195
400 Ga0495624_0012687 3300046690 Bacteria 5755
401 Ga0495600_0009594 3300046809 Bacteria 5984
402 Ga0495600_0366927 3300046809 Bacteria 900
403 Ga0495581_0082196 3300047315 Bacteria 1865
404 Ga0495604_0136713 3300047317 Bacteria 1755
405 Ga0495604_0542212 3300047317 Bacteria 751
406 Ga0495674_0053428 3300047319 Bacteria 3551
407 Ga0495674_0201439 3300047319 Bacteria 1651
408 Ga0495674_0820340 3300047319 Bacteria 722
409 Ga0495676_0048546 3300047321 Bacteria 3421
410 Ga0495680_0083088 3300047322 Bacteria 2415
411 Ga0495680_0189738 3300047322 Bacteria 1479
412 Ga0495680_0235028 3300047322 Bacteria 1304
413 Ga0495680_0601438 3300047322 Bacteria 736
414 Ga0495675_0071378 3300047444 Bacteria 2191
415 Ga0495675_0303209 3300047444 Bacteria 948
416 Ga0495675_0673467 3300047444 Bacteria 581
417 Ga0495684_0017280 3300047471 Bacteria 5553
418 Ga0495593_0019599 3300047673 Bacteria 3791
419 Ga0495602_0072760 3300048088 Bacteria 2929
420 Ga0495602_0571174 3300048088 Bacteria 781
421 Ga0495614_0011246 3300048089 Bacteria 3938
422 Ga0496100_0005810 3300048903 Bacteria 6674
423 Ga0496100_0021504 3300048903 Bacteria 3886
424 Ga0496100_0103243 3300048903 Bacteria 1968
425 Ga0496100_0295868 3300048903 Bacteria 1210
426 Ga0496100_0361563 3300048903 Bacteria 1098
427 Ga0496100_0846907 3300048903 Bacteria 717
428 Ga0496101_0013420 3300048904 Bacteria 5487
429 Ga0496101_0028001 3300048904 Bacteria 3931
430 Ga0496101_0112882 3300048904 Bacteria 2047
431 Ga0496101_0532737 3300048904 Bacteria 928
432 Ga0496101_0584248 3300048904 Bacteria 883
433 Ga0496101_0731529 3300048904 Bacteria 781
434 Ga0496102_0003029 3300048905 Bacteria 14222
435 Ga0496102_0072734 3300048905 Bacteria 3160
436 Ga0496102_0273770 3300048905 Bacteria 1592
437 Ga0496102_0274712 3300048905 Bacteria 1588
438 Ga0496102_1118540 3300048905 Bacteria 707
439 Ga0496103_0149374 3300048906 Bacteria 1496
440 Ga0496103_0199016 3300048906 Bacteria 1288
441 Ga0496104_0028744 3300048907 Bacteria 5153
442 Ga0496104_0038116 3300048907 Bacteria 4496
443 Ga0496104_0071750 3300048907 Bacteria 3292
444 Ga0496104_1111628 3300048907 Bacteria 694
445 Ga0496105_0015043 3300048908 Bacteria 6157
446 Ga0496105_0295849 3300048908 Bacteria 1302
447 Ga0496105_0766906 3300048908 Bacteria 736
448 Ga0496106_0036562 3300048909 Bacteria 3673
449 Ga0496106_0067259 3300048909 Bacteria 2731
450 Ga0496106_0112792 3300048909 Bacteria 2118
451 Ga0496106_1294316 3300048909 Bacteria 566
452 Ga0496107_0001433 3300048910 Bacteria 14740
453 Ga0496107_0165125 3300048910 Bacteria 1641
454 Ga0496107_0230152 3300048910 Bacteria 1379
455 Ga0496108_0003468 3300048911 Bacteria 12651
456 Ga0496108_0020348 3300048911 Bacteria 5454
457 Ga0496108_0312340 3300048911 Bacteria 1370
458 Ga0496108_0334146 3300048911 Bacteria 1321
459 Ga0496108_1068978 3300048911 Bacteria 687
460 Ga0496109_0001431 3300048912 Bacteria 19791
461 Ga0496109_0012514 3300048912 Bacteria 7326
462 Ga0496109_0375688 3300048912 Bacteria 1343
463 Ga0496109_0487884 3300048912 Bacteria 1163
464 Ga0496109_0998291 3300048912 Bacteria 775
465 Ga0496110_0000626 3300048913 Bacteria 24200
466 Ga0496110_0007505 3300048913 Bacteria 8715
467 Ga0496110_1657796 3300048913 Bacteria 549
468 Ga0496111_0002176 3300048914 Bacteria 11738
469 Ga0496111_0121089 3300048914 Bacteria 1932
470 Ga0496112_0003464 3300048915 Bacteria 13045
471 Ga0496112_0004855 3300048915 Bacteria 11485
472 Ga0496112_0006081 3300048915 Bacteria 10550
473 Ga0496112_0530778 3300048915 Bacteria 1111
474 Ga0496112_0650457 3300048915 Bacteria 984
475 Ga0496112_0700620 3300048915 Bacteria 941
476 Ga0496112_0795205 3300048915 Bacteria 871
477 Ga0496112_0862515 3300048915 Bacteria 828
478 Ga0496113_0000221 3300048916 Bacteria 26671
479 Ga0496113_0008913 3300048916 Bacteria 6564
480 Ga0496113_1362975 3300048916 Unclassified 550
481 Ga0496113_1548419 3300048916 Bacteria 511
482 Ga0496114_0016746 3300048917 Bacteria 5911
483 Ga0496114_0023239 3300048917 Bacteria 5058
484 Ga0496114_0134835 3300048917 Bacteria 2134
485 Ga0496114_0146884 3300048917 Bacteria 2044
486 Ga0496114_0222702 3300048917 Bacteria 1656
487 Ga0496114_0259524 3300048917 Bacteria 1530
488 Ga0496114_0287007 3300048917 Bacteria 1451
489 Ga0496115_0053938 3300048918 Bacteria 3227
490 Ga0496115_0109191 3300048918 Bacteria 2271
491 Ga0496115_0220381 3300048918 Bacteria 1565
492 Ga0496115_0386338 3300048918 Bacteria 1138
493 Ga0496115_1315614 3300048918 Bacteria 537
494 Ga0501034_0205276 3300049571 Bacteria 1927
495 Ga0501036_0381102 3300049572 Bacteria 1177
496 Ga0501040_1177537 3300049576 Bacteria 556
497 Ga0501048_0469596 3300049582 Bacteria 901
498 Ga0501067_0136595 3300049583 Bacteria 1365
499 Ga0501068_0000550 3300049584 Bacteria 19028
500 Ga0501068_0136481 3300049584 Bacteria 1536
501 Ga0501069_0000261 3300049585 Bacteria 23886
502 Ga0501069_0489970 3300049585 Bacteria 733
503 Ga0501070_0023647 3300049586 Bacteria 5148
504 Ga0501071_0117892 3300049587 Bacteria 1966
505 Ga0501075_0799411 3300049591 Bacteria 718
506 Ga0501076_0805075 3300049592 Bacteria 775
507 Ga0501077_0362185 3300049593 Bacteria 926
508 Ga0501079_0460430 3300049741 Bacteria 999
509 Ga0501080_0960164 3300049742 Bacteria 743
