F461451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 308 | 540 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100754032|Ga0070683_1007540321 |
| Length | 108 |
| Sequence | LSARPELGYLARMCRNIRTLYNFDPPTSSDEVHEAALQYVRKVSGMNKPSRANQEVFDRAVHEIAHLTEHLLADLVTTAPPRDREVEAEKARARSALRFARPSGSSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 2 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 105 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 201 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 307 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.63 |
| Metatranscriptomes | 0 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 13.65 |
| Rhizosphere | 83.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10067934 | 3300002075 | Bacteria | 736 |
| 2 | JGI24751J29686_10037306 | 3300002459 | Bacteria | 1006 |
| 3 | JGI25406J46586_10057059 | 3300003203 | Bacteria | 1278 |
| 4 | Ga0070676_10032239 | 3300005328 | Bacteria | 3001 |
| 5 | Ga0070683_100042259 | 3300005329 | Bacteria | 4197 |
| 6 | Ga0070683_100297633 | 3300005329 | Bacteria | 1535 |
| 7 | Ga0070683_100754032 | 3300005329 | Bacteria | 933 |
| 8 | Ga0070670_100409901 | 3300005331 | Bacteria | 1197 |
| 9 | Ga0070670_101363156 | 3300005331 | Bacteria | 650 |
| 10 | Ga0070666_10533599 | 3300005335 | Bacteria | 853 |
| 11 | Ga0070682_100130254 | 3300005337 | Bacteria | 1702 |
| 12 | Ga0068868_100005695 | 3300005338 | Bacteria | 8770 |
| 13 | Ga0068868_100930139 | 3300005338 | Bacteria | 792 |
| 14 | Ga0068868_100938831 | 3300005338 | Bacteria | 788 |
| 15 | Ga0068868_102108992 | 3300005338 | Bacteria | 536 |
| 16 | Ga0070660_100001771 | 3300005339 | Bacteria | 14831 |
| 17 | Ga0070660_100917999 | 3300005339 | Bacteria | 738 |
| 18 | Ga0070689_100328759 | 3300005340 | Bacteria | 1278 |
| 19 | Ga0070691_10063005 | 3300005341 | Bacteria | 1787 |
| 20 | Ga0070687_101267920 | 3300005343 | Bacteria | 546 |
| 21 | Ga0070692_10536475 | 3300005345 | Bacteria | 764 |
| 22 | Ga0070692_10760779 | 3300005345 | Bacteria | 658 |
| 23 | Ga0070668_101055254 | 3300005347 | Bacteria | 732 |
| 24 | Ga0070675_100524563 | 3300005354 | Bacteria | 1069 |
| 25 | Ga0070671_100291843 | 3300005355 | Bacteria | 1388 |
| 26 | Ga0070674_100324731 | 3300005356 | Bacteria | 1235 |
| 27 | Ga0070674_101062495 | 3300005356 | Bacteria | 713 |
| 28 | Ga0070674_101482757 | 3300005356 | Bacteria | 609 |
| 29 | Ga0070688_100119814 | 3300005365 | Bacteria | 1761 |
| 30 | Ga0070688_100454878 | 3300005365 | Bacteria | 958 |
| 31 | Ga0070659_100031418 | 3300005366 | Bacteria | 4112 |
| 32 | Ga0070659_101597330 | 3300005366 | Bacteria | 582 |
| 33 | Ga0070659_101913298 | 3300005366 | Bacteria | 532 |
| 34 | Ga0070667_100309163 | 3300005367 | Bacteria | 1424 |
| 35 | Ga0070714_100169950 | 3300005435 | Bacteria | 1978 |
| 36 | Ga0070714_100541955 | 3300005435 | Bacteria | 1113 |
| 37 | Ga0070714_101845273 | 3300005435 | Unclassified | 590 |
| 38 | Ga0070713_100230851 | 3300005436 | Bacteria | 1682 |
| 39 | Ga0070713_101055205 | 3300005436 | Bacteria | 785 |
| 40 | Ga0070713_101180848 | 3300005436 | Bacteria | 741 |
| 41 | Ga0070710_10112834 | 3300005437 | Bacteria | 1635 |
| 42 | Ga0070710_10500809 | 3300005437 | Bacteria | 831 |
| 43 | Ga0070701_10283752 | 3300005438 | Bacteria | 1012 |
| 44 | Ga0070711_100216803 | 3300005439 | Bacteria | 1485 |
| 45 | Ga0070711_100319693 | 3300005439 | Bacteria | 1240 |
| 46 | Ga0070711_101323581 | 3300005439 | Bacteria | 625 |
| 47 | Ga0070700_100156797 | 3300005441 | Bacteria | 1563 |
| 48 | Ga0070700_100669079 | 3300005441 | Bacteria | 822 |
| 49 | Ga0070694_100261933 | 3300005444 | Bacteria | 1312 |
| 50 | Ga0070708_101165529 | 3300005445 | Bacteria | 721 |
| 51 | Ga0070678_100037838 | 3300005456 | Bacteria | 3392 |
| 52 | Ga0070662_100343769 | 3300005457 | Bacteria | 1221 |
| 53 | Ga0070662_100668854 | 3300005457 | Bacteria | 877 |
| 54 | Ga0070662_101605896 | 3300005457 | Bacteria | 561 |
| 55 | Ga0070685_10049684 | 3300005466 | Bacteria | 2420 |
| 56 | Ga0070685_10638779 | 3300005466 | Bacteria | 770 |
| 57 | Ga0070706_100398022 | 3300005467 | Bacteria | 1282 |
| 58 | Ga0070706_101914860 | 3300005467 | Bacteria | 538 |
| 59 | Ga0070698_100141589 | 3300005471 | Bacteria | 2356 |
| 60 | Ga0070698_101270215 | 3300005471 | Bacteria | 686 |
| 61 | Ga0070679_101244215 | 3300005530 | Bacteria | 690 |
| 62 | Ga0070684_100199473 | 3300005535 | Bacteria | 1822 |
| 63 | Ga0068853_100030908 | 3300005539 | Bacteria | 4526 |
| 64 | Ga0068853_100216604 | 3300005539 | Bacteria | 1747 |
| 65 | Ga0070672_102100002 | 3300005543 | Bacteria | 509 |
| 66 | Ga0070686_100483738 | 3300005544 | Bacteria | 958 |
| 67 | Ga0070686_100658770 | 3300005544 | Bacteria | 831 |
| 68 | Ga0070686_101915988 | 3300005544 | Bacteria | 506 |
| 69 | Ga0070695_101405336 | 3300005545 | Bacteria | 579 |
| 70 | Ga0070696_101228115 | 3300005546 | Bacteria | 634 |
| 71 | Ga0070665_100179203 | 3300005548 | Bacteria | 2120 |
| 72 | Ga0070665_102565836 | 3300005548 | Bacteria | 511 |
| 73 | Ga0070704_100356712 | 3300005549 | Bacteria | 1236 |
| 74 | Ga0068855_100069956 | 3300005563 | Bacteria | 4083 |
| 75 | Ga0070664_100265845 | 3300005564 | Bacteria | 1544 |
| 76 | Ga0068857_100034823 | 3300005577 | Bacteria | 4455 |
| 77 | Ga0068857_100320319 | 3300005577 | Bacteria | 1432 |
| 78 | Ga0068854_100620944 | 3300005578 | Bacteria | 925 |
| 79 | Ga0068856_100651355 | 3300005614 | Bacteria | 1074 |
| 80 | Ga0070702_100545166 | 3300005615 | Bacteria | 860 |
| 81 | Ga0068852_100056540 | 3300005616 | Bacteria | 3391 |
| 82 | Ga0068852_100814081 | 3300005616 | Unclassified | 948 |
| 83 | Ga0068852_100914624 | 3300005616 | Unclassified | 895 |
| 84 | Ga0068852_101799960 | 3300005616 | Bacteria | 635 |
| 85 | Ga0068859_100113683 | 3300005617 | Bacteria | 2771 |
| 86 | Ga0068859_100884878 | 3300005617 | Unclassified | 978 |
| 87 | Ga0068864_100140609 | 3300005618 | Bacteria | 2177 |
| 88 | Ga0068864_100815244 | 3300005618 | Bacteria | 918 |
| 89 | Ga0068866_10575145 | 3300005718 | Bacteria | 757 |
| 90 | Ga0068861_100912484 | 3300005719 | Bacteria | 833 |
| 91 | Ga0068870_10035197 | 3300005840 | Bacteria | 2568 |
| 92 | Ga0068870_10353423 | 3300005840 | Bacteria | 944 |
| 93 | Ga0068863_100856039 | 3300005841 | Bacteria | 908 |
| 94 | Ga0068858_100025098 | 3300005842 | Bacteria | 5547 |
| 95 | Ga0068858_100872606 | 3300005842 | Bacteria | 879 |
| 96 | Ga0068858_102503557 | 3300005842 | Bacteria | 510 |
| 97 | Ga0068860_101627244 | 3300005843 | Bacteria | 668 |
| 98 | Ga0068862_102404794 | 3300005844 | Bacteria | 539 |
| 99 | Ga0081539_10002150 | 3300005985 | Bacteria | 29119 |
| 100 | Ga0081539_10195150 | 3300005985 | Bacteria | 939 |
| 101 | Ga0070717_10006834 | 3300006028 | Bacteria | 8418 |
| 102 | Ga0070717_10043513 | 3300006028 | Bacteria | 3666 |
| 103 | Ga0070717_12038109 | 3300006028 | Bacteria | 517 |
| 104 | Ga0075365_10128010 | 3300006038 | Bacteria | 1756 |
| 105 | Ga0075365_10684873 | 3300006038 | Bacteria | 724 |
| 106 | Ga0075365_10734140 | 3300006038 | Bacteria | 697 |
| 107 | Ga0070716_100359349 | 3300006173 | Bacteria | 1034 |
| 108 | Ga0075362_10059361 | 3300006177 | Bacteria | 1727 |
| 109 | Ga0075369_10108589 | 3300006186 | Bacteria | 1250 |
| 110 | Ga0075366_10243904 | 3300006195 | Bacteria | 1095 |
| 111 | Ga0097621_101046761 | 3300006237 | Bacteria | 765 |
| 112 | Ga0075428_101004408 | 3300006844 | Bacteria | 883 |
| 113 | Ga0075433_10284211 | 3300006852 | Bacteria | 1465 |
| 114 | Ga0075433_11358146 | 3300006852 | Bacteria | 615 |
| 115 | Ga0075434_100000189 | 3300006871 | Bacteria | 40699 |
| 116 | Ga0075434_100006313 | 3300006871 | Bacteria | 10864 |
| 117 | Ga0068865_100230730 | 3300006881 | Bacteria | 1452 |
| 118 | Ga0068865_100383075 | 3300006881 | Bacteria | 1147 |
| 119 | Ga0075436_100040261 | 3300006914 | Bacteria | 3225 |
| 120 | Ga0097620_100113680 | 3300006931 | Bacteria | 2771 |
| 121 | Ga0097620_100884812 | 3300006931 | Unclassified | 978 |
| 122 | Ga0075435_100001011 | 3300007076 | Bacteria | 17837 |
| 123 | Ga0075435_100005187 | 3300007076 | Bacteria | 9062 |
| 124 | Ga0099795_10437150 | 3300007788 | Bacteria | 600 |
| 125 | Ga0105250_10237254 | 3300009092 | Bacteria | 777 |
| 126 | Ga0105240_10091627 | 3300009093 | Bacteria | 3713 |
| 127 | Ga0111539_10071796 | 3300009094 | Bacteria | 4084 |
| 128 | Ga0111539_11084439 | 3300009094 | Bacteria | 931 |
| 129 | Ga0111539_12617096 | 3300009094 | Bacteria | 585 |
| 130 | Ga0111539_12701016 | 3300009094 | Bacteria | 575 |
| 131 | Ga0105245_10012419 | 3300009098 | Bacteria | 7412 |
| 132 | Ga0105245_10153633 | 3300009098 | Bacteria | 2178 |
| 133 | Ga0105245_10329144 | 3300009098 | Bacteria | 1507 |
| 134 | Ga0105245_11683138 | 3300009098 | Bacteria | 687 |
| 135 | Ga0105245_13143907 | 3300009098 | Bacteria | 512 |
| 136 | Ga0114129_10101632 | 3300009147 | Bacteria | 3978 |
| 137 | Ga0114129_11270526 | 3300009147 | Bacteria | 914 |
| 138 | Ga0105243_10111085 | 3300009148 | Bacteria | 2294 |
| 139 | Ga0105241_10644503 | 3300009174 | Unclassified | 961 |
| 140 | Ga0105242_10069422 | 3300009176 | Bacteria | 2918 |
| 141 | Ga0105242_10621253 | 3300009176 | Bacteria | 1047 |
| 142 | Ga0105242_12533343 | 3300009176 | Bacteria | 561 |