510 Ga0501081_0040720 3300049743 Bacteria 3181
511 Ga0501035_1460000 3300049822 Bacteria 523
512 Ga0501045_1400621 3300049824 Bacteria 508
513 nmdc:mga03683_100244_c1 3300050489 Bacteria 1272
514 nmdc:mga0yw44_389232_c1 3300050492 Bacteria 942
515 nmdc:mga0k408_160517_c1 3300050493 Bacteria 1339
516 nmdc:mga0qj67_474120_c1 3300050509 Bacteria 1007
517 nmdc:mga08y16_313025_c1 3300050511 Bacteria 1617
518 nmdc:mga0n895_1334_c1 3300050512 Bacteria 18282
519 nmdc:mga0n895_19850_c1 3300050512 Bacteria 6255
520 nmdc:mga0n895_764780_c1 3300050512 Bacteria 958
521 nmdc:mga0rr50_1039165_c1 3300050513 Unclassified 698
522 nmdc:mga0rr50_154805_c1 3300050513 Bacteria 1856
523 nmdc:mga0rr50_51388_c1 3300050513 Bacteria 3058
524 nmdc:mga08x19_23125_c1 3300050514 Bacteria 3855
525 nmdc:mga0a205_211575_c1 3300050515 Unclassified 740
526 nmdc:mga0a205_289715_c1 3300050515 Bacteria 1512
527 Ga0495601_0060840 3300053077 Bacteria 2396
528 Ga0495601_0084161 3300053077 Bacteria 2043
529 Ga0495601_0558199 3300053077 Unclassified 736
530 Ga0495601_1002352 3300053077 Bacteria 525
531 Ga0495612_0126422 3300053078 Bacteria 1102
532 Ga0495595_0006865 3300053084 Bacteria 4644
533 Ga0495595_0082358 3300053084 Bacteria 1535
534 Ga0495619_0087758 3300053085 Bacteria 2103
535 Ga0495619_0140350 3300053085 Bacteria 1664
536 Ga0495619_0320210 3300053085 Bacteria 1073
537 Ga0500641_0003465 3300053096 Bacteria 5578
538 Ga0466962_0013420 3300061719 Bacteria 3944
539 Ga0530510_0052208 3300061734 Bacteria 2954
540 Ga0530510_0053765 3300061734 Bacteria 2909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005544 Ga0070686_101915988 Ga0070686_1019159881 86
2 iso_pu_bacteria 2773857759 2774382999 86
3 3300005338 Ga0068868_102108992 Ga0068868_1021089921 88
4 3300005617 Ga0068859_100884878 Ga0068859_1008848782 88
5 3300006038 Ga0075365_10128010 Ga0075365_101280102 88
6 3300006852 Ga0075433_10284211 Ga0075433_102842113 88
7 3300006871 Ga0075434_100006313 Ga0075434_1000063137 88
8 3300006931 Ga0097620_100884812 Ga0097620_1008848122 88
9 3300007076 Ga0075435_100005187 Ga0075435_1000051879 88
10 3300009094 Ga0111539_12701016 Ga0111539_127010162 88
11 3300009147 Ga0114129_11270526 Ga0114129_112705262 88
12 3300014326 Ga0157380_13303346 Ga0157380_133033461 88
13 3300021377 Ga0213874_10239111 Ga0213874_102391112 88
14 3300026023 Ga0207677_11611351 Ga0207677_116113512 88
15 3300027907 Ga0207428_10733337 Ga0207428_107333373 88
16 3300028577 Ga0265318_10357673 Ga0265318_103576732 88
17 3300035171 Ga0373946_0406597 Ga0373946_0406597_126_392 88
18 3300035695 Ga0373927_0082991 Ga0373927_0082991_277_543 88
19 3300039437 Ga0436365_1271021 Ga0436365_1271021_1525_1791 88
20 3300039450 Ga0436363_0007682 Ga0436363_0007682_463_729 88
21 3300044656 Ga0466969_0296161 Ga0466969_0296161_418_684 88
22 3300044684 Ga0466966_0004486 Ga0466966_0004486_1628_1894 88
23 3300044684 Ga0466966_0059314 Ga0466966_0059314_1678_1944 88
24 3300044693 Ga0466961_0002730 Ga0466961_0002730_8977_9243 88
25 3300044694 Ga0466963_0003543 Ga0466963_0003543_577_843 88
26 3300044694 Ga0466963_0058878 Ga0466963_0058878_1624_1890 88
27 3300044694 Ga0466963_0289636 Ga0466963_0289636_701_967 88
28 3300044694 Ga0466963_0616524 Ga0466963_0616524_106_372 88
29 3300044694 Ga0466963_0687214 Ga0466963_0687214_133_399 88
30 3300044706 Ga0466964_0001685 Ga0466964_0001685_2909_3175 88
31 3300044706 Ga0466964_0008773 Ga0466964_0008773_237_503 88
32 3300044706 Ga0466964_0039600 Ga0466964_0039600_1126_1392 88
33 3300044706 Ga0466964_0293055 Ga0466964_0293055_469_735 88
34 3300044719 Ga0466971_0156503 Ga0466971_0156503_511_777 88
35 3300044735 Ga0466968_0001498 Ga0466968_0001498_663_929 88
36 3300044765 Ga0466970_0039835 Ga0466970_0039835_394_660 88
37 3300044842 Ga0466957_0781379 Ga0466957_0781379_378_644 88
38 3300045049 Ga0466959_0109225 Ga0466959_0109225_1457_1723 88
39 3300045049 Ga0466959_0537866 Ga0466959_0537866_343_609 88
40 3300045836 Ga0466958_0002290 Ga0466958_0002290_1539_1805 88
41 3300045836 Ga0466958_0007101 Ga0466958_0007101_5792_6058 88
42 3300045836 Ga0466958_0307139 Ga0466958_0307139_146_412 88
43 3300045836 Ga0466958_0439861 Ga0466958_0439861_567_833 88
44 3300045836 Ga0466958_0589720 Ga0466958_0589720_174_440 88
45 3300045976 Ga0466967_0001868 Ga0466967_0001868_2544_2810 88
46 3300045976 Ga0466967_0330414 Ga0466967_0330414_908_1174 88
47 3300045976 Ga0466967_0566843 Ga0466967_0566843_836_1102 88
48 3300045976 Ga0466967_1034840 Ga0466967_1034840_32_298 88
49 3300045976 Ga0466967_1705209 Ga0466967_1705209_99_365 88
50 3300046517 Ga0495630_0382118 Ga0495630_0382118_229_495 88
51 3300046533 Ga0495640_0834387 Ga0495640_0834387_112_378 88
52 3300048905 Ga0496102_0273770 Ga0496102_0273770_13_279 88
53 3300048907 Ga0496104_0071750 Ga0496104_0071750_642_908 88
54 3300048911 Ga0496108_1068978 Ga0496108_1068978_383_649 88
55 3300050512 nmdc:mga0n895_19850_c1 nmdc:mga0n895_19850_c1_2380_2646 88
56 3300050513 nmdc:mga0rr50_51388_c1 nmdc:mga0rr50_51388_c1_1369_1635 88
57 3300050515 nmdc:mga0a205_289715_c1 nmdc:mga0a205_289715_c1_1053_1319 88
58 3300061719 Ga0466962_0013420 Ga0466962_0013420_1211_1477 88