| 143 | Ga0105248_10089873 | 3300009177 | Bacteria | 3458 |
| 144 | Ga0105238_10006910 | 3300009551 | Bacteria | 11335 |
| 145 | Ga0105249_10154311 | 3300009553 | Bacteria | 2213 |
| 146 | Ga0105239_10003251 | 3300010375 | Bacteria | 20061 |
| 147 | Ga0105239_10742212 | 3300010375 | Bacteria | 1123 |
| 148 | Ga0105239_10868695 | 3300010375 | Bacteria | 1035 |
| 149 | Ga0105246_10001045 | 3300011119 | Bacteria | 15971 |
| 150 | Ga0157371_10399650 | 3300013102 | Bacteria | 1005 |
| 151 | Ga0157369_10320311 | 3300013105 | Bacteria | 1612 |
| 152 | Ga0157369_12124527 | 3300013105 | Bacteria | 569 |
| 153 | Ga0157374_10006009 | 3300013296 | Bacteria | 10274 |
| 154 | Ga0157374_10021831 | 3300013296 | Bacteria | 5703 |
| 155 | Ga0157378_10150876 | 3300013297 | Bacteria | 2165 |
| 156 | Ga0163162_10584117 | 3300013306 | Bacteria | 1244 |
| 157 | Ga0163162_11111538 | 3300013306 | Bacteria | 896 |
| 158 | Ga0157372_10401586 | 3300013307 | Bacteria | 1597 |
| 159 | Ga0157375_10077649 | 3300013308 | Bacteria | 3351 |
| 160 | Ga0163163_10001642 | 3300014325 | Bacteria | 18835 |
| 161 | Ga0163163_11022722 | 3300014325 | Bacteria | 890 |
| 162 | Ga0157380_13303346 | 3300014326 | Unclassified | 516 |
| 163 | Ga0157377_10008393 | 3300014745 | Bacteria | 5037 |
| 164 | Ga0157377_10358014 | 3300014745 | Bacteria | 981 |
| 165 | Ga0157377_10670367 | 3300014745 | Bacteria | 749 |
| 166 | Ga0157379_10030343 | 3300014968 | Bacteria | 4812 |
| 167 | Ga0157376_11429265 | 3300014969 | Bacteria | 724 |
| 168 | Ga0163161_11974680 | 3300017792 | Bacteria | 519 |
| 169 | Ga0213874_10239111 | 3300021377 | Bacteria | 666 |
| 170 | Ga0213871_10023265 | 3300021441 | Bacteria | 1559 |
| 171 | Ga0207692_10188351 | 3300025898 | Bacteria | 1206 |
| 172 | Ga0207692_10255529 | 3300025898 | Bacteria | 1052 |
| 173 | Ga0207642_10623424 | 3300025899 | Bacteria | 673 |
| 174 | Ga0207688_10006244 | 3300025901 | Bacteria | 6484 |
| 175 | Ga0207688_10392626 | 3300025901 | Bacteria | 860 |
| 176 | Ga0207647_10331495 | 3300025904 | Bacteria | 863 |
| 177 | Ga0207685_10102665 | 3300025905 | Bacteria | 1225 |
| 178 | Ga0207699_10097550 | 3300025906 | Bacteria | 1858 |
| 179 | Ga0207645_10564360 | 3300025907 | Bacteria | 772 |
| 180 | Ga0207643_10025546 | 3300025908 | Bacteria | 3265 |
| 181 | Ga0207643_10084922 | 3300025908 | Bacteria | 1838 |
| 182 | Ga0207684_10322805 | 3300025910 | Bacteria | 1331 |
| 183 | Ga0207684_10902855 | 3300025910 | Bacteria | 743 |
| 184 | Ga0207684_11404422 | 3300025910 | Bacteria | 571 |
| 185 | Ga0207654_10910807 | 3300025911 | Unclassified | 638 |
| 186 | Ga0207695_10193365 | 3300025913 | Bacteria | 1951 |
| 187 | Ga0207671_11005587 | 3300025914 | Bacteria | 657 |
| 188 | Ga0207660_10809604 | 3300025917 | Unclassified | 764 |
| 189 | Ga0207657_10001049 | 3300025919 | Bacteria | 29285 |
| 190 | Ga0207657_11225544 | 3300025919 | Bacteria | 569 |
| 191 | Ga0207649_11356332 | 3300025920 | Bacteria | 563 |
| 192 | Ga0207652_10876877 | 3300025921 | Bacteria | 794 |
| 193 | Ga0207646_10695860 | 3300025922 | Bacteria | 909 |
| 194 | Ga0207694_10039435 | 3300025924 | Bacteria | 3635 |
| 195 | Ga0207650_10472213 | 3300025925 | Bacteria | 1046 |
| 196 | Ga0207659_10305818 | 3300025926 | Bacteria | 1307 |
| 197 | Ga0207659_10409199 | 3300025926 | Bacteria | 1136 |
| 198 | Ga0207687_10020792 | 3300025927 | Bacteria | 4355 |
| 199 | Ga0207687_10110524 | 3300025927 | Bacteria | 2038 |
| 200 | Ga0207687_11841939 | 3300025927 | Bacteria | 518 |
| 201 | Ga0207700_10037642 | 3300025928 | Bacteria | 3505 |
| 202 | Ga0207700_10421943 | 3300025928 | Bacteria | 1172 |
| 203 | Ga0207700_11824688 | 3300025928 | Bacteria | 534 |
| 204 | Ga0207664_10095178 | 3300025929 | Bacteria | 2449 |
| 205 | Ga0207664_10726901 | 3300025929 | Bacteria | 893 |
| 206 | Ga0207644_10160317 | 3300025931 | Bacteria | 1748 |
| 207 | Ga0207690_10028340 | 3300025932 | Bacteria | 3550 |
| 208 | Ga0207706_10024837 | 3300025933 | Bacteria | 5371 |
| 209 | Ga0207686_10623185 | 3300025934 | Bacteria | 851 |
| 210 | Ga0207709_10317500 | 3300025935 | Bacteria | 1165 |
| 211 | Ga0207669_10581209 | 3300025937 | Bacteria | 908 |
| 212 | Ga0207669_10772154 | 3300025937 | Bacteria | 795 |
| 213 | Ga0207669_10935066 | 3300025937 | Bacteria | 726 |
| 214 | Ga0207704_10051755 | 3300025938 | Bacteria | 2486 |
| 215 | Ga0207704_11029628 | 3300025938 | Bacteria | 697 |
| 216 | Ga0207665_10031459 | 3300025939 | Bacteria | 3511 |
| 217 | Ga0207691_10220183 | 3300025940 | Bacteria | 1646 |
| 218 | Ga0207711_10061669 | 3300025941 | Bacteria | 3234 |
| 219 | Ga0207689_10208081 | 3300025942 | Bacteria | 1616 |
| 220 | Ga0207661_10065260 | 3300025944 | Bacteria | 2955 |
| 221 | Ga0207661_10816448 | 3300025944 | Unclassified | 859 |
| 222 | Ga0207679_10297107 | 3300025945 | Bacteria | 1391 |
| 223 | Ga0207667_10004544 | 3300025949 | Bacteria | 17001 |
| 224 | Ga0207667_11580857 | 3300025949 | Bacteria | 625 |
| 225 | Ga0207651_10363684 | 3300025960 | Bacteria | 1222 |
| 226 | Ga0207712_10201098 | 3300025961 | Bacteria | 1580 |
| 227 | Ga0207640_10206862 | 3300025981 | Bacteria | 1492 |
| 228 | Ga0207640_12035861 | 3300025981 | Bacteria | 520 |
| 229 | Ga0207677_10002013 | 3300026023 | Bacteria | 10722 |
| 230 | Ga0207677_11611351 | 3300026023 | Bacteria | 601 |
| 231 | Ga0207703_10307646 | 3300026035 | Bacteria | 1447 |
| 232 | Ga0207703_11394231 | 3300026035 | Bacteria | 674 |
| 233 | Ga0207678_10078179 | 3300026067 | Bacteria | 2833 |
| 234 | Ga0207678_10412808 | 3300026067 | Bacteria | 1170 |
| 235 | Ga0207708_10035751 | 3300026075 | Bacteria | 3780 |
| 236 | Ga0207708_10151155 | 3300026075 | Bacteria | 1828 |
| 237 | Ga0207708_11505793 | 3300026075 | Bacteria | 591 |
| 238 | Ga0207708_11691983 | 3300026075 | Bacteria | 556 |
| 239 | Ga0207702_10305355 | 3300026078 | Bacteria | 1511 |
| 240 | Ga0207702_10368648 | 3300026078 | Bacteria | 1378 |
| 241 | Ga0207702_11287347 | 3300026078 | Bacteria | 725 |
| 242 | Ga0207641_10300236 | 3300026088 | Bacteria | 1517 |
| 243 | Ga0207648_12060660 | 3300026089 | Bacteria | 532 |
| 244 | Ga0207676_10124554 | 3300026095 | Bacteria | 2180 |
| 245 | Ga0207676_10942821 | 3300026095 | Bacteria | 848 |
| 246 | Ga0207674_10001018 | 3300026116 | Bacteria | 36636 |
| 247 | Ga0207675_100547777 | 3300026118 | Bacteria | 1156 |
| 248 | Ga0207675_102079195 | 3300026118 | Bacteria | 585 |
| 249 | Ga0207683_10040124 | 3300026121 | Bacteria | 4083 |
| 250 | Ga0207698_10069789 | 3300026142 | Bacteria | 2781 |
| 251 | Ga0207428_10733337 | 3300027907 | Bacteria | 705 |
| 252 | Ga0207428_11101913 | 3300027907 | Bacteria | 555 |
| 253 | Ga0268266_10091270 | 3300028379 | Bacteria | 2671 |
| 254 | Ga0268266_11956747 | 3300028379 | Bacteria | 560 |
| 255 | Ga0268266_12321045 | 3300028379 | Bacteria | 508 |
| 256 | Ga0268265_11495515 | 3300028380 | Bacteria | 679 |
| 257 | Ga0268264_10225292 | 3300028381 | Bacteria | 1728 |
| 258 | Ga0265319_1010138 | 3300028563 | Bacteria | 3950 |
| 259 | Ga0265319_1013685 | 3300028563 | Bacteria | 3212 |
| 260 | Ga0265318_10046383 | 3300028577 | Bacteria | 1640 |
| 261 | Ga0265318_10357673 | 3300028577 | Bacteria | 533 |
| 262 | Ga0265338_10118007 | 3300028800 | Bacteria | 2121 |
| 263 | Ga0265324_10149267 | 3300029957 | Bacteria | 794 |
| 264 | Ga0265328_10239280 | 3300031239 | Bacteria | 694 |
| 265 | Ga0265320_10050042 | 3300031240 | Bacteria | 2033 |
| 266 | Ga0265320_10341635 | 3300031240 | Bacteria | 661 |
| 267 | Ga0265327_10124503 | 3300031251 | Bacteria | 1218 |
| 268 | Ga0307413_10318792 | 3300031824 | Bacteria | 1186 |
| 269 | Ga0307410_11858405 | 3300031852 | Bacteria | 536 |
| 270 | Ga0307406_10065282 | 3300031901 | Bacteria | 2365 |
| 271 | Ga0307409_100102095 | 3300031995 | Bacteria | 2382 |
| 272 | Ga0373926_0080961 | 3300035083 | Bacteria | 1201 |
| 273 | Ga0373934_0034137 | 3300035086 | Bacteria | 1999 |
| 274 | Ga0373934_0196210 | 3300035086 | Bacteria | 831 |
| 275 | Ga0373944_0050110 | 3300035089 | Bacteria | 1314 |
| 276 | Ga0373949_0019875 | 3300035090 | Bacteria | 1534 |
| 277 | Ga0373923_0058336 | 3300035111 | Bacteria | 1634 |
| 278 | Ga0373945_0005625 | 3300035116 | Bacteria | 4019 |
| 279 | Ga0373953_0234024 | 3300035117 | Bacteria | 797 |
| 280 | Ga0373956_0152500 | 3300035119 | Bacteria | 1088 |
| 281 | Ga0373956_0361785 | 3300035119 | Bacteria | 692 |
| 282 | Ga0373957_0287264 | 3300035120 | Bacteria | 696 |
| 283 | Ga0373943_0015921 | 3300035170 | Bacteria | 3422 |
| 284 | Ga0373946_0017134 | 3300035171 | Bacteria | 2768 |
| 285 | Ga0373946_0406597 | 3300035171 | Bacteria | 688 |
| 286 | Ga0373924_0019913 | 3300035410 | Bacteria | 2603 |
| 287 | Ga0373924_0464077 | 3300035410 | Bacteria | 568 |
| 288 | Ga0373935_0037167 | 3300035692 | Bacteria | 3046 |
| 289 | Ga0373927_0082991 | 3300035695 | Bacteria | 2078 |
| 290 | Ga0373927_0268299 | 3300035695 | Bacteria | 1122 |
| 291 | Ga0373933_0056851 | 3300035724 | Bacteria | 2350 |
| 292 | Ga0373933_0084793 | 3300035724 | Bacteria | 1947 |
| 293 | Ga0373933_0729379 | 3300035724 | Bacteria | 652 |
| 294 | Ga0373947_0024767 | 3300035725 | Bacteria | 3499 |
| 295 | Ga0373937_0057717 | 3300036401 | Bacteria | 3566 |
| 296 | Ga0373937_1223085 | 3300036401 | Bacteria | 699 |
| 297 | Ga0373937_1853928 | 3300036401 | Bacteria | 549 |
| 298 | Ga0373925_0027481 | 3300037068 | Bacteria | 4164 |
| 299 | Ga0373925_0667056 | 3300037068 | Bacteria | 857 |
| 300 | Ga0395899_0921214 | 3300037312 | Bacteria | 532 |
| 301 | Ga0395900_0167599 | 3300037418 | Bacteria | 2238 |
| 302 | Ga0395898_0486964 | 3300037466 | Bacteria | 1173 |
| 303 | Ga0395898_0871128 | 3300037466 | Bacteria | 839 |
| 304 | Ga0395898_1390213 | 3300037466 | Bacteria | 630 |
| 305 | Ga0395905_0353301 | 3300037471 | Bacteria | 1362 |
| 306 | Ga0395901_1829141 | 3300038443 | Bacteria | 556 |
| 307 | Ga0436365_1271021 | 3300039437 | Bacteria | 2261 |
| 308 | Ga0436360_1218010 | 3300039438 | Bacteria | 2787 |
| 309 | Ga0436363_0007682 | 3300039450 | Bacteria | 1125 |
| 310 | Ga0436362_0725924 | 3300039453 | Bacteria | 703 |
| 311 | Ga0439436_0115998 | 3300041404 | Bacteria | 748 |
| 312 | Ga0451795_0203502 | 3300041456 | Bacteria | 756 |
| 313 | Ga0451807_1280054 | 3300041486 | Bacteria | 512 |
| 314 | Ga0451853_2207647 | 3300041512 | Bacteria | 1073 |
| 315 | Ga0466969_0296161 | 3300044656 | Bacteria | 732 |
| 316 | Ga0466966_0004486 | 3300044684 | Bacteria | 9208 |
| 317 | Ga0466966_0059314 | 3300044684 | Bacteria | 2417 |
| 318 | Ga0466966_0915453 | 3300044684 | Bacteria | 529 |
| 319 | Ga0466961_0002730 | 3300044693 | Bacteria | 10974 |
| 320 | Ga0466963_0003543 | 3300044694 | Bacteria | 8962 |
| 321 | Ga0466963_0058878 | 3300044694 | Bacteria | 2563 |
| 322 | Ga0466963_0289636 | 3300044694 | Bacteria | 1151 |
| 323 | Ga0466963_0616524 | 3300044694 | Bacteria | 766 |
| 324 | Ga0466963_0687214 | 3300044694 | Bacteria | 722 |
| 325 | Ga0466964_0001685 | 3300044706 | Bacteria | 7625 |
| 326 | Ga0466964_0008773 | 3300044706 | Bacteria | 3801 |
| 327 | Ga0466964_0039600 | 3300044706 | Bacteria | 1900 |
| 328 | Ga0466964_0293055 | 3300044706 | Bacteria | 817 |
| 329 | Ga0466964_0616241 | 3300044706 | Bacteria | 597 |
| 330 | Ga0466971_0156503 | 3300044719 | Bacteria | 1065 |
| 331 | Ga0466971_0164706 | 3300044719 | Bacteria | 1039 |
| 332 | Ga0466968_0001498 | 3300044735 | Bacteria | 8360 |
| 333 | Ga0466968_0172129 | 3300044735 | Bacteria | 1004 |
| 334 | Ga0466970_0039835 | 3300044765 | Bacteria | 2494 |
| 335 | Ga0466957_0781379 | 3300044842 | Bacteria | 678 |
| 336 | Ga0466960_0914994 | 3300044901 | Bacteria | 536 |
| 337 | Ga0466959_0109225 | 3300045049 | Bacteria | 1975 |
| 338 | Ga0466959_0537866 | 3300045049 | Bacteria | 788 |
| 339 | Ga0466958_0002290 | 3300045836 | Bacteria | 9547 |
| 340 | Ga0466958_0007101 | 3300045836 | Bacteria | 6133 |
| 341 | Ga0466958_0307139 | 3300045836 | Bacteria | 1019 |
| 342 | Ga0466958_0439861 | 3300045836 | Bacteria | 844 |
| 343 | Ga0466958_0589720 | 3300045836 | Bacteria | 723 |
| 344 | Ga0466967_0001868 | 3300045976 | Bacteria | 12700 |
| 345 | Ga0466967_0046629 | 3300045976 | Bacteria | 3775 |
| 346 | Ga0466967_0108965 | 3300045976 | Bacteria | 2542 |
| 347 | Ga0466967_0330414 | 3300045976 | Bacteria | 1472 |
| 348 | Ga0466967_0566843 | 3300045976 | Bacteria | 1118 |
| 349 | Ga0466967_0985996 | 3300045976 | Bacteria | 839 |
| 350 | Ga0466967_1034840 | 3300045976 | Bacteria | 818 |
| 351 | Ga0466967_1705209 | 3300045976 | Bacteria | 627 |
| 352 | Ga0495592_0046264 | 3300046454 | Bacteria | 3244 |
| 353 | Ga0495603_0195724 | 3300046455 | Bacteria | 1168 |
| 354 | Ga0495603_0284112 | 3300046455 | Bacteria | 951 |
| 355 | Ga0495629_0035450 | 3300046459 | Bacteria | 3525 |
| 356 | Ga0495641_0011902 | 3300046461 | Bacteria | 4911 |
| 357 | Ga0495651_0036396 | 3300046462 | Bacteria | 3832 |
| 358 | Ga0495653_0015711 | 3300046463 | Bacteria | 6171 |
| 359 | Ga0495653_0845642 | 3300046463 | Bacteria | 548 |
| 360 | Ga0495580_0048722 | 3300046472 | Bacteria | 2998 |
| 361 | Ga0495582_0007720 | 3300046473 | Bacteria | 5946 |
| 362 | Ga0495639_0013945 | 3300046475 | Bacteria | 3476 |
| 363 | Ga0495662_0025456 | 3300046476 | Bacteria | 2857 |
| 364 | Ga0495608_0030505 | 3300046511 | Bacteria | 3649 |
| 365 | Ga0495618_0009858 | 3300046514 | Bacteria | 5779 |
| 366 | Ga0495628_0395868 | 3300046516 | Bacteria | 1010 |
| 367 | Ga0495628_0514476 | 3300046516 | Bacteria | 863 |
| 368 | Ga0495628_0816953 | 3300046516 | Bacteria | 651 |
| 369 | Ga0495630_0029648 | 3300046517 | Bacteria | 4066 |
| 370 | Ga0495630_0055545 | 3300046517 | Bacteria | 2967 |
| 371 | Ga0495630_0068661 | 3300046517 | Bacteria | 2666 |
| 372 | Ga0495630_0382118 | 3300046517 | Bacteria | 1079 |
| 373 | Ga0495666_0040911 | 3300046526 | Bacteria | 2246 |
| 374 | Ga0495665_0011188 | 3300046531 | Bacteria | 4858 |
| 375 | Ga0495640_0167234 | 3300046533 | Bacteria | 1406 |
| 376 | Ga0495640_0834387 | 3300046533 | Bacteria | 548 |
| 377 | Ga0495586_0005420 | 3300046535 | Bacteria | 6822 |
| 378 | Ga0495586_0068558 | 3300046535 | Bacteria | 1935 |
| 379 | Ga0495586_0771596 | 3300046535 | Bacteria | 555 |
| 380 | Ga0495587_0500866 | 3300046536 | Bacteria | 671 |
| 381 | Ga0495645_0619252 | 3300046543 | Bacteria | 664 |
| 382 | Ga0495645_0654906 | 3300046543 | Bacteria | 641 |
| 383 | Ga0495622_0457976 | 3300046557 | Bacteria | 547 |
| 384 | Ga0495667_0035681 | 3300046559 | Bacteria | 3321 |
| 385 | Ga0495667_0704501 | 3300046559 | Bacteria | 626 |
| 386 | Ga0495634_0011405 | 3300046642 | Bacteria | 6474 |
| 387 | Ga0495659_0032632 | 3300046664 | Unclassified | 1824 |
| 388 | Ga0495588_0016392 | 3300046674 | Bacteria | 3580 |
| 389 | Ga0495657_0007442 | 3300046675 | Bacteria | 8458 |
| 390 | Ga0495657_0197132 | 3300046675 | Bacteria | 1229 |
| 391 | Ga0495657_0425631 | 3300046675 | Bacteria | 779 |
| 392 | Ga0495599_0086832 | 3300046678 | Bacteria | 1953 |
| 393 | Ga0495623_0650498 | 3300046679 | Bacteria | 543 |
| 394 | Ga0495647_0015941 | 3300046681 | Bacteria | 2639 |
| 395 | Ga0495658_0020947 | 3300046683 | Bacteria | 3440 |
| 396 | Ga0495658_0239795 | 3300046683 | Bacteria | 1138 |
| 397 | Ga0495658_0305184 | 3300046683 | Bacteria | 1007 |
| 398 | Ga0495613_0004045 | 3300046689 | Bacteria | 10967 |
| 399 | Ga0495613_0265287 | 3300046689 | Bacteria | 1195 |
| 400 | Ga0495624_0012687 | 3300046690 | Bacteria | 5755 |
| 401 | Ga0495600_0009594 | 3300046809 | Bacteria | 5984 |
| 402 | Ga0495600_0366927 | 3300046809 | Bacteria | 900 |
| 403 | Ga0495581_0082196 | 3300047315 | Bacteria | 1865 |
| 404 | Ga0495604_0136713 | 3300047317 | Bacteria | 1755 |
| 405 | Ga0495604_0542212 | 3300047317 | Bacteria | 751 |
| 406 | Ga0495674_0053428 | 3300047319 | Bacteria | 3551 |
| 407 | Ga0495674_0201439 | 3300047319 | Bacteria | 1651 |
| 408 | Ga0495674_0820340 | 3300047319 | Bacteria | 722 |
| 409 | Ga0495676_0048546 | 3300047321 | Bacteria | 3421 |
| 410 | Ga0495680_0083088 | 3300047322 | Bacteria | 2415 |
| 411 | Ga0495680_0189738 | 3300047322 | Bacteria | 1479 |
| 412 | Ga0495680_0235028 | 3300047322 | Bacteria | 1304 |
| 413 | Ga0495680_0601438 | 3300047322 | Bacteria | 736 |
| 414 | Ga0495675_0071378 | 3300047444 | Bacteria | 2191 |
| 415 | Ga0495675_0303209 | 3300047444 | Bacteria | 948 |
| 416 | Ga0495675_0673467 | 3300047444 | Bacteria | 581 |
| 417 | Ga0495684_0017280 | 3300047471 | Bacteria | 5553 |
| 418 | Ga0495593_0019599 | 3300047673 | Bacteria | 3791 |
| 419 | Ga0495602_0072760 | 3300048088 | Bacteria | 2929 |
| 420 | Ga0495602_0571174 | 3300048088 | Bacteria | 781 |
| 421 | Ga0495614_0011246 | 3300048089 | Bacteria | 3938 |
| 422 | Ga0496100_0005810 | 3300048903 | Bacteria | 6674 |
| 423 | Ga0496100_0021504 | 3300048903 | Bacteria | 3886 |
| 424 | Ga0496100_0103243 | 3300048903 | Bacteria | 1968 |
| 425 | Ga0496100_0295868 | 3300048903 | Bacteria | 1210 |
| 426 | Ga0496100_0361563 | 3300048903 | Bacteria | 1098 |
| 427 | Ga0496100_0846907 | 3300048903 | Bacteria | 717 |
| 428 | Ga0496101_0013420 | 3300048904 | Bacteria | 5487 |
| 429 | Ga0496101_0028001 | 3300048904 | Bacteria | 3931 |
| 430 | Ga0496101_0112882 | 3300048904 | Bacteria | 2047 |
| 431 | Ga0496101_0532737 | 3300048904 | Bacteria | 928 |
| 432 | Ga0496101_0584248 | 3300048904 | Bacteria | 883 |
| 433 | Ga0496101_0731529 | 3300048904 | Bacteria | 781 |
| 434 | Ga0496102_0003029 | 3300048905 | Bacteria | 14222 |
| 435 | Ga0496102_0072734 | 3300048905 | Bacteria | 3160 |
| 436 | Ga0496102_0273770 | 3300048905 | Bacteria | 1592 |
| 437 | Ga0496102_0274712 | 3300048905 | Bacteria | 1588 |
| 438 | Ga0496102_1118540 | 3300048905 | Bacteria | 707 |
| 439 | Ga0496103_0149374 | 3300048906 | Bacteria | 1496 |
| 440 | Ga0496103_0199016 | 3300048906 | Bacteria | 1288 |
| 441 | Ga0496104_0028744 | 3300048907 | Bacteria | 5153 |
| 442 | Ga0496104_0038116 | 3300048907 | Bacteria | 4496 |
| 443 | Ga0496104_0071750 | 3300048907 | Bacteria | 3292 |
| 444 | Ga0496104_1111628 | 3300048907 | Bacteria | 694 |
| 445 | Ga0496105_0015043 | 3300048908 | Bacteria | 6157 |
| 446 | Ga0496105_0295849 | 3300048908 | Bacteria | 1302 |
| 447 | Ga0496105_0766906 | 3300048908 | Bacteria | 736 |
| 448 | Ga0496106_0036562 | 3300048909 | Bacteria | 3673 |
| 449 | Ga0496106_0067259 | 3300048909 | Bacteria | 2731 |
| 450 | Ga0496106_0112792 | 3300048909 | Bacteria | 2118 |
| 451 | Ga0496106_1294316 | 3300048909 | Bacteria | 566 |
| 452 | Ga0496107_0001433 | 3300048910 | Bacteria | 14740 |
| 453 | Ga0496107_0165125 | 3300048910 | Bacteria | 1641 |
| 454 | Ga0496107_0230152 | 3300048910 | Bacteria | 1379 |