59 3300014745 Ga0157377_10670367 Ga0157377_106703671 89
60 3300017792 Ga0163161_11974680 Ga0163161_119746802 89
61 3300021441 Ga0213871_10023265 Ga0213871_100232652 89
62 3300025905 Ga0207685_10102665 Ga0207685_101026652 89
63 3300026075 Ga0207708_11691983 Ga0207708_116919832 89
64 3300031824 Ga0307413_10318792 Ga0307413_103187922 89
65 3300039438 Ga0436360_1218010 Ga0436360_1218010_1613_1882 89
66 3300044684 Ga0466966_0915453 Ga0466966_0915453_125_394 89
67 3300044719 Ga0466971_0164706 Ga0466971_0164706_567_836 89
68 3300044901 Ga0466960_0914994 Ga0466960_0914994_238_507 89
69 3300048916 Ga0496113_1548419 Ga0496113_1548419_184_453 89
70 3300048917 Ga0496114_0023239 Ga0496114_0023239_1682_1951 89
71 3300049576 Ga0501040_1177537 Ga0501040_1177537_274_543 89
72 iso_pu_bacteria 2887443736 2887445267 89
73 3300005366 Ga0070659_101597330 Ga0070659_1015973302 90
74 3300005471 Ga0070698_101270215 Ga0070698_1012702152 90
75 3300013105 Ga0157369_10320311 Ga0157369_103203112 90
76 3300031852 Ga0307410_11858405 Ga0307410_118584051 90
77 3300031901 Ga0307406_10065282 Ga0307406_100652823 90
78 3300031995 Ga0307409_100102095 Ga0307409_1001020953 90
79 3300037312 Ga0395899_0921214 Ga0395899_0921214_92_364 90
80 3300037418 Ga0395900_0167599 Ga0395900_0167599_166_438 90
81 3300037466 Ga0395898_0486964 Ga0395898_0486964_350_622 90
82 3300037466 Ga0395898_0871128 Ga0395898_0871128_30_302 90
83 3300037466 Ga0395898_1390213 Ga0395898_1390213_12_284 90
84 3300037471 Ga0395905_0353301 Ga0395905_0353301_890_1162 90
85 3300046516 Ga0495628_0395868 Ga0495628_0395868_336_608 90
86 3300047322 Ga0495680_0601438 Ga0495680_0601438_274_546 90
87 3300047444 Ga0495675_0673467 Ga0495675_0673467_57_329 90
88 3300048915 Ga0496112_0530778 Ga0496112_0530778_121_393 90
89 3300048916 Ga0496113_1362975 Ga0496113_1362975_20_292 90
90 3300049571 Ga0501034_0205276 Ga0501034_0205276_1305_1577 90
91 3300049583 Ga0501067_0136595 Ga0501067_0136595_828_1100 90
92 3300053096 Ga0500641_0003465 Ga0500641_0003465_897_1169 90
93 3300003203 JGI25406J46586_10057059 JGI25406J46586_100570592 91
94 3300005329 Ga0070683_100042259 Ga0070683_1000422592 91
95 3300005331 Ga0070670_101363156 Ga0070670_1013631562 91
96 3300005338 Ga0068868_100938831 Ga0068868_1009388312 91
97 3300005340 Ga0070689_100328759 Ga0070689_1003287592 91
98 3300005345 Ga0070692_10536475 Ga0070692_105364752 91
99 3300005345 Ga0070692_10760779 Ga0070692_107607791 91
100 3300005347 Ga0070668_101055254 Ga0070668_1010552542 91
101 3300005356 Ga0070674_100324731 Ga0070674_1003247312 91
102 3300005356 Ga0070674_101482757 Ga0070674_1014827572 91
103 3300005365 Ga0070688_100119814 Ga0070688_1001198141 91
104 3300005366 Ga0070659_101913298 Ga0070659_1019132981 91
105 3300005435 Ga0070714_100541955 Ga0070714_1005419552 91
106 3300005436 Ga0070713_100230851 Ga0070713_1002308513 91
107 3300005437 Ga0070710_10112834 Ga0070710_101128342 91
108 3300005438 Ga0070701_10283752 Ga0070701_102837522 91
109 3300005441 Ga0070700_100669079 Ga0070700_1006690792 91
110 3300005457 Ga0070662_101605896 Ga0070662_1016058962 91
111 3300005467 Ga0070706_101914860 Ga0070706_1019148601 91
112 3300005471 Ga0070698_100141589 Ga0070698_1001415893 91
113 3300005535 Ga0070684_100199473 Ga0070684_1001994733 91
114 3300005539 Ga0068853_100030908 Ga0068853_1000309082 91
115 3300005543 Ga0070672_102100002 Ga0070672_1021000022 91
116 3300005546 Ga0070696_101228115 Ga0070696_1012281152 91
117 3300005548 Ga0070665_102565836 Ga0070665_1025658362 91
118 3300005564 Ga0070664_100265845 Ga0070664_1002658452 91
119 3300005577 Ga0068857_100034823 Ga0068857_1000348234 91
120 3300005614 Ga0068856_100651355 Ga0068856_1006513552 91
121 3300005616 Ga0068852_100814081 Ga0068852_1008140812 91
122 3300005616 Ga0068852_100914624 Ga0068852_1009146242 91
123 3300005616 Ga0068852_101799960 Ga0068852_1017999601 91
124 3300005618 Ga0068864_100815244 Ga0068864_1008152442 91
125 3300005718 Ga0068866_10575145 Ga0068866_105751452 91
126 3300005840 Ga0068870_10353423 Ga0068870_103534232 91
127 3300005842 Ga0068858_100872606 Ga0068858_1008726062 91
128 3300005842 Ga0068858_102503557 Ga0068858_1025035572 91
129 3300005985 Ga0081539_10002150 Ga0081539_1000215023 91
130 3300005985 Ga0081539_10195150 Ga0081539_101951502 91
131 3300006844 Ga0075428_101004408 Ga0075428_1010044082 91
132 3300006881 Ga0068865_100230730 Ga0068865_1002307302 91
133 3300007788 Ga0099795_10437150 Ga0099795_104371501 91
134 3300009094 Ga0111539_10071796 Ga0111539_100717965 91
135 3300009094 Ga0111539_12617096 Ga0111539_126170962 91
136 3300009098 Ga0105245_10329144 Ga0105245_103291442 91
137 3300009098 Ga0105245_11683138 Ga0105245_116831383 91
138 3300009147 Ga0114129_10101632 Ga0114129_101016322 91
139 3300009174 Ga0105241_10644503 Ga0105241_106445032 91
140 3300009176 Ga0105242_12533343 Ga0105242_125333432 91
141 3300010375 Ga0105239_10003251 Ga0105239_1000325113 91
142 3300010375 Ga0105239_10868695 Ga0105239_108686952 91
143 3300013105 Ga0157369_12124527 Ga0157369_121245271 91
144 3300013296 Ga0157374_10021831 Ga0157374_1002183111 91
145 3300013307 Ga0157372_10401586 Ga0157372_104015863 91
146 3300014325 Ga0163163_11022722 Ga0163163_110227222 91
147 3300014745 Ga0157377_10358014 Ga0157377_103580141 91
148 3300025898 Ga0207692_10255529 Ga0207692_102555292 91
149 3300025899 Ga0207642_10623424 Ga0207642_106234242 91
150 3300025901 Ga0207688_10392626 Ga0207688_103926261 91
151 3300025908 Ga0207643_10084922 Ga0207643_100849223 91
152 3300025910 Ga0207684_11404422 Ga0207684_114044221 91
153 3300025911 Ga0207654_10910807 Ga0207654_109108071 91
154 3300025919 Ga0207657_11225544 Ga0207657_112255441 91
155 3300025920 Ga0207649_11356332 Ga0207649_113563321 91
156 3300025922 Ga0207646_10695860 Ga0207646_106958602 91
157 3300025927 Ga0207687_11841939 Ga0207687_118419391 91
158 3300025928 Ga0207700_10421943 Ga0207700_104219431 91
159 3300025929 Ga0207664_10726901 Ga0207664_107269012 91
160 3300025934 Ga0207686_10623185 Ga0207686_106231851 91
161 3300025937 Ga0207669_10581209 Ga0207669_105812092 91
162 3300025937 Ga0207669_10772154 Ga0207669_107721541 91
163 3300025938 Ga0207704_11029628 Ga0207704_110296282 91
164 3300025942 Ga0207689_10208081 Ga0207689_102080812 91
165 3300025944 Ga0207661_10816448 Ga0207661_108164482 91
166 3300025945 Ga0207679_10297107 Ga0207679_102971072 91
167 3300025981 Ga0207640_12035861 Ga0207640_120358611 91
168 3300026035 Ga0207703_11394231 Ga0207703_113942312 91
169 3300026067 Ga0207678_10412808 Ga0207678_104128082 91
170 3300026075 Ga0207708_10035751 Ga0207708_100357513 91
171 3300026075 Ga0207708_11505793 Ga0207708_115057932 91
172 3300026078 Ga0207702_11287347 Ga0207702_112873472 91
173 3300026095 Ga0207676_10942821 Ga0207676_109428212 91
174 3300026116 Ga0207674_10001018 Ga0207674_1000101838 91
175 3300026118 Ga0207675_102079195 Ga0207675_1020791952 91
176 3300027907 Ga0207428_11101913 Ga0207428_111019131 91
177 3300028379 Ga0268266_11956747 Ga0268266_119567472 91
178 3300028379 Ga0268266_12321045 Ga0268266_123210451 91
179 3300031251 Ga0265327_10124503 Ga0265327_101245033 91
180 3300035724 Ga0373933_0056851 Ga0373933_0056851_360_635 91
181 3300036401 Ga0373937_0057717 Ga0373937_0057717_1568_1843 91
182 3300037068 Ga0373925_0667056 Ga0373925_0667056_220_495 91
183 3300038443 Ga0395901_1829141 Ga0395901_1829141_29_304 91
184 3300039453 Ga0436362_0725924 Ga0436362_0725924_177_452 91
185 3300041456 Ga0451795_0203502 Ga0451795_0203502_60_335 91
186 3300041486 Ga0451807_1280054 Ga0451807_1280054_103_378 91
187 3300044706 Ga0466964_0616241 Ga0466964_0616241_222_497 91
188 3300044735 Ga0466968_0172129 Ga0466968_0172129_494_769 91
189 3300045976 Ga0466967_0046629 Ga0466967_0046629_1385_1660 91
190 3300045976 Ga0466967_0108965 Ga0466967_0108965_380_655 91
191 3300046455 Ga0495603_0284112 Ga0495603_0284112_177_452 91
192 3300046463 Ga0495653_0845642 Ga0495653_0845642_237_512 91
193 3300046517 Ga0495630_0055545 Ga0495630_0055545_2252_2527 91
194 3300046517 Ga0495630_0068661 Ga0495630_0068661_618_893 91
195 3300046535 Ga0495586_0005420 Ga0495586_0005420_4367_4642 91
196 3300046535 Ga0495586_0771596 Ga0495586_0771596_117_392 91
197 3300046543 Ga0495645_0654906 Ga0495645_0654906_122_397 91
198 3300046664 Ga0495659_0032632 Ga0495659_0032632_1082_1357 91
199 3300046683 Ga0495658_0239795 Ga0495658_0239795_21_302 91
200 3300046683 Ga0495658_0305184 Ga0495658_0305184_290_565 91
201 3300046689 Ga0495613_0265287 Ga0495613_0265287_646_921 91
202 3300047319 Ga0495674_0201439 Ga0495674_0201439_1007_1282 91
203 3300047319 Ga0495674_0820340 Ga0495674_0820340_390_665 91
204 3300047322 Ga0495680_0189738 Ga0495680_0189738_1120_1395 91
205 3300047444 Ga0495675_0071378 Ga0495675_0071378_1392_1667 91
206 3300048088 Ga0495602_0571174 Ga0495602_0571174_85_360 91
207 3300048903 Ga0496100_0103243 Ga0496100_0103243_903_1178 91
208 3300048903 Ga0496100_0361563 Ga0496100_0361563_544_819 91
209 3300048904 Ga0496101_0584248 Ga0496101_0584248_17_292 91
210 3300048904 Ga0496101_0731529 Ga0496101_0731529_106_381 91
211 3300048907 Ga0496104_1111628 Ga0496104_1111628_60_335 91
212 3300048909 Ga0496106_1294316 Ga0496106_1294316_103_378 91
213 3300048911 Ga0496108_0312340 Ga0496108_0312340_303_578 91
214 3300048912 Ga0496109_0487884 Ga0496109_0487884_315_590 91
215 3300048912 Ga0496109_0998291 Ga0496109_0998291_84_359 91
216 3300048915 Ga0496112_0003464 Ga0496112_0003464_5995_6270 91
217 3300048915 Ga0496112_0795205 Ga0496112_0795205_264_539 91
218 3300048915 Ga0496112_0862515 Ga0496112_0862515_534_809 91
219 3300048917 Ga0496114_0146884 Ga0496114_0146884_1590_1865 91
220 3300048917 Ga0496114_0222702 Ga0496114_0222702_1299_1574 91
221 3300048917 Ga0496114_0259524 Ga0496114_0259524_556_831 91
222 3300048918 Ga0496115_0053938 Ga0496115_0053938_1171_1446 91
223 3300048918 Ga0496115_0386338 Ga0496115_0386338_456_731 91
224 3300049572 Ga0501036_0381102 Ga0501036_0381102_634_909 91
225 3300049582 Ga0501048_0469596 Ga0501048_0469596_212_487 91
226 3300049584 Ga0501068_0136481 Ga0501068_0136481_794_1069 91
227 3300049585 Ga0501069_0489970 Ga0501069_0489970_281_556 91
228 3300049591 Ga0501075_0799411 Ga0501075_0799411_208_483 91
229 3300049592 Ga0501076_0805075 Ga0501076_0805075_381_656 91
230 3300049741 Ga0501079_0460430 Ga0501079_0460430_690_965 91
231 3300049742 Ga0501080_0960164 Ga0501080_0960164_44_319 91