| 455 | Ga0496108_0003468 | 3300048911 | Bacteria | 12651 |
| 456 | Ga0496108_0020348 | 3300048911 | Bacteria | 5454 |
| 457 | Ga0496108_0312340 | 3300048911 | Bacteria | 1370 |
| 458 | Ga0496108_0334146 | 3300048911 | Bacteria | 1321 |
| 459 | Ga0496108_1068978 | 3300048911 | Bacteria | 687 |
| 460 | Ga0496109_0001431 | 3300048912 | Bacteria | 19791 |
| 461 | Ga0496109_0012514 | 3300048912 | Bacteria | 7326 |
| 462 | Ga0496109_0375688 | 3300048912 | Bacteria | 1343 |
| 463 | Ga0496109_0487884 | 3300048912 | Bacteria | 1163 |
| 464 | Ga0496109_0998291 | 3300048912 | Bacteria | 775 |
| 465 | Ga0496110_0000626 | 3300048913 | Bacteria | 24200 |
| 466 | Ga0496110_0007505 | 3300048913 | Bacteria | 8715 |
| 467 | Ga0496110_1657796 | 3300048913 | Bacteria | 549 |
| 468 | Ga0496111_0002176 | 3300048914 | Bacteria | 11738 |
| 469 | Ga0496111_0121089 | 3300048914 | Bacteria | 1932 |
| 470 | Ga0496112_0003464 | 3300048915 | Bacteria | 13045 |
| 471 | Ga0496112_0004855 | 3300048915 | Bacteria | 11485 |
| 472 | Ga0496112_0006081 | 3300048915 | Bacteria | 10550 |
| 473 | Ga0496112_0530778 | 3300048915 | Bacteria | 1111 |
| 474 | Ga0496112_0650457 | 3300048915 | Bacteria | 984 |
| 475 | Ga0496112_0700620 | 3300048915 | Bacteria | 941 |
| 476 | Ga0496112_0795205 | 3300048915 | Bacteria | 871 |
| 477 | Ga0496112_0862515 | 3300048915 | Bacteria | 828 |
| 478 | Ga0496113_0000221 | 3300048916 | Bacteria | 26671 |
| 479 | Ga0496113_0008913 | 3300048916 | Bacteria | 6564 |
| 480 | Ga0496113_1362975 | 3300048916 | Unclassified | 550 |
| 481 | Ga0496113_1548419 | 3300048916 | Bacteria | 511 |
| 482 | Ga0496114_0016746 | 3300048917 | Bacteria | 5911 |
| 483 | Ga0496114_0023239 | 3300048917 | Bacteria | 5058 |
| 484 | Ga0496114_0134835 | 3300048917 | Bacteria | 2134 |
| 485 | Ga0496114_0146884 | 3300048917 | Bacteria | 2044 |
| 486 | Ga0496114_0222702 | 3300048917 | Bacteria | 1656 |
| 487 | Ga0496114_0259524 | 3300048917 | Bacteria | 1530 |
| 488 | Ga0496114_0287007 | 3300048917 | Bacteria | 1451 |
| 489 | Ga0496115_0053938 | 3300048918 | Bacteria | 3227 |
| 490 | Ga0496115_0109191 | 3300048918 | Bacteria | 2271 |
| 491 | Ga0496115_0220381 | 3300048918 | Bacteria | 1565 |
| 492 | Ga0496115_0386338 | 3300048918 | Bacteria | 1138 |
| 493 | Ga0496115_1315614 | 3300048918 | Bacteria | 537 |
| 494 | Ga0501034_0205276 | 3300049571 | Bacteria | 1927 |
| 495 | Ga0501036_0381102 | 3300049572 | Bacteria | 1177 |
| 496 | Ga0501040_1177537 | 3300049576 | Bacteria | 556 |
| 497 | Ga0501048_0469596 | 3300049582 | Bacteria | 901 |
| 498 | Ga0501067_0136595 | 3300049583 | Bacteria | 1365 |
| 499 | Ga0501068_0000550 | 3300049584 | Bacteria | 19028 |
| 500 | Ga0501068_0136481 | 3300049584 | Bacteria | 1536 |
| 501 | Ga0501069_0000261 | 3300049585 | Bacteria | 23886 |
| 502 | Ga0501069_0489970 | 3300049585 | Bacteria | 733 |
| 503 | Ga0501070_0023647 | 3300049586 | Bacteria | 5148 |
| 504 | Ga0501071_0117892 | 3300049587 | Bacteria | 1966 |
| 505 | Ga0501075_0799411 | 3300049591 | Bacteria | 718 |
| 506 | Ga0501076_0805075 | 3300049592 | Bacteria | 775 |
| 507 | Ga0501077_0362185 | 3300049593 | Bacteria | 926 |
| 508 | Ga0501079_0460430 | 3300049741 | Bacteria | 999 |
| 509 | Ga0501080_0960164 | 3300049742 | Bacteria | 743 |
| 510 | Ga0501081_0040720 | 3300049743 | Bacteria | 3181 |
| 511 | Ga0501035_1460000 | 3300049822 | Bacteria | 523 |
| 512 | Ga0501045_1400621 | 3300049824 | Bacteria | 508 |
| 513 | nmdc:mga03683_100244_c1 | 3300050489 | Bacteria | 1272 |
| 514 | nmdc:mga0yw44_389232_c1 | 3300050492 | Bacteria | 942 |
| 515 | nmdc:mga0k408_160517_c1 | 3300050493 | Bacteria | 1339 |
| 516 | nmdc:mga0qj67_474120_c1 | 3300050509 | Bacteria | 1007 |
| 517 | nmdc:mga08y16_313025_c1 | 3300050511 | Bacteria | 1617 |
| 518 | nmdc:mga0n895_1334_c1 | 3300050512 | Bacteria | 18282 |
| 519 | nmdc:mga0n895_19850_c1 | 3300050512 | Bacteria | 6255 |
| 520 | nmdc:mga0n895_764780_c1 | 3300050512 | Bacteria | 958 |
| 521 | nmdc:mga0rr50_1039165_c1 | 3300050513 | Unclassified | 698 |
| 522 | nmdc:mga0rr50_154805_c1 | 3300050513 | Bacteria | 1856 |
| 523 | nmdc:mga0rr50_51388_c1 | 3300050513 | Bacteria | 3058 |
| 524 | nmdc:mga08x19_23125_c1 | 3300050514 | Bacteria | 3855 |
| 525 | nmdc:mga0a205_211575_c1 | 3300050515 | Unclassified | 740 |
| 526 | nmdc:mga0a205_289715_c1 | 3300050515 | Bacteria | 1512 |
| 527 | Ga0495601_0060840 | 3300053077 | Bacteria | 2396 |
| 528 | Ga0495601_0084161 | 3300053077 | Bacteria | 2043 |
| 529 | Ga0495601_0558199 | 3300053077 | Unclassified | 736 |
| 530 | Ga0495601_1002352 | 3300053077 | Bacteria | 525 |
| 531 | Ga0495612_0126422 | 3300053078 | Bacteria | 1102 |
| 532 | Ga0495595_0006865 | 3300053084 | Bacteria | 4644 |
| 533 | Ga0495595_0082358 | 3300053084 | Bacteria | 1535 |
| 534 | Ga0495619_0087758 | 3300053085 | Bacteria | 2103 |
| 535 | Ga0495619_0140350 | 3300053085 | Bacteria | 1664 |
| 536 | Ga0495619_0320210 | 3300053085 | Bacteria | 1073 |
| 537 | Ga0500641_0003465 | 3300053096 | Bacteria | 5578 |
| 538 | Ga0466962_0013420 | 3300061719 | Bacteria | 3944 |
| 539 | Ga0530510_0052208 | 3300061734 | Bacteria | 2954 |
| 540 | Ga0530510_0053765 | 3300061734 | Bacteria | 2909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005544 | Ga0070686_101915988 | Ga0070686_1019159881 | 86 |
| 2 | iso_pu_bacteria | 2773857759 | 2774382999 | 86 |
| 3 | 3300005338 | Ga0068868_102108992 | Ga0068868_1021089921 | 88 |
| 4 | 3300005617 | Ga0068859_100884878 | Ga0068859_1008848782 | 88 |
| 5 | 3300006038 | Ga0075365_10128010 | Ga0075365_101280102 | 88 |
| 6 | 3300006852 | Ga0075433_10284211 | Ga0075433_102842113 | 88 |
| 7 | 3300006871 | Ga0075434_100006313 | Ga0075434_1000063137 | 88 |
| 8 | 3300006931 | Ga0097620_100884812 | Ga0097620_1008848122 | 88 |
| 9 | 3300007076 | Ga0075435_100005187 | Ga0075435_1000051879 | 88 |
| 10 | 3300009094 | Ga0111539_12701016 | Ga0111539_127010162 | 88 |
| 11 | 3300009147 | Ga0114129_11270526 | Ga0114129_112705262 | 88 |
| 12 | 3300014326 | Ga0157380_13303346 | Ga0157380_133033461 | 88 |
| 13 | 3300021377 | Ga0213874_10239111 | Ga0213874_102391112 | 88 |
| 14 | 3300026023 | Ga0207677_11611351 | Ga0207677_116113512 | 88 |
| 15 | 3300027907 | Ga0207428_10733337 | Ga0207428_107333373 | 88 |
| 16 | 3300028577 | Ga0265318_10357673 | Ga0265318_103576732 | 88 |
| 17 | 3300035171 | Ga0373946_0406597 | Ga0373946_0406597_126_392 | 88 |
| 18 | 3300035695 | Ga0373927_0082991 | Ga0373927_0082991_277_543 | 88 |
| 19 | 3300039437 | Ga0436365_1271021 | Ga0436365_1271021_1525_1791 | 88 |
| 20 | 3300039450 | Ga0436363_0007682 | Ga0436363_0007682_463_729 | 88 |
| 21 | 3300044656 | Ga0466969_0296161 | Ga0466969_0296161_418_684 | 88 |
| 22 | 3300044684 | Ga0466966_0004486 | Ga0466966_0004486_1628_1894 | 88 |
| 23 | 3300044684 | Ga0466966_0059314 | Ga0466966_0059314_1678_1944 | 88 |
| 24 | 3300044693 | Ga0466961_0002730 | Ga0466961_0002730_8977_9243 | 88 |
| 25 | 3300044694 | Ga0466963_0003543 | Ga0466963_0003543_577_843 | 88 |
| 26 | 3300044694 | Ga0466963_0058878 | Ga0466963_0058878_1624_1890 | 88 |
| 27 | 3300044694 | Ga0466963_0289636 | Ga0466963_0289636_701_967 | 88 |
| 28 | 3300044694 | Ga0466963_0616524 | Ga0466963_0616524_106_372 | 88 |
| 29 | 3300044694 | Ga0466963_0687214 | Ga0466963_0687214_133_399 | 88 |
| 30 | 3300044706 | Ga0466964_0001685 | Ga0466964_0001685_2909_3175 | 88 |
| 31 | 3300044706 | Ga0466964_0008773 | Ga0466964_0008773_237_503 | 88 |
| 32 | 3300044706 | Ga0466964_0039600 | Ga0466964_0039600_1126_1392 | 88 |
| 33 | 3300044706 | Ga0466964_0293055 | Ga0466964_0293055_469_735 | 88 |
| 34 | 3300044719 | Ga0466971_0156503 | Ga0466971_0156503_511_777 | 88 |
| 35 | 3300044735 | Ga0466968_0001498 | Ga0466968_0001498_663_929 | 88 |
| 36 | 3300044765 | Ga0466970_0039835 | Ga0466970_0039835_394_660 | 88 |
| 37 | 3300044842 | Ga0466957_0781379 | Ga0466957_0781379_378_644 | 88 |
| 38 | 3300045049 | Ga0466959_0109225 | Ga0466959_0109225_1457_1723 | 88 |
| 39 | 3300045049 | Ga0466959_0537866 | Ga0466959_0537866_343_609 | 88 |
| 40 | 3300045836 | Ga0466958_0002290 | Ga0466958_0002290_1539_1805 | 88 |
| 41 | 3300045836 | Ga0466958_0007101 | Ga0466958_0007101_5792_6058 | 88 |
| 42 | 3300045836 | Ga0466958_0307139 | Ga0466958_0307139_146_412 | 88 |
| 43 | 3300045836 | Ga0466958_0439861 | Ga0466958_0439861_567_833 | 88 |
| 44 | 3300045836 | Ga0466958_0589720 | Ga0466958_0589720_174_440 | 88 |
| 45 | 3300045976 | Ga0466967_0001868 | Ga0466967_0001868_2544_2810 | 88 |
| 46 | 3300045976 | Ga0466967_0330414 | Ga0466967_0330414_908_1174 | 88 |
| 47 | 3300045976 | Ga0466967_0566843 | Ga0466967_0566843_836_1102 | 88 |
| 48 | 3300045976 | Ga0466967_1034840 | Ga0466967_1034840_32_298 | 88 |
| 49 | 3300045976 | Ga0466967_1705209 | Ga0466967_1705209_99_365 | 88 |
| 50 | 3300046517 | Ga0495630_0382118 | Ga0495630_0382118_229_495 | 88 |
| 51 | 3300046533 | Ga0495640_0834387 | Ga0495640_0834387_112_378 | 88 |
| 52 | 3300048905 | Ga0496102_0273770 | Ga0496102_0273770_13_279 | 88 |
| 53 | 3300048907 | Ga0496104_0071750 | Ga0496104_0071750_642_908 | 88 |
| 54 | 3300048911 | Ga0496108_1068978 | Ga0496108_1068978_383_649 | 88 |
| 55 | 3300050512 | nmdc:mga0n895_19850_c1 | nmdc:mga0n895_19850_c1_2380_2646 | 88 |
| 56 | 3300050513 | nmdc:mga0rr50_51388_c1 | nmdc:mga0rr50_51388_c1_1369_1635 | 88 |