232 3300049822 Ga0501035_1460000 Ga0501035_1460000_181_456 91
233 3300049824 Ga0501045_1400621 Ga0501045_1400621_203_478 91
234 3300050511 nmdc:mga08y16_313025_c1 nmdc:mga08y16_313025_c1_1205_1480 91
235 3300050512 nmdc:mga0n895_764780_c1 nmdc:mga0n895_764780_c1_56_331 91
236 3300050513 nmdc:mga0rr50_154805_c1 nmdc:mga0rr50_154805_c1_1064_1339 91
237 3300053077 Ga0495601_0084161 Ga0495601_0084161_215_490 91
238 3300053077 Ga0495601_0558199 Ga0495601_0558199_153_428 91
239 3300005339 Ga0070660_100917999 Ga0070660_1009179991 92
240 3300005435 Ga0070714_101845273 Ga0070714_1018452731 92
241 3300005436 Ga0070713_101055205 Ga0070713_1010552051 92
242 3300005445 Ga0070708_101165529 Ga0070708_1011655291 92
243 3300005467 Ga0070706_100398022 Ga0070706_1003980223 92
244 3300005544 Ga0070686_100658770 Ga0070686_1006587702 92
245 3300006028 Ga0070717_12038109 Ga0070717_120381091 92
246 3300009098 Ga0105245_13143907 Ga0105245_131439071 92
247 3300009176 Ga0105242_10069422 Ga0105242_100694223 92
248 3300025910 Ga0207684_10322805 Ga0207684_103228052 92
249 3300026078 Ga0207702_10305355 Ga0207702_103053552 92
250 3300028563 Ga0265319_1010138 Ga0265319_10101383 92
251 3300028563 Ga0265319_1013685 Ga0265319_10136853 92
252 3300028577 Ga0265318_10046383 Ga0265318_100463831 92
253 3300028800 Ga0265338_10118007 Ga0265338_101180075 92
254 3300029957 Ga0265324_10149267 Ga0265324_101492672 92
255 3300031239 Ga0265328_10239280 Ga0265328_102392802 92
256 3300031240 Ga0265320_10050042 Ga0265320_100500422 92
257 3300031240 Ga0265320_10341635 Ga0265320_103416352 92
258 3300046557 Ga0495622_0457976 Ga0495622_0457976_132_410 92
259 3300046559 Ga0495667_0704501 Ga0495667_0704501_37_315 92
260 3300046675 Ga0495657_0425631 Ga0495657_0425631_214_492 92
261 3300047317 Ga0495604_0542212 Ga0495604_0542212_337_615 92
262 3300049584 Ga0501068_0000550 Ga0501068_0000550_10239_10517 92
263 3300049585 Ga0501069_0000261 Ga0501069_0000261_18997_19275 92
264 3300049586 Ga0501070_0023647 Ga0501070_0023647_625_903 92
265 3300049587 Ga0501071_0117892 Ga0501071_0117892_1000_1278 92
266 3300049593 Ga0501077_0362185 Ga0501077_0362185_222_500 92
267 3300049743 Ga0501081_0040720 Ga0501081_0040720_1213_1491 92
268 3300053085 Ga0495619_0140350 Ga0495619_0140350_198_476 92
269 3300061734 Ga0530510_0053765 Ga0530510_0053765_83_361 92
270 3300002075 JGI24738J21930_10067934 JGI24738J21930_100679342 93
271 3300002459 JGI24751J29686_10037306 JGI24751J29686_100373062 93
272 3300005328 Ga0070676_10032239 Ga0070676_100322394 93
273 3300005329 Ga0070683_100297633 Ga0070683_1002976332 93
274 3300005329 Ga0070683_100754032 Ga0070683_1007540321 93
275 3300005331 Ga0070670_100409901 Ga0070670_1004099013 93
276 3300005335 Ga0070666_10533599 Ga0070666_105335992 93
277 3300005337 Ga0070682_100130254 Ga0070682_1001302543 93
278 3300005338 Ga0068868_100005695 Ga0068868_1000056956 93
279 3300005338 Ga0068868_100930139 Ga0068868_1009301391 93
280 3300005339 Ga0070660_100001771 Ga0070660_1000017714 93
281 3300005341 Ga0070691_10063005 Ga0070691_100630054 93
282 3300005343 Ga0070687_101267920 Ga0070687_1012679202 93
283 3300005354 Ga0070675_100524563 Ga0070675_1005245633 93
284 3300005355 Ga0070671_100291843 Ga0070671_1002918432 93
285 3300005356 Ga0070674_101062495 Ga0070674_1010624952 93
286 3300005365 Ga0070688_100454878 Ga0070688_1004548782 93
287 3300005366 Ga0070659_100031418 Ga0070659_1000314181 93
288 3300005367 Ga0070667_100309163 Ga0070667_1003091634 93
289 3300005435 Ga0070714_100169950 Ga0070714_1001699502 93
290 3300005436 Ga0070713_101180848 Ga0070713_1011808482 93
291 3300005437 Ga0070710_10500809 Ga0070710_105008092 93
292 3300005439 Ga0070711_100216803 Ga0070711_1002168032 93
293 3300005439 Ga0070711_100319693 Ga0070711_1003196932 93
294 3300005439 Ga0070711_101323581 Ga0070711_1013235812 93
295 3300005441 Ga0070700_100156797 Ga0070700_1001567974 93
296 3300005444 Ga0070694_100261933 Ga0070694_1002619332 93
297 3300005456 Ga0070678_100037838 Ga0070678_1000378385 93
298 3300005457 Ga0070662_100343769 Ga0070662_1003437691 93
299 3300005457 Ga0070662_100668854 Ga0070662_1006688542 93
300 3300005466 Ga0070685_10049684 Ga0070685_100496845 93
301 3300005466 Ga0070685_10638779 Ga0070685_106387792 93
302 3300005530 Ga0070679_101244215 Ga0070679_1012442152 93
303 3300005539 Ga0068853_100216604 Ga0068853_1002166043 93
304 3300005544 Ga0070686_100483738 Ga0070686_1004837382 93
305 3300005545 Ga0070695_101405336 Ga0070695_1014053362 93
306 3300005548 Ga0070665_100179203 Ga0070665_1001792032 93
307 3300005549 Ga0070704_100356712 Ga0070704_1003567121 93
308 3300005563 Ga0068855_100069956 Ga0068855_1000699562 93
309 3300005577 Ga0068857_100320319 Ga0068857_1003203193 93
310 3300005578 Ga0068854_100620944 Ga0068854_1006209443 93
311 3300005615 Ga0070702_100545166 Ga0070702_1005451661 93
312 3300005616 Ga0068852_100056540 Ga0068852_1000565404 93
313 3300005617 Ga0068859_100113683 Ga0068859_1001136832 93
314 3300005618 Ga0068864_100140609 Ga0068864_1001406094 93
315 3300005719 Ga0068861_100912484 Ga0068861_1009124842 93
316 3300005840 Ga0068870_10035197 Ga0068870_100351974 93
317 3300005841 Ga0068863_100856039 Ga0068863_1008560392 93
318 3300005842 Ga0068858_100025098 Ga0068858_1000250984 93
319 3300005843 Ga0068860_101627244 Ga0068860_1016272442 93
320 3300005844 Ga0068862_102404794 Ga0068862_1024047942 93
321 3300006028 Ga0070717_10006834 Ga0070717_1000683411 93
322 3300006028 Ga0070717_10043513 Ga0070717_100435133 93
323 3300006038 Ga0075365_10684873 Ga0075365_106848732 93
324 3300006038 Ga0075365_10734140 Ga0075365_107341402 93
325 3300006173 Ga0070716_100359349 Ga0070716_1003593492 93
326 3300006177 Ga0075362_10059361 Ga0075362_100593612 93
327 3300006186 Ga0075369_10108589 Ga0075369_101085892 93
328 3300006195 Ga0075366_10243904 Ga0075366_102439042 93
329 3300006237 Ga0097621_101046761 Ga0097621_1010467612 93
330 3300006852 Ga0075433_11358146 Ga0075433_113581461 93
331 3300006871 Ga0075434_100000189 Ga0075434_10000018914 93
332 3300006881 Ga0068865_100383075 Ga0068865_1003830751 93
333 3300006914 Ga0075436_100040261 Ga0075436_1000402614 93
334 3300006931 Ga0097620_100113680 Ga0097620_1001136802 93
335 3300007076 Ga0075435_100001011 Ga0075435_1000010117 93
336 3300009092 Ga0105250_10237254 Ga0105250_102372542 93
337 3300009093 Ga0105240_10091627 Ga0105240_100916274 93
338 3300009094 Ga0111539_11084439 Ga0111539_110844392 93
339 3300009098 Ga0105245_10012419 Ga0105245_1001241912 93
340 3300009098 Ga0105245_10153633 Ga0105245_101536334 93
341 3300009148 Ga0105243_10111085 Ga0105243_101110856 93
342 3300009176 Ga0105242_10621253 Ga0105242_106212532 93
343 3300009177 Ga0105248_10089873 Ga0105248_100898735 93
344 3300009551 Ga0105238_10006910 Ga0105238_100069104 93
345 3300009553 Ga0105249_10154311 Ga0105249_101543115 93
346 3300010375 Ga0105239_10742212 Ga0105239_107422122 93
347 3300011119 Ga0105246_10001045 Ga0105246_100010458 93
348 3300013102 Ga0157371_10399650 Ga0157371_103996502 93
349 3300013296 Ga0157374_10006009 Ga0157374_1000600916 93
350 3300013297 Ga0157378_10150876 Ga0157378_101508766 93
351 3300013306 Ga0163162_10584117 Ga0163162_105841173 93
352 3300013306 Ga0163162_11111538 Ga0163162_111115382 93
353 3300013308 Ga0157375_10077649 Ga0157375_100776494 93
354 3300014325 Ga0163163_10001642 Ga0163163_1000164211 93
355 3300014745 Ga0157377_10008393 Ga0157377_100083936 93
356 3300014968 Ga0157379_10030343 Ga0157379_100303432 93
357 3300014969 Ga0157376_11429265 Ga0157376_114292653 93
358 3300025898 Ga0207692_10188351 Ga0207692_101883512 93
359 3300025901 Ga0207688_10006244 Ga0207688_1000624411 93
360 3300025904 Ga0207647_10331495 Ga0207647_103314953 93
361 3300025906 Ga0207699_10097550 Ga0207699_100975502 93
362 3300025907 Ga0207645_10564360 Ga0207645_105643602 93
363 3300025908 Ga0207643_10025546 Ga0207643_100255464 93
364 3300025910 Ga0207684_10902855 Ga0207684_109028552 93
365 3300025913 Ga0207695_10193365 Ga0207695_101933651 93
366 3300025914 Ga0207671_11005587 Ga0207671_110055873 93
367 3300025917 Ga0207660_10809604 Ga0207660_108096042 93
368 3300025919 Ga0207657_10001049 Ga0207657_1000104926 93
369 3300025921 Ga0207652_10876877 Ga0207652_108768773 93
370 3300025924 Ga0207694_10039435 Ga0207694_100394356 93
371 3300025925 Ga0207650_10472213 Ga0207650_104722132 93
372 3300025926 Ga0207659_10305818 Ga0207659_103058182 93
373 3300025926 Ga0207659_10409199 Ga0207659_104091994 93
374 3300025927 Ga0207687_10020792 Ga0207687_100207922 93
375 3300025927 Ga0207687_10110524 Ga0207687_101105243 93
376 3300025928 Ga0207700_10037642 Ga0207700_100376424 93
377 3300025928 Ga0207700_11824688 Ga0207700_118246881 93
378 3300025929 Ga0207664_10095178 Ga0207664_100951785 93
379 3300025931 Ga0207644_10160317 Ga0207644_101603172 93
380 3300025932 Ga0207690_10028340 Ga0207690_100283401 93
381 3300025933 Ga0207706_10024837 Ga0207706_100248376 93
382 3300025935 Ga0207709_10317500 Ga0207709_103175002 93
383 3300025937 Ga0207669_10935066 Ga0207669_109350662 93
384 3300025938 Ga0207704_10051755 Ga0207704_100517556 93
385 3300025939 Ga0207665_10031459 Ga0207665_100314595 93
386 3300025940 Ga0207691_10220183 Ga0207691_102201833 93
387 3300025941 Ga0207711_10061669 Ga0207711_100616694 93
388 3300025944 Ga0207661_10065260 Ga0207661_100652604 93
389 3300025949 Ga0207667_10004544 Ga0207667_1000454421 93
390 3300025949 Ga0207667_11580857 Ga0207667_115808572 93
391 3300025960 Ga0207651_10363684 Ga0207651_103636842 93
392 3300025961 Ga0207712_10201098 Ga0207712_102010981 93
393 3300025981 Ga0207640_10206862 Ga0207640_102068622 93
394 3300026023 Ga0207677_10002013 Ga0207677_100020134 93
395 3300026035 Ga0207703_10307646 Ga0207703_103076462 93
396 3300026067 Ga0207678_10078179 Ga0207678_100781795 93
397 3300026075 Ga0207708_10151155 Ga0207708_101511552 93
398 3300026078 Ga0207702_10368648 Ga0207702_103686482 93
399 3300026088 Ga0207641_10300236 Ga0207641_103002362 93
400 3300026089 Ga0207648_12060660 Ga0207648_120606601 93
401 3300026095 Ga0207676_10124554 Ga0207676_101245544 93
402 3300026118 Ga0207675_100547777 Ga0207675_1005477773 93
403 3300026121 Ga0207683_10040124 Ga0207683_100401244 93
404 3300026142 Ga0207698_10069789 Ga0207698_100697892 93
405 3300028379 Ga0268266_10091270 Ga0268266_100912704 93
406 3300028380 Ga0268265_11495515 Ga0268265_114955151 93