| 57 | 3300050515 | nmdc:mga0a205_289715_c1 | nmdc:mga0a205_289715_c1_1053_1319 | 88 |
| 58 | 3300061719 | Ga0466962_0013420 | Ga0466962_0013420_1211_1477 | 88 |
| 59 | 3300014745 | Ga0157377_10670367 | Ga0157377_106703671 | 89 |
| 60 | 3300017792 | Ga0163161_11974680 | Ga0163161_119746802 | 89 |
| 61 | 3300021441 | Ga0213871_10023265 | Ga0213871_100232652 | 89 |
| 62 | 3300025905 | Ga0207685_10102665 | Ga0207685_101026652 | 89 |
| 63 | 3300026075 | Ga0207708_11691983 | Ga0207708_116919832 | 89 |
| 64 | 3300031824 | Ga0307413_10318792 | Ga0307413_103187922 | 89 |
| 65 | 3300039438 | Ga0436360_1218010 | Ga0436360_1218010_1613_1882 | 89 |
| 66 | 3300044684 | Ga0466966_0915453 | Ga0466966_0915453_125_394 | 89 |
| 67 | 3300044719 | Ga0466971_0164706 | Ga0466971_0164706_567_836 | 89 |
| 68 | 3300044901 | Ga0466960_0914994 | Ga0466960_0914994_238_507 | 89 |
| 69 | 3300048916 | Ga0496113_1548419 | Ga0496113_1548419_184_453 | 89 |
| 70 | 3300048917 | Ga0496114_0023239 | Ga0496114_0023239_1682_1951 | 89 |
| 71 | 3300049576 | Ga0501040_1177537 | Ga0501040_1177537_274_543 | 89 |
| 72 | iso_pu_bacteria | 2887443736 | 2887445267 | 89 |
| 73 | 3300005366 | Ga0070659_101597330 | Ga0070659_1015973302 | 90 |
| 74 | 3300005471 | Ga0070698_101270215 | Ga0070698_1012702152 | 90 |
| 75 | 3300013105 | Ga0157369_10320311 | Ga0157369_103203112 | 90 |
| 76 | 3300031852 | Ga0307410_11858405 | Ga0307410_118584051 | 90 |
| 77 | 3300031901 | Ga0307406_10065282 | Ga0307406_100652823 | 90 |
| 78 | 3300031995 | Ga0307409_100102095 | Ga0307409_1001020953 | 90 |
| 79 | 3300037312 | Ga0395899_0921214 | Ga0395899_0921214_92_364 | 90 |
| 80 | 3300037418 | Ga0395900_0167599 | Ga0395900_0167599_166_438 | 90 |
| 81 | 3300037466 | Ga0395898_0486964 | Ga0395898_0486964_350_622 | 90 |
| 82 | 3300037466 | Ga0395898_0871128 | Ga0395898_0871128_30_302 | 90 |
| 83 | 3300037466 | Ga0395898_1390213 | Ga0395898_1390213_12_284 | 90 |
| 84 | 3300037471 | Ga0395905_0353301 | Ga0395905_0353301_890_1162 | 90 |
| 85 | 3300046516 | Ga0495628_0395868 | Ga0495628_0395868_336_608 | 90 |
| 86 | 3300047322 | Ga0495680_0601438 | Ga0495680_0601438_274_546 | 90 |
| 87 | 3300047444 | Ga0495675_0673467 | Ga0495675_0673467_57_329 | 90 |
| 88 | 3300048915 | Ga0496112_0530778 | Ga0496112_0530778_121_393 | 90 |
| 89 | 3300048916 | Ga0496113_1362975 | Ga0496113_1362975_20_292 | 90 |
| 90 | 3300049571 | Ga0501034_0205276 | Ga0501034_0205276_1305_1577 | 90 |
| 91 | 3300049583 | Ga0501067_0136595 | Ga0501067_0136595_828_1100 | 90 |
| 92 | 3300053096 | Ga0500641_0003465 | Ga0500641_0003465_897_1169 | 90 |
| 93 | 3300003203 | JGI25406J46586_10057059 | JGI25406J46586_100570592 | 91 |
| 94 | 3300005329 | Ga0070683_100042259 | Ga0070683_1000422592 | 91 |
| 95 | 3300005331 | Ga0070670_101363156 | Ga0070670_1013631562 | 91 |
| 96 | 3300005338 | Ga0068868_100938831 | Ga0068868_1009388312 | 91 |
| 97 | 3300005340 | Ga0070689_100328759 | Ga0070689_1003287592 | 91 |
| 98 | 3300005345 | Ga0070692_10536475 | Ga0070692_105364752 | 91 |
| 99 | 3300005345 | Ga0070692_10760779 | Ga0070692_107607791 | 91 |
| 100 | 3300005347 | Ga0070668_101055254 | Ga0070668_1010552542 | 91 |
| 101 | 3300005356 | Ga0070674_100324731 | Ga0070674_1003247312 | 91 |
| 102 | 3300005356 | Ga0070674_101482757 | Ga0070674_1014827572 | 91 |
| 103 | 3300005365 | Ga0070688_100119814 | Ga0070688_1001198141 | 91 |
| 104 | 3300005366 | Ga0070659_101913298 | Ga0070659_1019132981 | 91 |
| 105 | 3300005435 | Ga0070714_100541955 | Ga0070714_1005419552 | 91 |
| 106 | 3300005436 | Ga0070713_100230851 | Ga0070713_1002308513 | 91 |
| 107 | 3300005437 | Ga0070710_10112834 | Ga0070710_101128342 | 91 |
| 108 | 3300005438 | Ga0070701_10283752 | Ga0070701_102837522 | 91 |
| 109 | 3300005441 | Ga0070700_100669079 | Ga0070700_1006690792 | 91 |
| 110 | 3300005457 | Ga0070662_101605896 | Ga0070662_1016058962 | 91 |
| 111 | 3300005467 | Ga0070706_101914860 | Ga0070706_1019148601 | 91 |
| 112 | 3300005471 | Ga0070698_100141589 | Ga0070698_1001415893 | 91 |
| 113 | 3300005535 | Ga0070684_100199473 | Ga0070684_1001994733 | 91 |
| 114 | 3300005539 | Ga0068853_100030908 | Ga0068853_1000309082 | 91 |
| 115 | 3300005543 | Ga0070672_102100002 | Ga0070672_1021000022 | 91 |
| 116 | 3300005546 | Ga0070696_101228115 | Ga0070696_1012281152 | 91 |
| 117 | 3300005548 | Ga0070665_102565836 | Ga0070665_1025658362 | 91 |
| 118 | 3300005564 | Ga0070664_100265845 | Ga0070664_1002658452 | 91 |
| 119 | 3300005577 | Ga0068857_100034823 | Ga0068857_1000348234 | 91 |
| 120 | 3300005614 | Ga0068856_100651355 | Ga0068856_1006513552 | 91 |
| 121 | 3300005616 | Ga0068852_100814081 | Ga0068852_1008140812 | 91 |
| 122 | 3300005616 | Ga0068852_100914624 | Ga0068852_1009146242 | 91 |
| 123 | 3300005616 | Ga0068852_101799960 | Ga0068852_1017999601 | 91 |
| 124 | 3300005618 | Ga0068864_100815244 | Ga0068864_1008152442 | 91 |
| 125 | 3300005718 | Ga0068866_10575145 | Ga0068866_105751452 | 91 |
| 126 | 3300005840 | Ga0068870_10353423 | Ga0068870_103534232 | 91 |
| 127 | 3300005842 | Ga0068858_100872606 | Ga0068858_1008726062 | 91 |
| 128 | 3300005842 | Ga0068858_102503557 | Ga0068858_1025035572 | 91 |
| 129 | 3300005985 | Ga0081539_10002150 | Ga0081539_1000215023 | 91 |
| 130 | 3300005985 | Ga0081539_10195150 | Ga0081539_101951502 | 91 |
| 131 | 3300006844 | Ga0075428_101004408 | Ga0075428_1010044082 | 91 |
| 132 | 3300006881 | Ga0068865_100230730 | Ga0068865_1002307302 | 91 |
| 133 | 3300007788 | Ga0099795_10437150 | Ga0099795_104371501 | 91 |
| 134 | 3300009094 | Ga0111539_10071796 | Ga0111539_100717965 | 91 |
| 135 | 3300009094 | Ga0111539_12617096 | Ga0111539_126170962 | 91 |
| 136 | 3300009098 | Ga0105245_10329144 | Ga0105245_103291442 | 91 |
| 137 | 3300009098 | Ga0105245_11683138 | Ga0105245_116831383 | 91 |
| 138 | 3300009147 | Ga0114129_10101632 | Ga0114129_101016322 | 91 |
| 139 | 3300009174 | Ga0105241_10644503 | Ga0105241_106445032 | 91 |
| 140 | 3300009176 | Ga0105242_12533343 | Ga0105242_125333432 | 91 |
| 141 | 3300010375 | Ga0105239_10003251 | Ga0105239_1000325113 | 91 |
| 142 | 3300010375 | Ga0105239_10868695 | Ga0105239_108686952 | 91 |
| 143 | 3300013105 | Ga0157369_12124527 | Ga0157369_121245271 | 91 |
| 144 | 3300013296 | Ga0157374_10021831 | Ga0157374_1002183111 | 91 |
| 145 | 3300013307 | Ga0157372_10401586 | Ga0157372_104015863 | 91 |
| 146 | 3300014325 | Ga0163163_11022722 | Ga0163163_110227222 | 91 |
| 147 | 3300014745 | Ga0157377_10358014 | Ga0157377_103580141 | 91 |
| 148 | 3300025898 | Ga0207692_10255529 | Ga0207692_102555292 | 91 |
| 149 | 3300025899 | Ga0207642_10623424 | Ga0207642_106234242 | 91 |
| 150 | 3300025901 | Ga0207688_10392626 | Ga0207688_103926261 | 91 |
| 151 | 3300025908 | Ga0207643_10084922 | Ga0207643_100849223 | 91 |
| 152 | 3300025910 | Ga0207684_11404422 | Ga0207684_114044221 | 91 |
| 153 | 3300025911 | Ga0207654_10910807 | Ga0207654_109108071 | 91 |
| 154 | 3300025919 | Ga0207657_11225544 | Ga0207657_112255441 | 91 |
| 155 | 3300025920 | Ga0207649_11356332 | Ga0207649_113563321 | 91 |
| 156 | 3300025922 | Ga0207646_10695860 | Ga0207646_106958602 | 91 |
| 157 | 3300025927 | Ga0207687_11841939 | Ga0207687_118419391 | 91 |
| 158 | 3300025928 | Ga0207700_10421943 | Ga0207700_104219431 | 91 |
| 159 | 3300025929 | Ga0207664_10726901 | Ga0207664_107269012 | 91 |
| 160 | 3300025934 | Ga0207686_10623185 | Ga0207686_106231851 | 91 |
| 161 | 3300025937 | Ga0207669_10581209 | Ga0207669_105812092 | 91 |
| 162 | 3300025937 | Ga0207669_10772154 | Ga0207669_107721541 | 91 |
| 163 | 3300025938 | Ga0207704_11029628 | Ga0207704_110296282 | 91 |
| 164 | 3300025942 | Ga0207689_10208081 | Ga0207689_102080812 | 91 |
| 165 | 3300025944 | Ga0207661_10816448 | Ga0207661_108164482 | 91 |
| 166 | 3300025945 | Ga0207679_10297107 | Ga0207679_102971072 | 91 |
| 167 | 3300025981 | Ga0207640_12035861 | Ga0207640_120358611 | 91 |
| 168 | 3300026035 | Ga0207703_11394231 | Ga0207703_113942312 | 91 |
| 169 | 3300026067 | Ga0207678_10412808 | Ga0207678_104128082 | 91 |
| 170 | 3300026075 | Ga0207708_10035751 | Ga0207708_100357513 | 91 |
| 171 | 3300026075 | Ga0207708_11505793 | Ga0207708_115057932 | 91 |
| 172 | 3300026078 | Ga0207702_11287347 | Ga0207702_112873472 | 91 |
| 173 | 3300026095 | Ga0207676_10942821 | Ga0207676_109428212 | 91 |
| 174 | 3300026116 | Ga0207674_10001018 | Ga0207674_1000101838 | 91 |
| 175 | 3300026118 | Ga0207675_102079195 | Ga0207675_1020791952 | 91 |
| 176 | 3300027907 | Ga0207428_11101913 | Ga0207428_111019131 | 91 |
| 177 | 3300028379 | Ga0268266_11956747 | Ga0268266_119567472 | 91 |
| 178 | 3300028379 | Ga0268266_12321045 | Ga0268266_123210451 | 91 |
| 179 | 3300031251 | Ga0265327_10124503 | Ga0265327_101245033 | 91 |
| 180 | 3300035724 | Ga0373933_0056851 | Ga0373933_0056851_360_635 | 91 |
| 181 | 3300036401 | Ga0373937_0057717 | Ga0373937_0057717_1568_1843 | 91 |
| 182 | 3300037068 | Ga0373925_0667056 | Ga0373925_0667056_220_495 | 91 |
| 183 | 3300038443 | Ga0395901_1829141 | Ga0395901_1829141_29_304 | 91 |
| 184 | 3300039453 | Ga0436362_0725924 | Ga0436362_0725924_177_452 | 91 |
| 185 | 3300041456 | Ga0451795_0203502 | Ga0451795_0203502_60_335 | 91 |
| 186 | 3300041486 | Ga0451807_1280054 | Ga0451807_1280054_103_378 | 91 |
| 187 | 3300044706 | Ga0466964_0616241 | Ga0466964_0616241_222_497 | 91 |
| 188 | 3300044735 | Ga0466968_0172129 | Ga0466968_0172129_494_769 | 91 |
| 189 | 3300045976 | Ga0466967_0046629 | Ga0466967_0046629_1385_1660 | 91 |
| 190 | 3300045976 | Ga0466967_0108965 | Ga0466967_0108965_380_655 | 91 |
| 191 | 3300046455 | Ga0495603_0284112 | Ga0495603_0284112_177_452 | 91 |
| 192 | 3300046463 | Ga0495653_0845642 | Ga0495653_0845642_237_512 | 91 |
| 193 | 3300046517 | Ga0495630_0055545 | Ga0495630_0055545_2252_2527 | 91 |
| 194 | 3300046517 | Ga0495630_0068661 | Ga0495630_0068661_618_893 | 91 |
| 195 | 3300046535 | Ga0495586_0005420 | Ga0495586_0005420_4367_4642 | 91 |
| 196 | 3300046535 | Ga0495586_0771596 | Ga0495586_0771596_117_392 | 91 |
| 197 | 3300046543 | Ga0495645_0654906 | Ga0495645_0654906_122_397 | 91 |
| 198 | 3300046664 | Ga0495659_0032632 | Ga0495659_0032632_1082_1357 | 91 |
| 199 | 3300046683 | Ga0495658_0239795 | Ga0495658_0239795_21_302 | 91 |
| 200 | 3300046683 | Ga0495658_0305184 | Ga0495658_0305184_290_565 | 91 |
| 201 | 3300046689 | Ga0495613_0265287 | Ga0495613_0265287_646_921 | 91 |
| 202 | 3300047319 | Ga0495674_0201439 | Ga0495674_0201439_1007_1282 | 91 |
| 203 | 3300047319 | Ga0495674_0820340 | Ga0495674_0820340_390_665 | 91 |
| 204 | 3300047322 | Ga0495680_0189738 | Ga0495680_0189738_1120_1395 | 91 |
| 205 | 3300047444 | Ga0495675_0071378 | Ga0495675_0071378_1392_1667 | 91 |
| 206 | 3300048088 | Ga0495602_0571174 | Ga0495602_0571174_85_360 | 91 |
| 207 | 3300048903 | Ga0496100_0103243 | Ga0496100_0103243_903_1178 | 91 |
| 208 | 3300048903 | Ga0496100_0361563 | Ga0496100_0361563_544_819 | 91 |
| 209 | 3300048904 | Ga0496101_0584248 | Ga0496101_0584248_17_292 | 91 |
| 210 | 3300048904 | Ga0496101_0731529 | Ga0496101_0731529_106_381 | 91 |
| 211 | 3300048907 | Ga0496104_1111628 | Ga0496104_1111628_60_335 | 91 |
| 212 | 3300048909 | Ga0496106_1294316 | Ga0496106_1294316_103_378 | 91 |
| 213 | 3300048911 | Ga0496108_0312340 | Ga0496108_0312340_303_578 | 91 |
| 214 | 3300048912 | Ga0496109_0487884 | Ga0496109_0487884_315_590 | 91 |
| 215 | 3300048912 | Ga0496109_0998291 | Ga0496109_0998291_84_359 | 91 |
| 216 | 3300048915 | Ga0496112_0003464 | Ga0496112_0003464_5995_6270 | 91 |
| 217 | 3300048915 | Ga0496112_0795205 | Ga0496112_0795205_264_539 | 91 |
| 218 | 3300048915 | Ga0496112_0862515 | Ga0496112_0862515_534_809 | 91 |
| 219 | 3300048917 | Ga0496114_0146884 | Ga0496114_0146884_1590_1865 | 91 |
| 220 | 3300048917 | Ga0496114_0222702 | Ga0496114_0222702_1299_1574 | 91 |
| 221 | 3300048917 | Ga0496114_0259524 | Ga0496114_0259524_556_831 | 91 |
| 222 | 3300048918 | Ga0496115_0053938 | Ga0496115_0053938_1171_1446 | 91 |
| 223 | 3300048918 | Ga0496115_0386338 | Ga0496115_0386338_456_731 | 91 |
| 224 | 3300049572 | Ga0501036_0381102 | Ga0501036_0381102_634_909 | 91 |
| 225 | 3300049582 | Ga0501048_0469596 | Ga0501048_0469596_212_487 | 91 |
| 226 | 3300049584 | Ga0501068_0136481 | Ga0501068_0136481_794_1069 | 91 |
| 227 | 3300049585 | Ga0501069_0489970 | Ga0501069_0489970_281_556 | 91 |
| 228 | 3300049591 | Ga0501075_0799411 | Ga0501075_0799411_208_483 | 91 |
| 229 | 3300049592 | Ga0501076_0805075 | Ga0501076_0805075_381_656 | 91 |
| 230 | 3300049741 | Ga0501079_0460430 | Ga0501079_0460430_690_965 | 91 |
| 231 | 3300049742 | Ga0501080_0960164 | Ga0501080_0960164_44_319 | 91 |
| 232 | 3300049822 | Ga0501035_1460000 | Ga0501035_1460000_181_456 | 91 |
| 233 | 3300049824 | Ga0501045_1400621 | Ga0501045_1400621_203_478 | 91 |
| 234 | 3300050511 | nmdc:mga08y16_313025_c1 | nmdc:mga08y16_313025_c1_1205_1480 | 91 |
| 235 | 3300050512 | nmdc:mga0n895_764780_c1 | nmdc:mga0n895_764780_c1_56_331 | 91 |
| 236 | 3300050513 | nmdc:mga0rr50_154805_c1 | nmdc:mga0rr50_154805_c1_1064_1339 | 91 |
| 237 | 3300053077 | Ga0495601_0084161 | Ga0495601_0084161_215_490 | 91 |
| 238 | 3300053077 | Ga0495601_0558199 | Ga0495601_0558199_153_428 | 91 |
| 239 | 3300005339 | Ga0070660_100917999 | Ga0070660_1009179991 | 92 |
| 240 | 3300005435 | Ga0070714_101845273 | Ga0070714_1018452731 | 92 |
| 241 | 3300005436 | Ga0070713_101055205 | Ga0070713_1010552051 | 92 |
| 242 | 3300005445 | Ga0070708_101165529 | Ga0070708_1011655291 | 92 |
| 243 | 3300005467 | Ga0070706_100398022 | Ga0070706_1003980223 | 92 |
| 244 | 3300005544 | Ga0070686_100658770 | Ga0070686_1006587702 | 92 |
| 245 | 3300006028 | Ga0070717_12038109 | Ga0070717_120381091 | 92 |
| 246 | 3300009098 | Ga0105245_13143907 | Ga0105245_131439071 | 92 |
| 247 | 3300009176 | Ga0105242_10069422 | Ga0105242_100694223 | 92 |
| 248 | 3300025910 | Ga0207684_10322805 | Ga0207684_103228052 | 92 |
| 249 | 3300026078 | Ga0207702_10305355 | Ga0207702_103053552 | 92 |
| 250 | 3300028563 | Ga0265319_1010138 | Ga0265319_10101383 | 92 |
| 251 | 3300028563 | Ga0265319_1013685 | Ga0265319_10136853 | 92 |
| 252 | 3300028577 | Ga0265318_10046383 | Ga0265318_100463831 | 92 |
| 253 | 3300028800 | Ga0265338_10118007 | Ga0265338_101180075 | 92 |
| 254 | 3300029957 | Ga0265324_10149267 | Ga0265324_101492672 | 92 |
| 255 | 3300031239 | Ga0265328_10239280 | Ga0265328_102392802 | 92 |
| 256 | 3300031240 | Ga0265320_10050042 | Ga0265320_100500422 | 92 |
| 257 | 3300031240 | Ga0265320_10341635 | Ga0265320_103416352 | 92 |
| 258 | 3300046557 | Ga0495622_0457976 | Ga0495622_0457976_132_410 | 92 |
| 259 | 3300046559 | Ga0495667_0704501 | Ga0495667_0704501_37_315 | 92 |
| 260 | 3300046675 | Ga0495657_0425631 | Ga0495657_0425631_214_492 | 92 |
| 261 | 3300047317 | Ga0495604_0542212 | Ga0495604_0542212_337_615 | 92 |
| 262 | 3300049584 | Ga0501068_0000550 | Ga0501068_0000550_10239_10517 | 92 |
| 263 | 3300049585 | Ga0501069_0000261 | Ga0501069_0000261_18997_19275 | 92 |
| 264 | 3300049586 | Ga0501070_0023647 | Ga0501070_0023647_625_903 | 92 |
| 265 | 3300049587 | Ga0501071_0117892 | Ga0501071_0117892_1000_1278 | 92 |
| 266 | 3300049593 | Ga0501077_0362185 | Ga0501077_0362185_222_500 | 92 |
| 267 | 3300049743 | Ga0501081_0040720 | Ga0501081_0040720_1213_1491 | 92 |
| 268 | 3300053085 | Ga0495619_0140350 | Ga0495619_0140350_198_476 | 92 |
| 269 | 3300061734 | Ga0530510_0053765 | Ga0530510_0053765_83_361 | 92 |
| 270 | 3300002075 | JGI24738J21930_10067934 | JGI24738J21930_100679342 | 93 |
| 271 | 3300002459 | JGI24751J29686_10037306 | JGI24751J29686_100373062 | 93 |
| 272 | 3300005328 | Ga0070676_10032239 | Ga0070676_100322394 | 93 |
| 273 | 3300005329 | Ga0070683_100297633 | Ga0070683_1002976332 | 93 |
| 274 | 3300005329 | Ga0070683_100754032 | Ga0070683_1007540321 | 93 |
| 275 | 3300005331 | Ga0070670_100409901 | Ga0070670_1004099013 | 93 |
| 276 | 3300005335 | Ga0070666_10533599 | Ga0070666_105335992 | 93 |
| 277 | 3300005337 | Ga0070682_100130254 | Ga0070682_1001302543 | 93 |
| 278 | 3300005338 | Ga0068868_100005695 | Ga0068868_1000056956 | 93 |
| 279 | 3300005338 | Ga0068868_100930139 | Ga0068868_1009301391 | 93 |
| 280 | 3300005339 | Ga0070660_100001771 | Ga0070660_1000017714 | 93 |
| 281 | 3300005341 | Ga0070691_10063005 | Ga0070691_100630054 | 93 |
| 282 | 3300005343 | Ga0070687_101267920 | Ga0070687_1012679202 | 93 |
| 283 | 3300005354 | Ga0070675_100524563 | Ga0070675_1005245633 | 93 |
| 284 | 3300005355 | Ga0070671_100291843 | Ga0070671_1002918432 | 93 |
| 285 | 3300005356 | Ga0070674_101062495 | Ga0070674_1010624952 | 93 |
| 286 | 3300005365 | Ga0070688_100454878 | Ga0070688_1004548782 | 93 |
| 287 | 3300005366 | Ga0070659_100031418 | Ga0070659_1000314181 | 93 |
| 288 | 3300005367 | Ga0070667_100309163 | Ga0070667_1003091634 | 93 |
| 289 | 3300005435 | Ga0070714_100169950 | Ga0070714_1001699502 | 93 |
| 290 | 3300005436 | Ga0070713_101180848 | Ga0070713_1011808482 | 93 |
| 291 | 3300005437 | Ga0070710_10500809 | Ga0070710_105008092 | 93 |
| 292 | 3300005439 | Ga0070711_100216803 | Ga0070711_1002168032 | 93 |
| 293 | 3300005439 | Ga0070711_100319693 | Ga0070711_1003196932 | 93 |
| 294 | 3300005439 | Ga0070711_101323581 | Ga0070711_1013235812 | 93 |
| 295 | 3300005441 | Ga0070700_100156797 | Ga0070700_1001567974 | 93 |
| 296 | 3300005444 | Ga0070694_100261933 | Ga0070694_1002619332 | 93 |
| 297 | 3300005456 | Ga0070678_100037838 | Ga0070678_1000378385 | 93 |
| 298 | 3300005457 | Ga0070662_100343769 | Ga0070662_1003437691 | 93 |
| 299 | 3300005457 | Ga0070662_100668854 | Ga0070662_1006688542 | 93 |
| 300 | 3300005466 | Ga0070685_10049684 | Ga0070685_100496845 | 93 |
| 301 | 3300005466 | Ga0070685_10638779 | Ga0070685_106387792 | 93 |
| 302 | 3300005530 | Ga0070679_101244215 | Ga0070679_1012442152 | 93 |
| 303 | 3300005539 | Ga0068853_100216604 | Ga0068853_1002166043 | 93 |
| 304 | 3300005544 | Ga0070686_100483738 | Ga0070686_1004837382 | 93 |
| 305 | 3300005545 | Ga0070695_101405336 | Ga0070695_1014053362 | 93 |
| 306 | 3300005548 | Ga0070665_100179203 | Ga0070665_1001792032 | 93 |
| 307 | 3300005549 | Ga0070704_100356712 | Ga0070704_1003567121 | 93 |
| 308 | 3300005563 | Ga0068855_100069956 | Ga0068855_1000699562 | 93 |
| 309 | 3300005577 | Ga0068857_100320319 | Ga0068857_1003203193 | 93 |
| 310 | 3300005578 | Ga0068854_100620944 | Ga0068854_1006209443 | 93 |
| 311 | 3300005615 | Ga0070702_100545166 | Ga0070702_1005451661 | 93 |
| 312 | 3300005616 | Ga0068852_100056540 | Ga0068852_1000565404 | 93 |
| 313 | 3300005617 | Ga0068859_100113683 | Ga0068859_1001136832 | 93 |