407 3300028381 Ga0268264_10225292 Ga0268264_102252922 93
408 3300035083 Ga0373926_0080961 Ga0373926_0080961_807_1088 93
409 3300035086 Ga0373934_0034137 Ga0373934_0034137_737_1018 93
410 3300035086 Ga0373934_0196210 Ga0373934_0196210_151_432 93
411 3300035089 Ga0373944_0050110 Ga0373944_0050110_662_943 93
412 3300035090 Ga0373949_0019875 Ga0373949_0019875_1090_1371 93
413 3300035111 Ga0373923_0058336 Ga0373923_0058336_107_388 93
414 3300035116 Ga0373945_0005625 Ga0373945_0005625_2554_2835 93
415 3300035117 Ga0373953_0234024 Ga0373953_0234024_251_532 93
416 3300035119 Ga0373956_0152500 Ga0373956_0152500_736_1017 93
417 3300035119 Ga0373956_0361785 Ga0373956_0361785_353_634 93
418 3300035120 Ga0373957_0287264 Ga0373957_0287264_141_422 93
419 3300035170 Ga0373943_0015921 Ga0373943_0015921_2613_2894 93
420 3300035171 Ga0373946_0017134 Ga0373946_0017134_1077_1358 93
421 3300035410 Ga0373924_0019913 Ga0373924_0019913_811_1092 93
422 3300035410 Ga0373924_0464077 Ga0373924_0464077_30_311 93
423 3300035692 Ga0373935_0037167 Ga0373935_0037167_1102_1383 93
424 3300035695 Ga0373927_0268299 Ga0373927_0268299_390_671 93
425 3300035724 Ga0373933_0084793 Ga0373933_0084793_1251_1532 93
426 3300035724 Ga0373933_0729379 Ga0373933_0729379_129_410 93
427 3300035725 Ga0373947_0024767 Ga0373947_0024767_1485_1766 93
428 3300036401 Ga0373937_1223085 Ga0373937_1223085_14_295 93
429 3300036401 Ga0373937_1853928 Ga0373937_1853928_208_489 93
430 3300037068 Ga0373925_0027481 Ga0373925_0027481_2858_3139 93
431 3300041404 Ga0439436_0115998 Ga0439436_0115998_341_631 93
432 3300041512 Ga0451853_2207647 Ga0451853_2207647_517_807 93
433 3300045976 Ga0466967_0985996 Ga0466967_0985996_536_817 93
434 3300046454 Ga0495592_0046264 Ga0495592_0046264_1346_1627 93
435 3300046455 Ga0495603_0195724 Ga0495603_0195724_582_863 93
436 3300046459 Ga0495629_0035450 Ga0495629_0035450_477_758 93
437 3300046461 Ga0495641_0011902 Ga0495641_0011902_2670_2951 93
438 3300046462 Ga0495651_0036396 Ga0495651_0036396_2920_3201 93
439 3300046463 Ga0495653_0015711 Ga0495653_0015711_2654_2935 93
440 3300046472 Ga0495580_0048722 Ga0495580_0048722_2279_2560 93
441 3300046473 Ga0495582_0007720 Ga0495582_0007720_5061_5342 93
442 3300046475 Ga0495639_0013945 Ga0495639_0013945_707_988 93
443 3300046476 Ga0495662_0025456 Ga0495662_0025456_417_698 93
444 3300046511 Ga0495608_0030505 Ga0495608_0030505_1468_1749 93
445 3300046514 Ga0495618_0009858 Ga0495618_0009858_1022_1303 93
446 3300046516 Ga0495628_0514476 Ga0495628_0514476_523_804 93
447 3300046516 Ga0495628_0816953 Ga0495628_0816953_48_329 93
448 3300046517 Ga0495630_0029648 Ga0495630_0029648_2404_2685 93
449 3300046526 Ga0495666_0040911 Ga0495666_0040911_404_685 93
450 3300046531 Ga0495665_0011188 Ga0495665_0011188_695_976 93
451 3300046533 Ga0495640_0167234 Ga0495640_0167234_883_1164 93
452 3300046535 Ga0495586_0068558 Ga0495586_0068558_562_843 93
453 3300046536 Ga0495587_0500866 Ga0495587_0500866_121_402 93
454 3300046543 Ga0495645_0619252 Ga0495645_0619252_363_644 93
455 3300046559 Ga0495667_0035681 Ga0495667_0035681_2333_2614 93
456 3300046642 Ga0495634_0011405 Ga0495634_0011405_3845_4126 93
457 3300046674 Ga0495588_0016392 Ga0495588_0016392_750_1031 93
458 3300046675 Ga0495657_0007442 Ga0495657_0007442_911_1192 93
459 3300046675 Ga0495657_0197132 Ga0495657_0197132_250_531 93
460 3300046678 Ga0495599_0086832 Ga0495599_0086832_156_437 93
461 3300046679 Ga0495623_0650498 Ga0495623_0650498_141_422 93
462 3300046681 Ga0495647_0015941 Ga0495647_0015941_1446_1727 93
463 3300046683 Ga0495658_0020947 Ga0495658_0020947_2871_3152 93
464 3300046689 Ga0495613_0004045 Ga0495613_0004045_8020_8301 93
465 3300046690 Ga0495624_0012687 Ga0495624_0012687_3638_3919 93
466 3300046809 Ga0495600_0009594 Ga0495600_0009594_3546_3827 93
467 3300046809 Ga0495600_0366927 Ga0495600_0366927_429_710 93
468 3300047315 Ga0495581_0082196 Ga0495581_0082196_120_401 93
469 3300047317 Ga0495604_0136713 Ga0495604_0136713_499_780 93
470 3300047319 Ga0495674_0053428 Ga0495674_0053428_912_1193 93
471 3300047321 Ga0495676_0048546 Ga0495676_0048546_695_976 93
472 3300047322 Ga0495680_0083088 Ga0495680_0083088_1061_1342 93
473 3300047322 Ga0495680_0235028 Ga0495680_0235028_801_1082 93
474 3300047444 Ga0495675_0303209 Ga0495675_0303209_301_582 93
475 3300047471 Ga0495684_0017280 Ga0495684_0017280_539_820 93
476 3300047673 Ga0495593_0019599 Ga0495593_0019599_2803_3084 93
477 3300048088 Ga0495602_0072760 Ga0495602_0072760_1269_1550 93
478 3300048089 Ga0495614_0011246 Ga0495614_0011246_1266_1547 93
479 3300048903 Ga0496100_0005810 Ga0496100_0005810_1657_1938 93
480 3300048903 Ga0496100_0021504 Ga0496100_0021504_2379_2660 93
481 3300048903 Ga0496100_0295868 Ga0496100_0295868_695_976 93
482 3300048903 Ga0496100_0846907 Ga0496100_0846907_100_381 93
483 3300048904 Ga0496101_0013420 Ga0496101_0013420_640_921 93
484 3300048904 Ga0496101_0028001 Ga0496101_0028001_2122_2403 93
485 3300048904 Ga0496101_0112882 Ga0496101_0112882_720_1001 93
486 3300048904 Ga0496101_0532737 Ga0496101_0532737_578_859 93
487 3300048905 Ga0496102_0003029 Ga0496102_0003029_4443_4724 93
488 3300048905 Ga0496102_0072734 Ga0496102_0072734_273_554 93