| 314 | 3300005618 | Ga0068864_100140609 | Ga0068864_1001406094 | 93 |
| 315 | 3300005719 | Ga0068861_100912484 | Ga0068861_1009124842 | 93 |
| 316 | 3300005840 | Ga0068870_10035197 | Ga0068870_100351974 | 93 |
| 317 | 3300005841 | Ga0068863_100856039 | Ga0068863_1008560392 | 93 |
| 318 | 3300005842 | Ga0068858_100025098 | Ga0068858_1000250984 | 93 |
| 319 | 3300005843 | Ga0068860_101627244 | Ga0068860_1016272442 | 93 |
| 320 | 3300005844 | Ga0068862_102404794 | Ga0068862_1024047942 | 93 |
| 321 | 3300006028 | Ga0070717_10006834 | Ga0070717_1000683411 | 93 |
| 322 | 3300006028 | Ga0070717_10043513 | Ga0070717_100435133 | 93 |
| 323 | 3300006038 | Ga0075365_10684873 | Ga0075365_106848732 | 93 |
| 324 | 3300006038 | Ga0075365_10734140 | Ga0075365_107341402 | 93 |
| 325 | 3300006173 | Ga0070716_100359349 | Ga0070716_1003593492 | 93 |
| 326 | 3300006177 | Ga0075362_10059361 | Ga0075362_100593612 | 93 |
| 327 | 3300006186 | Ga0075369_10108589 | Ga0075369_101085892 | 93 |
| 328 | 3300006195 | Ga0075366_10243904 | Ga0075366_102439042 | 93 |
| 329 | 3300006237 | Ga0097621_101046761 | Ga0097621_1010467612 | 93 |
| 330 | 3300006852 | Ga0075433_11358146 | Ga0075433_113581461 | 93 |
| 331 | 3300006871 | Ga0075434_100000189 | Ga0075434_10000018914 | 93 |
| 332 | 3300006881 | Ga0068865_100383075 | Ga0068865_1003830751 | 93 |
| 333 | 3300006914 | Ga0075436_100040261 | Ga0075436_1000402614 | 93 |
| 334 | 3300006931 | Ga0097620_100113680 | Ga0097620_1001136802 | 93 |
| 335 | 3300007076 | Ga0075435_100001011 | Ga0075435_1000010117 | 93 |
| 336 | 3300009092 | Ga0105250_10237254 | Ga0105250_102372542 | 93 |
| 337 | 3300009093 | Ga0105240_10091627 | Ga0105240_100916274 | 93 |
| 338 | 3300009094 | Ga0111539_11084439 | Ga0111539_110844392 | 93 |
| 339 | 3300009098 | Ga0105245_10012419 | Ga0105245_1001241912 | 93 |
| 340 | 3300009098 | Ga0105245_10153633 | Ga0105245_101536334 | 93 |
| 341 | 3300009148 | Ga0105243_10111085 | Ga0105243_101110856 | 93 |
| 342 | 3300009176 | Ga0105242_10621253 | Ga0105242_106212532 | 93 |
| 343 | 3300009177 | Ga0105248_10089873 | Ga0105248_100898735 | 93 |
| 344 | 3300009551 | Ga0105238_10006910 | Ga0105238_100069104 | 93 |
| 345 | 3300009553 | Ga0105249_10154311 | Ga0105249_101543115 | 93 |
| 346 | 3300010375 | Ga0105239_10742212 | Ga0105239_107422122 | 93 |
| 347 | 3300011119 | Ga0105246_10001045 | Ga0105246_100010458 | 93 |
| 348 | 3300013102 | Ga0157371_10399650 | Ga0157371_103996502 | 93 |
| 349 | 3300013296 | Ga0157374_10006009 | Ga0157374_1000600916 | 93 |
| 350 | 3300013297 | Ga0157378_10150876 | Ga0157378_101508766 | 93 |
| 351 | 3300013306 | Ga0163162_10584117 | Ga0163162_105841173 | 93 |
| 352 | 3300013306 | Ga0163162_11111538 | Ga0163162_111115382 | 93 |
| 353 | 3300013308 | Ga0157375_10077649 | Ga0157375_100776494 | 93 |
| 354 | 3300014325 | Ga0163163_10001642 | Ga0163163_1000164211 | 93 |
| 355 | 3300014745 | Ga0157377_10008393 | Ga0157377_100083936 | 93 |
| 356 | 3300014968 | Ga0157379_10030343 | Ga0157379_100303432 | 93 |
| 357 | 3300014969 | Ga0157376_11429265 | Ga0157376_114292653 | 93 |
| 358 | 3300025898 | Ga0207692_10188351 | Ga0207692_101883512 | 93 |
| 359 | 3300025901 | Ga0207688_10006244 | Ga0207688_1000624411 | 93 |
| 360 | 3300025904 | Ga0207647_10331495 | Ga0207647_103314953 | 93 |
| 361 | 3300025906 | Ga0207699_10097550 | Ga0207699_100975502 | 93 |
| 362 | 3300025907 | Ga0207645_10564360 | Ga0207645_105643602 | 93 |
| 363 | 3300025908 | Ga0207643_10025546 | Ga0207643_100255464 | 93 |
| 364 | 3300025910 | Ga0207684_10902855 | Ga0207684_109028552 | 93 |
| 365 | 3300025913 | Ga0207695_10193365 | Ga0207695_101933651 | 93 |
| 366 | 3300025914 | Ga0207671_11005587 | Ga0207671_110055873 | 93 |
| 367 | 3300025917 | Ga0207660_10809604 | Ga0207660_108096042 | 93 |
| 368 | 3300025919 | Ga0207657_10001049 | Ga0207657_1000104926 | 93 |
| 369 | 3300025921 | Ga0207652_10876877 | Ga0207652_108768773 | 93 |
| 370 | 3300025924 | Ga0207694_10039435 | Ga0207694_100394356 | 93 |
| 371 | 3300025925 | Ga0207650_10472213 | Ga0207650_104722132 | 93 |
| 372 | 3300025926 | Ga0207659_10305818 | Ga0207659_103058182 | 93 |
| 373 | 3300025926 | Ga0207659_10409199 | Ga0207659_104091994 | 93 |
| 374 | 3300025927 | Ga0207687_10020792 | Ga0207687_100207922 | 93 |
| 375 | 3300025927 | Ga0207687_10110524 | Ga0207687_101105243 | 93 |
| 376 | 3300025928 | Ga0207700_10037642 | Ga0207700_100376424 | 93 |
| 377 | 3300025928 | Ga0207700_11824688 | Ga0207700_118246881 | 93 |
| 378 | 3300025929 | Ga0207664_10095178 | Ga0207664_100951785 | 93 |
| 379 | 3300025931 | Ga0207644_10160317 | Ga0207644_101603172 | 93 |
| 380 | 3300025932 | Ga0207690_10028340 | Ga0207690_100283401 | 93 |
| 381 | 3300025933 | Ga0207706_10024837 | Ga0207706_100248376 | 93 |
| 382 | 3300025935 | Ga0207709_10317500 | Ga0207709_103175002 | 93 |
| 383 | 3300025937 | Ga0207669_10935066 | Ga0207669_109350662 | 93 |
| 384 | 3300025938 | Ga0207704_10051755 | Ga0207704_100517556 | 93 |
| 385 | 3300025939 | Ga0207665_10031459 | Ga0207665_100314595 | 93 |
| 386 | 3300025940 | Ga0207691_10220183 | Ga0207691_102201833 | 93 |
| 387 | 3300025941 | Ga0207711_10061669 | Ga0207711_100616694 | 93 |
| 388 | 3300025944 | Ga0207661_10065260 | Ga0207661_100652604 | 93 |
| 389 | 3300025949 | Ga0207667_10004544 | Ga0207667_1000454421 | 93 |
| 390 | 3300025949 | Ga0207667_11580857 | Ga0207667_115808572 | 93 |
| 391 | 3300025960 | Ga0207651_10363684 | Ga0207651_103636842 | 93 |
| 392 | 3300025961 | Ga0207712_10201098 | Ga0207712_102010981 | 93 |
| 393 | 3300025981 | Ga0207640_10206862 | Ga0207640_102068622 | 93 |
| 394 | 3300026023 | Ga0207677_10002013 | Ga0207677_100020134 | 93 |
| 395 | 3300026035 | Ga0207703_10307646 | Ga0207703_103076462 | 93 |
| 396 | 3300026067 | Ga0207678_10078179 | Ga0207678_100781795 | 93 |
| 397 | 3300026075 | Ga0207708_10151155 | Ga0207708_101511552 | 93 |
| 398 | 3300026078 | Ga0207702_10368648 | Ga0207702_103686482 | 93 |
| 399 | 3300026088 | Ga0207641_10300236 | Ga0207641_103002362 | 93 |
| 400 | 3300026089 | Ga0207648_12060660 | Ga0207648_120606601 | 93 |
| 401 | 3300026095 | Ga0207676_10124554 | Ga0207676_101245544 | 93 |
| 402 | 3300026118 | Ga0207675_100547777 | Ga0207675_1005477773 | 93 |
| 403 | 3300026121 | Ga0207683_10040124 | Ga0207683_100401244 | 93 |
| 404 | 3300026142 | Ga0207698_10069789 | Ga0207698_100697892 | 93 |
| 405 | 3300028379 | Ga0268266_10091270 | Ga0268266_100912704 | 93 |
| 406 | 3300028380 | Ga0268265_11495515 | Ga0268265_114955151 | 93 |
| 407 | 3300028381 | Ga0268264_10225292 | Ga0268264_102252922 | 93 |
| 408 | 3300035083 | Ga0373926_0080961 | Ga0373926_0080961_807_1088 | 93 |
| 409 | 3300035086 | Ga0373934_0034137 | Ga0373934_0034137_737_1018 | 93 |
| 410 | 3300035086 | Ga0373934_0196210 | Ga0373934_0196210_151_432 | 93 |
| 411 | 3300035089 | Ga0373944_0050110 | Ga0373944_0050110_662_943 | 93 |
| 412 | 3300035090 | Ga0373949_0019875 | Ga0373949_0019875_1090_1371 | 93 |
| 413 | 3300035111 | Ga0373923_0058336 | Ga0373923_0058336_107_388 | 93 |
| 414 | 3300035116 | Ga0373945_0005625 | Ga0373945_0005625_2554_2835 | 93 |
| 415 | 3300035117 | Ga0373953_0234024 | Ga0373953_0234024_251_532 | 93 |
| 416 | 3300035119 | Ga0373956_0152500 | Ga0373956_0152500_736_1017 | 93 |
| 417 | 3300035119 | Ga0373956_0361785 | Ga0373956_0361785_353_634 | 93 |
| 418 | 3300035120 | Ga0373957_0287264 | Ga0373957_0287264_141_422 | 93 |
| 419 | 3300035170 | Ga0373943_0015921 | Ga0373943_0015921_2613_2894 | 93 |
| 420 | 3300035171 | Ga0373946_0017134 | Ga0373946_0017134_1077_1358 | 93 |
| 421 | 3300035410 | Ga0373924_0019913 | Ga0373924_0019913_811_1092 | 93 |
| 422 | 3300035410 | Ga0373924_0464077 | Ga0373924_0464077_30_311 | 93 |
| 423 | 3300035692 | Ga0373935_0037167 | Ga0373935_0037167_1102_1383 | 93 |
| 424 | 3300035695 | Ga0373927_0268299 | Ga0373927_0268299_390_671 | 93 |
| 425 | 3300035724 | Ga0373933_0084793 | Ga0373933_0084793_1251_1532 | 93 |
| 426 | 3300035724 | Ga0373933_0729379 | Ga0373933_0729379_129_410 | 93 |
| 427 | 3300035725 | Ga0373947_0024767 | Ga0373947_0024767_1485_1766 | 93 |
| 428 | 3300036401 | Ga0373937_1223085 | Ga0373937_1223085_14_295 | 93 |
| 429 | 3300036401 | Ga0373937_1853928 | Ga0373937_1853928_208_489 | 93 |
| 430 | 3300037068 | Ga0373925_0027481 | Ga0373925_0027481_2858_3139 | 93 |
| 431 | 3300041404 | Ga0439436_0115998 | Ga0439436_0115998_341_631 | 93 |
| 432 | 3300041512 | Ga0451853_2207647 | Ga0451853_2207647_517_807 | 93 |
| 433 | 3300045976 | Ga0466967_0985996 | Ga0466967_0985996_536_817 | 93 |
| 434 | 3300046454 | Ga0495592_0046264 | Ga0495592_0046264_1346_1627 | 93 |
| 435 | 3300046455 | Ga0495603_0195724 | Ga0495603_0195724_582_863 | 93 |
| 436 | 3300046459 | Ga0495629_0035450 | Ga0495629_0035450_477_758 | 93 |
| 437 | 3300046461 | Ga0495641_0011902 | Ga0495641_0011902_2670_2951 | 93 |
| 438 | 3300046462 | Ga0495651_0036396 | Ga0495651_0036396_2920_3201 | 93 |
| 439 | 3300046463 | Ga0495653_0015711 | Ga0495653_0015711_2654_2935 | 93 |
| 440 | 3300046472 | Ga0495580_0048722 | Ga0495580_0048722_2279_2560 | 93 |
| 441 | 3300046473 | Ga0495582_0007720 | Ga0495582_0007720_5061_5342 | 93 |
| 442 | 3300046475 | Ga0495639_0013945 | Ga0495639_0013945_707_988 | 93 |
| 443 | 3300046476 | Ga0495662_0025456 | Ga0495662_0025456_417_698 | 93 |