489 3300048905 Ga0496102_0274712 Ga0496102_0274712_1175_1456 93
490 3300048905 Ga0496102_1118540 Ga0496102_1118540_109_390 93
491 3300048906 Ga0496103_0149374 Ga0496103_0149374_268_549 93
492 3300048906 Ga0496103_0199016 Ga0496103_0199016_965_1246 93
493 3300048907 Ga0496104_0028744 Ga0496104_0028744_3099_3380 93
494 3300048907 Ga0496104_0038116 Ga0496104_0038116_3560_3841 93
495 3300048908 Ga0496105_0015043 Ga0496105_0015043_4431_4712 93
496 3300048908 Ga0496105_0295849 Ga0496105_0295849_460_741 93
497 3300048908 Ga0496105_0766906 Ga0496105_0766906_398_679 93
498 3300048909 Ga0496106_0036562 Ga0496106_0036562_1022_1303 93
499 3300048909 Ga0496106_0067259 Ga0496106_0067259_1327_1608 93
500 3300048909 Ga0496106_0112792 Ga0496106_0112792_1219_1500 93
501 3300048910 Ga0496107_0001433 Ga0496107_0001433_8275_8556 93
502 3300048910 Ga0496107_0165125 Ga0496107_0165125_1336_1617 93
503 3300048910 Ga0496107_0230152 Ga0496107_0230152_305_586 93
504 3300048911 Ga0496108_0003468 Ga0496108_0003468_918_1199 93
505 3300048911 Ga0496108_0020348 Ga0496108_0020348_4466_4747 93
506 3300048911 Ga0496108_0334146 Ga0496108_0334146_321_602 93
507 3300048912 Ga0496109_0001431 Ga0496109_0001431_708_989 93
508 3300048912 Ga0496109_0012514 Ga0496109_0012514_5400_5681 93
509 3300048912 Ga0496109_0375688 Ga0496109_0375688_720_1001 93
510 3300048913 Ga0496110_0000626 Ga0496110_0000626_18526_18807 93
511 3300048913 Ga0496110_0007505 Ga0496110_0007505_2897_3178 93
512 3300048913 Ga0496110_1657796 Ga0496110_1657796_244_525 93
513 3300048914 Ga0496111_0002176 Ga0496111_0002176_391_672 93
514 3300048914 Ga0496111_0121089 Ga0496111_0121089_854_1135 93
515 3300048915 Ga0496112_0004855 Ga0496112_0004855_11083_11364 93
516 3300048915 Ga0496112_0006081 Ga0496112_0006081_9168_9449 93
517 3300048915 Ga0496112_0650457 Ga0496112_0650457_342_632 93
518 3300048915 Ga0496112_0700620 Ga0496112_0700620_581_862 93
519 3300048916 Ga0496113_0000221 Ga0496113_0000221_17251_17532 93
520 3300048916 Ga0496113_0008913 Ga0496113_0008913_1485_1766 93
521 3300048917 Ga0496114_0016746 Ga0496114_0016746_4630_4911 93
522 3300048917 Ga0496114_0134835 Ga0496114_0134835_367_648 93
523 3300048917 Ga0496114_0287007 Ga0496114_0287007_243_524 93
524 3300048918 Ga0496115_0109191 Ga0496115_0109191_1188_1469 93
525 3300048918 Ga0496115_0220381 Ga0496115_0220381_647_928 93
526 3300048918 Ga0496115_1315614 Ga0496115_1315614_136_417 93
527 3300050489 nmdc:mga03683_100244_c1 nmdc:mga03683_100244_c1_112_402 93
528 3300050492 nmdc:mga0yw44_389232_c1 nmdc:mga0yw44_389232_c1_198_488 93
529 3300050493 nmdc:mga0k408_160517_c1 nmdc:mga0k408_160517_c1_556_846 93
530 3300050509 nmdc:mga0qj67_474120_c1 nmdc:mga0qj67_474120_c1_380_670 93
531 3300050512 nmdc:mga0n895_1334_c1 nmdc:mga0n895_1334_c1_2861_3142 93
532 3300050513 nmdc:mga0rr50_1039165_c1 nmdc:mga0rr50_1039165_c1_133_414 93
533 3300050514 nmdc:mga08x19_23125_c1 nmdc:mga08x19_23125_c1_2179_2460 93
534 3300050515 nmdc:mga0a205_211575_c1 nmdc:mga0a205_211575_c1_176_457 93
535 3300053077 Ga0495601_0060840 Ga0495601_0060840_1267_1548 93
536 3300053077 Ga0495601_1002352 Ga0495601_1002352_20_301 93
537 3300053078 Ga0495612_0126422 Ga0495612_0126422_133_414 93
538 3300053084 Ga0495595_0006865 Ga0495595_0006865_2206_2487 93
539 3300053084 Ga0495595_0082358 Ga0495595_0082358_1120_1401 93
540 3300053085 Ga0495619_0087758 Ga0495619_0087758_1346_1627 93
541 3300053085 Ga0495619_0320210 Ga0495619_0320210_358_639 93
542 3300061734 Ga0530510_0052208 Ga0530510_0052208_2299_2586 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

13

90

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hia-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides lov protein 0.5524 17 59
2isv-assembly1.cif.gz_B structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate 0.5495 17 55
3gay-assembly1.cif.gz_B structure of giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate 0.5495 17 55
2isv-assembly1.cif.gz_A structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate 0.541 17 56
5ey7-assembly1.cif.gz_B crystal structure of fructokinase from vibrio cholerae o395 in apo form 0.5361 17 58
ID Description Score Start End Superfamily
af_Q94255_26_115_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.6304 17 67 1.10.225.10
af_P26616_269_564_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6285 13 67 3.40.50.720
af_Q9URY3_323_468_1.10.472.80 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Ypt/Rab-GAP domain of gyp1p, domain 3 0.6257 14 67 1.10.472.80
3zyvC05 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.6011 16 62 3.30.390.50
af_Q8VY78_1_318_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.5686 15 57 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A212T3K0-F1-model_v4 deleted 0.9883 16 67
AF-A0A841AF04-F1-model_v4 DUF2277 domain-containing protein 0.9873 1 72
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 0.987 1 70
AF-A0A387HH46-F1-model_v4 DUF2277 domain-containing protein 0.9845 16 67
AF-A0A536H2R0-F1-model_v4 DUF2277 domain-containing protein 0.9827 1 88

Feature Viewer

pLDDT pTM Quality
91.19 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map