| 444 | 3300046511 | Ga0495608_0030505 | Ga0495608_0030505_1468_1749 | 93 |
| 445 | 3300046514 | Ga0495618_0009858 | Ga0495618_0009858_1022_1303 | 93 |
| 446 | 3300046516 | Ga0495628_0514476 | Ga0495628_0514476_523_804 | 93 |
| 447 | 3300046516 | Ga0495628_0816953 | Ga0495628_0816953_48_329 | 93 |
| 448 | 3300046517 | Ga0495630_0029648 | Ga0495630_0029648_2404_2685 | 93 |
| 449 | 3300046526 | Ga0495666_0040911 | Ga0495666_0040911_404_685 | 93 |
| 450 | 3300046531 | Ga0495665_0011188 | Ga0495665_0011188_695_976 | 93 |
| 451 | 3300046533 | Ga0495640_0167234 | Ga0495640_0167234_883_1164 | 93 |
| 452 | 3300046535 | Ga0495586_0068558 | Ga0495586_0068558_562_843 | 93 |
| 453 | 3300046536 | Ga0495587_0500866 | Ga0495587_0500866_121_402 | 93 |
| 454 | 3300046543 | Ga0495645_0619252 | Ga0495645_0619252_363_644 | 93 |
| 455 | 3300046559 | Ga0495667_0035681 | Ga0495667_0035681_2333_2614 | 93 |
| 456 | 3300046642 | Ga0495634_0011405 | Ga0495634_0011405_3845_4126 | 93 |
| 457 | 3300046674 | Ga0495588_0016392 | Ga0495588_0016392_750_1031 | 93 |
| 458 | 3300046675 | Ga0495657_0007442 | Ga0495657_0007442_911_1192 | 93 |
| 459 | 3300046675 | Ga0495657_0197132 | Ga0495657_0197132_250_531 | 93 |
| 460 | 3300046678 | Ga0495599_0086832 | Ga0495599_0086832_156_437 | 93 |
| 461 | 3300046679 | Ga0495623_0650498 | Ga0495623_0650498_141_422 | 93 |
| 462 | 3300046681 | Ga0495647_0015941 | Ga0495647_0015941_1446_1727 | 93 |
| 463 | 3300046683 | Ga0495658_0020947 | Ga0495658_0020947_2871_3152 | 93 |
| 464 | 3300046689 | Ga0495613_0004045 | Ga0495613_0004045_8020_8301 | 93 |
| 465 | 3300046690 | Ga0495624_0012687 | Ga0495624_0012687_3638_3919 | 93 |
| 466 | 3300046809 | Ga0495600_0009594 | Ga0495600_0009594_3546_3827 | 93 |
| 467 | 3300046809 | Ga0495600_0366927 | Ga0495600_0366927_429_710 | 93 |
| 468 | 3300047315 | Ga0495581_0082196 | Ga0495581_0082196_120_401 | 93 |
| 469 | 3300047317 | Ga0495604_0136713 | Ga0495604_0136713_499_780 | 93 |
| 470 | 3300047319 | Ga0495674_0053428 | Ga0495674_0053428_912_1193 | 93 |
| 471 | 3300047321 | Ga0495676_0048546 | Ga0495676_0048546_695_976 | 93 |
| 472 | 3300047322 | Ga0495680_0083088 | Ga0495680_0083088_1061_1342 | 93 |
| 473 | 3300047322 | Ga0495680_0235028 | Ga0495680_0235028_801_1082 | 93 |
| 474 | 3300047444 | Ga0495675_0303209 | Ga0495675_0303209_301_582 | 93 |
| 475 | 3300047471 | Ga0495684_0017280 | Ga0495684_0017280_539_820 | 93 |
| 476 | 3300047673 | Ga0495593_0019599 | Ga0495593_0019599_2803_3084 | 93 |
| 477 | 3300048088 | Ga0495602_0072760 | Ga0495602_0072760_1269_1550 | 93 |
| 478 | 3300048089 | Ga0495614_0011246 | Ga0495614_0011246_1266_1547 | 93 |
| 479 | 3300048903 | Ga0496100_0005810 | Ga0496100_0005810_1657_1938 | 93 |
| 480 | 3300048903 | Ga0496100_0021504 | Ga0496100_0021504_2379_2660 | 93 |
| 481 | 3300048903 | Ga0496100_0295868 | Ga0496100_0295868_695_976 | 93 |
| 482 | 3300048903 | Ga0496100_0846907 | Ga0496100_0846907_100_381 | 93 |
| 483 | 3300048904 | Ga0496101_0013420 | Ga0496101_0013420_640_921 | 93 |
| 484 | 3300048904 | Ga0496101_0028001 | Ga0496101_0028001_2122_2403 | 93 |
| 485 | 3300048904 | Ga0496101_0112882 | Ga0496101_0112882_720_1001 | 93 |
| 486 | 3300048904 | Ga0496101_0532737 | Ga0496101_0532737_578_859 | 93 |
| 487 | 3300048905 | Ga0496102_0003029 | Ga0496102_0003029_4443_4724 | 93 |
| 488 | 3300048905 | Ga0496102_0072734 | Ga0496102_0072734_273_554 | 93 |
| 489 | 3300048905 | Ga0496102_0274712 | Ga0496102_0274712_1175_1456 | 93 |
| 490 | 3300048905 | Ga0496102_1118540 | Ga0496102_1118540_109_390 | 93 |
| 491 | 3300048906 | Ga0496103_0149374 | Ga0496103_0149374_268_549 | 93 |
| 492 | 3300048906 | Ga0496103_0199016 | Ga0496103_0199016_965_1246 | 93 |
| 493 | 3300048907 | Ga0496104_0028744 | Ga0496104_0028744_3099_3380 | 93 |
| 494 | 3300048907 | Ga0496104_0038116 | Ga0496104_0038116_3560_3841 | 93 |
| 495 | 3300048908 | Ga0496105_0015043 | Ga0496105_0015043_4431_4712 | 93 |
| 496 | 3300048908 | Ga0496105_0295849 | Ga0496105_0295849_460_741 | 93 |
| 497 | 3300048908 | Ga0496105_0766906 | Ga0496105_0766906_398_679 | 93 |
| 498 | 3300048909 | Ga0496106_0036562 | Ga0496106_0036562_1022_1303 | 93 |
| 499 | 3300048909 | Ga0496106_0067259 | Ga0496106_0067259_1327_1608 | 93 |
| 500 | 3300048909 | Ga0496106_0112792 | Ga0496106_0112792_1219_1500 | 93 |
| 501 | 3300048910 | Ga0496107_0001433 | Ga0496107_0001433_8275_8556 | 93 |
| 502 | 3300048910 | Ga0496107_0165125 | Ga0496107_0165125_1336_1617 | 93 |
| 503 | 3300048910 | Ga0496107_0230152 | Ga0496107_0230152_305_586 | 93 |
| 504 | 3300048911 | Ga0496108_0003468 | Ga0496108_0003468_918_1199 | 93 |
| 505 | 3300048911 | Ga0496108_0020348 | Ga0496108_0020348_4466_4747 | 93 |
| 506 | 3300048911 | Ga0496108_0334146 | Ga0496108_0334146_321_602 | 93 |
| 507 | 3300048912 | Ga0496109_0001431 | Ga0496109_0001431_708_989 | 93 |
| 508 | 3300048912 | Ga0496109_0012514 | Ga0496109_0012514_5400_5681 | 93 |
| 509 | 3300048912 | Ga0496109_0375688 | Ga0496109_0375688_720_1001 | 93 |
| 510 | 3300048913 | Ga0496110_0000626 | Ga0496110_0000626_18526_18807 | 93 |
| 511 | 3300048913 | Ga0496110_0007505 | Ga0496110_0007505_2897_3178 | 93 |
| 512 | 3300048913 | Ga0496110_1657796 | Ga0496110_1657796_244_525 | 93 |
| 513 | 3300048914 | Ga0496111_0002176 | Ga0496111_0002176_391_672 | 93 |
| 514 | 3300048914 | Ga0496111_0121089 | Ga0496111_0121089_854_1135 | 93 |
| 515 | 3300048915 | Ga0496112_0004855 | Ga0496112_0004855_11083_11364 | 93 |
| 516 | 3300048915 | Ga0496112_0006081 | Ga0496112_0006081_9168_9449 | 93 |
| 517 | 3300048915 | Ga0496112_0650457 | Ga0496112_0650457_342_632 | 93 |
| 518 | 3300048915 | Ga0496112_0700620 | Ga0496112_0700620_581_862 | 93 |
| 519 | 3300048916 | Ga0496113_0000221 | Ga0496113_0000221_17251_17532 | 93 |
| 520 | 3300048916 | Ga0496113_0008913 | Ga0496113_0008913_1485_1766 | 93 |
| 521 | 3300048917 | Ga0496114_0016746 | Ga0496114_0016746_4630_4911 | 93 |
| 522 | 3300048917 | Ga0496114_0134835 | Ga0496114_0134835_367_648 | 93 |
| 523 | 3300048917 | Ga0496114_0287007 | Ga0496114_0287007_243_524 | 93 |
| 524 | 3300048918 | Ga0496115_0109191 | Ga0496115_0109191_1188_1469 | 93 |
| 525 | 3300048918 | Ga0496115_0220381 | Ga0496115_0220381_647_928 | 93 |
| 526 | 3300048918 | Ga0496115_1315614 | Ga0496115_1315614_136_417 | 93 |
| 527 | 3300050489 | nmdc:mga03683_100244_c1 | nmdc:mga03683_100244_c1_112_402 | 93 |
| 528 | 3300050492 | nmdc:mga0yw44_389232_c1 | nmdc:mga0yw44_389232_c1_198_488 | 93 |
| 529 | 3300050493 | nmdc:mga0k408_160517_c1 | nmdc:mga0k408_160517_c1_556_846 | 93 |
| 530 | 3300050509 | nmdc:mga0qj67_474120_c1 | nmdc:mga0qj67_474120_c1_380_670 | 93 |
| 531 | 3300050512 | nmdc:mga0n895_1334_c1 | nmdc:mga0n895_1334_c1_2861_3142 | 93 |
| 532 | 3300050513 | nmdc:mga0rr50_1039165_c1 | nmdc:mga0rr50_1039165_c1_133_414 | 93 |
| 533 | 3300050514 | nmdc:mga08x19_23125_c1 | nmdc:mga08x19_23125_c1_2179_2460 | 93 |
| 534 | 3300050515 | nmdc:mga0a205_211575_c1 | nmdc:mga0a205_211575_c1_176_457 | 93 |
| 535 | 3300053077 | Ga0495601_0060840 | Ga0495601_0060840_1267_1548 | 93 |
| 536 | 3300053077 | Ga0495601_1002352 | Ga0495601_1002352_20_301 | 93 |
| 537 | 3300053078 | Ga0495612_0126422 | Ga0495612_0126422_133_414 | 93 |
| 538 | 3300053084 | Ga0495595_0006865 | Ga0495595_0006865_2206_2487 | 93 |
| 539 | 3300053084 | Ga0495595_0082358 | Ga0495595_0082358_1120_1401 | 93 |
| 540 | 3300053085 | Ga0495619_0087758 | Ga0495619_0087758_1346_1627 | 93 |
| 541 | 3300053085 | Ga0495619_0320210 | Ga0495619_0320210_358_639 | 93 |
| 542 | 3300061734 | Ga0530510_0052208 | Ga0530510_0052208_2299_2586 | 93 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hia-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides lov protein | 0.5524 | 17 | 59 |
| 2isv-assembly1.cif.gz_B | structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate | 0.5495 | 17 | 55 |
| 3gay-assembly1.cif.gz_B | structure of giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate | 0.5495 | 17 | 55 |
| 2isv-assembly1.cif.gz_A | structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate | 0.541 | 17 | 56 |
| 5ey7-assembly1.cif.gz_B | crystal structure of fructokinase from vibrio cholerae o395 in apo form | 0.5361 | 17 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94255_26_115_1.10.225.10 | Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like | 0.6304 | 17 | 67 | 1.10.225.10 |
| af_P26616_269_564_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.6285 | 13 | 67 | 3.40.50.720 |
| af_Q9URY3_323_468_1.10.472.80 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Ypt/Rab-GAP domain of gyp1p, domain 3 | 0.6257 | 14 | 67 | 1.10.472.80 |
| 3zyvC05 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain | 0.6011 | 16 | 62 | 3.30.390.50 |
| af_Q8VY78_1_318_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.5686 | 15 | 57 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A212T3K0-F1-model_v4 | deleted | 0.9883 | 16 | 67 |
|
| AF-A0A841AF04-F1-model_v4 | DUF2277 domain-containing protein | 0.9873 | 1 | 72 |
|
| AF-A0A529FDB9-F1-model_v4 | DUF2277 domain-containing protein | 0.987 | 1 | 70 |
|
| AF-A0A387HH46-F1-model_v4 | DUF2277 domain-containing protein | 0.9845 | 16 | 67 |
|
| AF-A0A536H2R0-F1-model_v4 | DUF2277 domain-containing protein | 0.9827 | 1 | 88 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar