F461415

General Info

Members Datasets Scaffolds Average Seq Length
541 254 1082 400

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0008540|Ga0496113_0008540_2905_4230
Length 441
Sequence MKAHGEPPPSLIPPGRAECHPSPLYIATVPAPTTLNPFRVVLRHRNFRLFLIGQTLSLIGTWMQTMAEGWLALELTNSAFLVGLVATVSSIPILLFTMPAGAIVDRSDKLRIVRTAQIAFLVQASSLWLLTATHRMTIDWLLILAFLGGLIASIEIPARQAMMIDLVGRDDLPDAIALNSSGFNLARIVGPAVAAAVIARLGIAWCFFLNAVSFVAVLAGLLMMRLPPWVAPRHRTSPWQGVVQVIRYMRDXXXXRALMLMVTVYAILNAPVLALMPVVAREMFSLGAGGYGLLLSFLGIGGLCGALGLAAVGNRISRTRLLTVVSMLWPALLLTFSLTSVPSVGYALLFAIGIVMILNGAIANGLLQGLVPNELRGRVMAAYGLVVVGLAQVVGAFTGGVVAHAIGVAGAIFITSLLMAAYGVWAFLRRPELRELRERTV

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
241 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
242 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0008540 3300048916 Bacteria 6680
2 MBSR1b_contig_3312623 2162886012 Bacteria 1600
3 rootH1_10212981 3300003323 Bacteria 1526
4 Ga0070658_10012173 3300005327 Bacteria 6905
5 Ga0070683_100000429 3300005329 Bacteria 29152
6 Ga0070683_100001575 3300005329 Bacteria 17640
7 Ga0070683_100013004 3300005329 Bacteria 7246
8 Ga0070683_100027152 3300005329 Bacteria 5161
9 Ga0070683_100054284 3300005329 Bacteria 3716
10 Ga0070683_100119591 3300005329 Bacteria 2488
11 Ga0070683_100138139 3300005329 Bacteria 2308
12 Ga0070690_100057811 3300005330 Bacteria 2489
13 Ga0070690_100072599 3300005330 Bacteria 2238
14 Ga0070670_100031126 3300005331 Bacteria 4595
15 Ga0070677_10019068 3300005333 Bacteria 2480
16 Ga0068869_100014227 3300005334 Bacteria 5311
17 Ga0070666_10099571 3300005335 Bacteria 2002
18 Ga0070666_10189647 3300005335 Bacteria 1444
19 Ga0070680_100001996 3300005336 Bacteria 15020
20 Ga0070680_100002481 3300005336 Bacteria 13670
21 Ga0070680_100017215 3300005336 Bacteria 5695
22 Ga0070680_100168433 3300005336 Unclassified 1843
23 Ga0070680_100176635 3300005336 Bacteria 1798
24 Ga0070680_100252990 3300005336 Bacteria 1490
25 Ga0070682_100001884 3300005337 Bacteria 11711
26 Ga0070682_100003661 3300005337 Bacteria 8527
27 Ga0070682_100003849 3300005337 Bacteria 8332
28 Ga0070682_100004171 3300005337 Bacteria 8015
29 Ga0070660_100015055 3300005339 Bacteria 5579
30 Ga0070660_100020838 3300005339 Bacteria 4825
31 Ga0070660_100083546 3300005339 Bacteria 2509
32 Ga0070691_10000219 3300005341 Bacteria 19335
33 Ga0070691_10081019 3300005341 Unclassified 1589
34 Ga0070661_100031968 3300005344 Bacteria 3807
35 Ga0070661_100033311 3300005344 Unclassified 3731
36 Ga0070661_100040340 3300005344 Bacteria 3406
37 Ga0070661_100072123 3300005344 Bacteria 2541
38 Ga0070661_100240237 3300005344 Unclassified 1395
39 Ga0070692_10014075 3300005345 Bacteria 3747
40 Ga0070668_100049581 3300005347 Bacteria 3230
41 Ga0070669_100006004 3300005353 Bacteria 8759
42 Ga0070669_100076463 3300005353 Unclassified 2485
43 Ga0070669_100111877 3300005353 Bacteria 2073
44 Ga0070675_100007972 3300005354 Bacteria 8208
45 Ga0070675_100027083 3300005354 Bacteria 4604
46 Ga0070675_100044287 3300005354 Bacteria 3639
47 Ga0070671_100050919 3300005355 Bacteria 3445
48 Ga0070671_100059188 3300005355 Bacteria 3188
49 Ga0070671_100106317 3300005355 Bacteria 2356
50 Ga0070674_100223767 3300005356 Unclassified 1465
51 Ga0070659_100002317 3300005366 Bacteria 13560
52 Ga0070659_100003724 3300005366 Bacteria 10875
53 Ga0070659_100073180 3300005366 Bacteria 2727
54 Ga0070667_100102709 3300005367 Bacteria 2470
55 Ga0070714_100032906 3300005435 Bacteria 4331
56 Ga0070714_100251940 3300005435 Bacteria 1633
57 Ga0070713_100000457 3300005436 Bacteria 26099
58 Ga0070713_100047973 3300005436 Bacteria 3514
59 Ga0070710_10038103 3300005437 Bacteria 2638
60 Ga0070710_10140216 3300005437 Unclassified 1482
61 Ga0070701_10060261 3300005438 Bacteria 1998
62 Ga0070705_100004713 3300005440 Bacteria 6644
63 Ga0070694_100089663 3300005444 Bacteria 2155
64 Ga0070708_100084962 3300005445 Bacteria 2871
65 Ga0070708_100289715 3300005445 Bacteria 1541
66 Ga0070662_100023868 3300005457 Bacteria 4207
67 Ga0070681_10001650 3300005458 Bacteria 19913
68 Ga0070681_10006527 3300005458 Bacteria 11354
69 Ga0070681_10007313 3300005458 Bacteria 10782
70 Ga0070681_10011927 3300005458 Bacteria 8617
71 Ga0070681_10014426 3300005458 Bacteria 7864
72 Ga0070681_10014466 3300005458 Bacteria 7852
73 Ga0070681_10026752 3300005458 Bacteria 5800
74 Ga0070681_10048842 3300005458 Bacteria 4227
75 Ga0070681_10086494 3300005458 Bacteria 3088
76 Ga0070681_10143642 3300005458 Unclassified 2316
77 Ga0070681_10144266 3300005458 Unclassified 2310
78 Ga0070681_10280557 3300005458 Bacteria 1577
79 Ga0070706_100019959 3300005467 Bacteria 6179
80 Ga0070707_100003112 3300005468 Bacteria 15705
81 Ga0070707_100275069 3300005468 Unclassified 1637
82 Ga0070698_100000018 3300005471 Bacteria 107758
83 Ga0070698_100003611 3300005471 Bacteria 17000
84 Ga0070698_100018438 3300005471 Bacteria 7348
85 Ga0070679_100000866 3300005530 Bacteria 26295
86 Ga0070679_100001055 3300005530 Bacteria 24027
87 Ga0070679_100010507 3300005530 Bacteria 8782
88 Ga0070679_100015528 3300005530 Bacteria 7317
89 Ga0070679_100019955 3300005530 Bacteria 6529
90 Ga0070679_100033634 3300005530 Bacteria 5076
91 Ga0070679_100069686 3300005530 Bacteria 3508
92 Ga0070679_100073480 3300005530 Bacteria 3411
93 Ga0070679_100159880 3300005530 Bacteria 2227
94 Ga0070679_100314597 3300005530 Bacteria 1515
95 Ga0070684_100000975 3300005535 Bacteria 20408
96 Ga0070684_100004192 3300005535 Bacteria 10922
97 Ga0070684_100010409 3300005535 Bacteria 7368
98 Ga0070684_100030860 3300005535 Bacteria 4558
99 Ga0070684_100043478 3300005535 Unclassified 3880
100 Ga0070684_100083512 3300005535 Bacteria 2830
101 Ga0070684_100184290 3300005535 Bacteria 1898
102 Ga0070684_100212569 3300005535 Bacteria 1763
103 Ga0068853_100039674 3300005539 Bacteria 4016
104 Ga0068853_100095008 3300005539 Bacteria 2628
105 Ga0068853_100200288 3300005539 Unclassified 1817
106 Ga0070672_100039936 3300005543 Unclassified 3597
107 Ga0070672_100077285 3300005543 Bacteria 2661
108 Ga0070672_100156340 3300005543 Bacteria 1889
109 Ga0070695_100016818 3300005545 Bacteria 4432
110 Ga0070696_100002265 3300005546 Bacteria 12688
111 Ga0070693_100002286 3300005547 Bacteria 8782
112 Ga0070693_100013318 3300005547 Bacteria 4187
113 Ga0070693_100061851 3300005547 Bacteria 2178
114 Ga0070704_100073243 3300005549 Bacteria 2495
115 Ga0070704_100095543 3300005549 Bacteria 2226
116 Ga0068855_100007857 3300005563 Bacteria 12888
117 Ga0068855_100058123 3300005563 Bacteria 4531
118 Ga0068855_100064358 3300005563 Bacteria 4277
119 Ga0068855_100276530 3300005563 Bacteria 1866
120 Ga0070664_100007779 3300005564 Bacteria 8655
121 Ga0070664_100027365 3300005564 Bacteria 4738
122 Ga0070664_100042618 3300005564 Unclassified 3831
123 Ga0070664_100079029 3300005564 Bacteria 2830
124 Ga0070664_100152699 3300005564 Bacteria 2039
125 Ga0070664_100166987 3300005564 Bacteria 1950
126 Ga0070664_100172432 3300005564 Bacteria 1919
127 Ga0068857_100002489 3300005577 Bacteria 15064
128 Ga0068857_100003542 3300005577 Bacteria 13052
129 Ga0068857_100053694 3300005577 Bacteria 3574
130 Ga0068854_100066925 3300005578 Bacteria 2616
131 Ga0068856_100002052 3300005614 Bacteria 20880
132 Ga0068856_100075475 3300005614 Unclassified 3339
133 Ga0070702_100007650 3300005615 Bacteria 5181
134 Ga0068852_100029191 3300005616 Bacteria 4527
135 Ga0068852_100117741 3300005616 Bacteria 2426
136 Ga0068859_100010712 3300005617 Bacteria 9229
137 Ga0068859_100060568 3300005617 Bacteria 3814
138 Ga0068859_100153842 3300005617 Bacteria 2376
139 Ga0068864_100018061 3300005618 Bacteria 5887
140 Ga0068864_100330966 3300005618 Bacteria 1433
141 Ga0068851_10015325 3300005834 Bacteria 3651
142 Ga0068851_10043062 3300005834 Bacteria 2275
143 Ga0068870_10046990 3300005840 Bacteria 2266
144 Ga0068863_100017061 3300005841 Bacteria 6964
145 Ga0068858_100157736 3300005842 Bacteria 2135
146 Ga0068860_100024437 3300005843 Bacteria 5838
147 Ga0068862_100027697 3300005844 Bacteria 4770
148 Ga0068862_100069736 3300005844 Bacteria 3034
149 Ga0068862_100174662 3300005844 Unclassified 1925
150 Ga0068862_100282742 3300005844 Bacteria 1521
151 Ga0081455_10091381 3300005937 Bacteria 2465
152 Ga0081540_1021462 3300005983 Bacteria 3843
153 Ga0081539_10000354 3300005985 Bacteria 100885
154 Ga0070712_100009011 3300006175 Bacteria 6283
155 Ga0097621_100123104 3300006237 Bacteria 2201
156 Ga0068871_100003795 3300006358 Bacteria 10411
157 Ga0068871_100199068 3300006358 Bacteria 1728
158 Ga0075428_100088266 3300006844 Bacteria 3382
159 Ga0075430_100056881 3300006846 Unclassified 3289
160 Ga0075430_100071492 3300006846 Bacteria 2910
161 Ga0075431_100030254 3300006847 Bacteria 5577
162 Ga0075431_100183104 3300006847 Bacteria 2149
163 Ga0075431_100303259 3300006847 Bacteria 1613
164 Ga0075433_10005651 3300006852 Bacteria 9827
165 Ga0075433_10006595 3300006852 Bacteria 9189
166 Ga0075433_10012807 3300006852 Bacteria 6794
167 Ga0075433_10089341 3300006852 Bacteria 2723
168 Ga0075434_100005356 3300006871 Bacteria 11673
169 Ga0075429_100017454 3300006880 Bacteria 6205
170 Ga0075429_100039050 3300006880 Bacteria 4132
171 Ga0075429_100098677 3300006880 Bacteria 2548
172 Ga0068865_100018231 3300006881 Bacteria 4528
173 Ga0075436_100001457 3300006914 Bacteria 16089
174 Ga0075436_100016547 3300006914 Bacteria 5049
175 Ga0075436_100044067 3300006914 Bacteria 3076
176 Ga0097620_100010712 3300006931 Bacteria 9229
177 Ga0097620_100060570 3300006931 Bacteria 3814
178 Ga0097620_100153844 3300006931 Bacteria 2376
179 Ga0075435_100020937 3300007076 Bacteria 5022
180 Ga0075435_100225872 3300007076 Bacteria 1590
181 Ga0075435_100261186 3300007076 Bacteria 1476
182 Ga0099794_10009748 3300007265 Bacteria 4052
183 Ga0105240_10046499 3300009093 Bacteria 5499
184 Ga0105240_10050534 3300009093 Bacteria 5240
185 Ga0105240_10232274 3300009093 Bacteria 2143
186 Ga0111539_10002395 3300009094 Bacteria 24918
187 Ga0111539_10052347 3300009094 Bacteria 4860
188 Ga0111539_10060079 3300009094 Bacteria 4506
189 Ga0105245_10010645 3300009098 Bacteria 8000
190 Ga0105245_10042296 3300009098 Bacteria 4065
191 Ga0105245_10055461 3300009098 Bacteria 3559
192 Ga0114129_10005598 3300009147 Bacteria 17776
193 Ga0114129_10019984 3300009147 Bacteria 9534
194 Ga0114129_10084675 3300009147 Bacteria 4401
195 Ga0114129_10134101 3300009147 Bacteria 3399
196 Ga0114129_10262500 3300009147 Bacteria 2314
197 Ga0105241_10000100 3300009174 Bacteria 63013
198 Ga0105241_10018730 3300009174 Bacteria 5099
199 Ga0105241_10131505 3300009174 Bacteria 2027
200 Ga0105242_10002377 3300009176 Bacteria 14838
201 Ga0105242_10048246 3300009176 Bacteria 3461
202 Ga0105242_10151774 3300009176 Unclassified 2020
203 Ga0105248_10003991 3300009177 Bacteria 16313
204 Ga0105248_10018493 3300009177 Bacteria 7701
205 Ga0105248_10041515 3300009177 Bacteria 5157
206 Ga0105248_10082137 3300009177 Bacteria 3623
207 Ga0105248_10150139 3300009177 Bacteria 2629
208 Ga0105248_10230944 3300009177 Bacteria 2083
209 Ga0105238_10069649 3300009551 Bacteria 3518
210 Ga0105238_10193974 3300009551 Bacteria 2007
211 Ga0105249_10238557 3300009553 Unclassified 1797
212 Ga0105246_10002895 3300011119 Bacteria 10386
213 Ga0157373_10005224 3300013100 Bacteria 9750
214 Ga0157373_10009909 3300013100 Bacteria 7024
215 Ga0157373_10028495 3300013100 Bacteria 4029
216 Ga0157373_10032063 3300013100 Bacteria 3783
217 Ga0157373_10085385 3300013100 Bacteria 2225
218 Ga0157370_10002501 3300013104 Bacteria 22161
219 Ga0157370_10064099 3300013104 Unclassified 3479
220 Ga0157370_10065646 3300013104 Unclassified 3434
221 Ga0157369_10148232 3300013105 Bacteria 2481
222 Ga0157369_10261164 3300013105 Bacteria 1806
223 Ga0157369_10292523 3300013105 Bacteria 1695
224 Ga0157374_10047696 3300013296 Bacteria 3973
225 Ga0157374_10074605 3300013296 Bacteria 3204
226 Ga0157378_10076018 3300013297 Bacteria 3025
227 Ga0163162_10204366 3300013306 Bacteria 2104
228 Ga0157372_10003954 3300013307 Bacteria 15914
229 Ga0157372_10007712 3300013307 Bacteria 11443
230 Ga0157372_10024696 3300013307 Bacteria 6532
231 Ga0157372_10056402 3300013307 Bacteria 4389
232 Ga0157372_10091841 3300013307 Bacteria 3453
233 Ga0157372_10148325 3300013307 Unclassified 2705
234 Ga0157372_10149204 3300013307 Bacteria 2697
235 Ga0157375_10010264 3300013308 Bacteria 8241
236 Ga0157375_10023505 3300013308 Bacteria 5689
237 Ga0157375_10029152 3300013308 Bacteria 5186
238 Ga0157375_10035367 3300013308 Bacteria 4768
239 Ga0157375_10170402 3300013308 Bacteria 2324
240 Ga0163163_10038263 3300014325 Bacteria 4674
241 Ga0157377_10024008 3300014745 Bacteria 3238
242 Ga0157376_10027890 3300014969 Bacteria 4482
243 Ga0213876_10003936 3300021384 Bacteria 8386
244 Ga0207656_10029244 3300025321 Unclassified 2268
245 Ga0207680_10037198 3300025903 Bacteria 2809
246 Ga0207647_10105148 3300025904 Unclassified 1672
247 Ga0207699_10000707 3300025906 Bacteria 15915
248 Ga0207645_10080812 3300025907 Bacteria 2084
249 Ga0207645_10124579 3300025907 Unclassified 1674
250 Ga0207643_10057087 3300025908 Bacteria 2222
251 Ga0207705_10000670 3300025909 Bacteria 28487
252 Ga0207705_10014887 3300025909 Bacteria 5594
253 Ga0207705_10171801 3300025909 Bacteria 1632
254 Ga0207684_10018254 3300025910 Bacteria 6007
255 Ga0207684_10018997 3300025910 Bacteria 5880
256 Ga0207684_10073311 3300025910 Bacteria 2907
257 Ga0207654_10016668 3300025911 Bacteria 3829
258 Ga0207707_10000822 3300025912 Bacteria 30446
259 Ga0207707_10001106 3300025912 Bacteria 25637
260 Ga0207707_10019103 3300025912 Bacteria 5981
261 Ga0207707_10036962 3300025912 Bacteria 4267
262 Ga0207707_10070236 3300025912 Bacteria 3052
263 Ga0207707_10075260 3300025912 Bacteria 2945
264 Ga0207695_10002009 3300025913 Bacteria 31390
265 Ga0207695_10023937 3300025913 Bacteria 6888
266 Ga0207695_10251949 3300025913 Unclassified 1665
267 Ga0207693_10005682 3300025915 Bacteria 10369
268 Ga0207693_10028306 3300025915 Bacteria 4428
269 Ga0207660_10008802 3300025917 Bacteria 6525
270 Ga0207660_10219184 3300025917 Bacteria 1493
271 Ga0207662_10004923 3300025918 Bacteria 7060
272 Ga0207662_10050335 3300025918 Bacteria 2474
273 Ga0207657_10001978 3300025919 Bacteria 22123
274 Ga0207657_10014269 3300025919 Bacteria 7767
275 Ga0207657_10071220 3300025919 Bacteria 2944
276 Ga0207657_10095870 3300025919 Bacteria 2468
277 Ga0207649_10019863 3300025920 Bacteria 3846
278 Ga0207649_10024748 3300025920 Bacteria 3493
279 Ga0207649_10072231 3300025920 Bacteria 2207
280 Ga0207649_10077829 3300025920 Bacteria 2138
281 Ga0207649_10232922 3300025920 Unclassified 1318
282 Ga0207652_10001406 3300025921 Bacteria 21353
283 Ga0207652_10009561 3300025921 Bacteria 7798
284 Ga0207652_10009770 3300025921 Bacteria 7722
285 Ga0207652_10012300 3300025921 Bacteria 6912
286 Ga0207652_10083907 3300025921 Bacteria 2790
287 Ga0207652_10097804 3300025921 Bacteria 2588
288 Ga0207652_10108180 3300025921 Bacteria 2463
289 Ga0207646_10003599 3300025922 Bacteria 17369
290 Ga0207646_10101343 3300025922 Bacteria 2581
291 Ga0207681_10026329 3300025923 Bacteria 3750
292 Ga0207694_10131738 3300025924 Bacteria 2005
293 Ga0207650_10016939 3300025925 Bacteria 5097
294 Ga0207650_10143134 3300025925 Bacteria 1881
295 Ga0207687_10096814 3300025927 Bacteria 2164
296 Ga0207664_10004807 3300025929 Bacteria 9182
297 Ga0207664_10018054 3300025929 Bacteria 5184
298 Ga0207644_10020523 3300025931 Bacteria 4493
299 Ga0207644_10092151 3300025931 Bacteria 2261
300 Ga0207690_10006901 3300025932 Bacteria 6734
301 Ga0207690_10021208 3300025932 Bacteria 4025
302 Ga0207706_10002611 3300025933 Bacteria 17546
303 Ga0207706_10018663 3300025933 Bacteria 6241
304 Ga0207706_10058805 3300025933 Bacteria 3385
305 Ga0207686_10042376 3300025934 Bacteria 2782
306 Ga0207704_10008021 3300025938 Bacteria 5023
307 Ga0207704_10040241 3300025938 Bacteria 2730
308 Ga0207665_10009491 3300025939 Bacteria 6390
309 Ga0207691_10024650 3300025940 Bacteria 5657
310 Ga0207691_10033076 3300025940 Bacteria 4817
311 Ga0207691_10053614 3300025940 Bacteria 3681
312 Ga0207711_10037887 3300025941 Unclassified 4098
313 Ga0207711_10069623 3300025941 Bacteria 3050
314 Ga0207689_10046742 3300025942 Unclassified 3576
315 Ga0207661_10000363 3300025944 Bacteria 29142
316 Ga0207661_10001020 3300025944 Bacteria 18559
317 Ga0207661_10001219 3300025944 Bacteria 17189
318 Ga0207661_10090429 3300025944 Bacteria 2549
319 Ga0207661_10143515 3300025944 Bacteria 2057
320 Ga0207679_10002053 3300025945 Bacteria 12503
321 Ga0207679_10033744 3300025945 Bacteria 3604
322 Ga0207679_10037986 3300025945 Unclassified 3428
323 Ga0207679_10043120 3300025945 Bacteria 3246
324 Ga0207679_10075785 3300025945 Bacteria 2554
325 Ga0207679_10134516 3300025945 Bacteria 1989
326 Ga0207679_10144191 3300025945 Bacteria 1929
327 Ga0207679_10146124 3300025945 Bacteria 1918
328 Ga0207679_10167086 3300025945 Bacteria 1807
329 Ga0207658_10102251 3300025986 Bacteria 2247
330 Ga0207658_10169512 3300025986 Bacteria 1797
331 Ga0207703_10108269 3300026035 Bacteria 2367
332 Ga0207639_10152978 3300026041 Bacteria 1934
333 Ga0207678_10003013 3300026067 Bacteria 15231
334 Ga0207708_10146616 3300026075 Unclassified 1855
335 Ga0207702_10062168 3300026078 Bacteria 3187
336 Ga0207702_10140644 3300026078 Bacteria 2184
337 Ga0207641_10058029 3300026088 Unclassified 3293
338 Ga0207648_10032753 3300026089 Bacteria 4586
339 Ga0207648_10047956 3300026089 Bacteria 3742
340 Ga0207676_10005668 3300026095 Bacteria 8841
341 Ga0207674_10001269 3300026116 Bacteria 32986
342 Ga0207674_10004648 3300026116 Bacteria 16486
343 Ga0207674_10006919 3300026116 Bacteria 13285
344 Ga0207674_10015375 3300026116 Bacteria 8408
345 Ga0207675_100138097 3300026118 Bacteria 2314
346 Ga0207683_10206819 3300026121 Unclassified 1785
347 Ga0207698_10168339 3300026142 Unclassified 1926
348 Ga0209998_10001323 3300027717 Bacteria 6026
349 Ga0207428_10000238 3300027907 Bacteria 75423
350 Ga0268265_10056887 3300028380 Bacteria 2978
351 Ga0268265_10139786 3300028380 Bacteria 2026
352 Ga0307408_100085986 3300031548 Bacteria 2363
353 Ga0307408_100230193 3300031548 Bacteria 1517
354 Ga0307405_10000678 3300031731 Bacteria 13188
355 Ga0307405_10025935 3300031731 Bacteria 3372
356 Ga0307413_10002547 3300031824 Bacteria 7440
357 Ga0307413_10041384 3300031824 Bacteria 2697
358 Ga0307413_10049140 3300031824 Bacteria 2526
359 Ga0307410_10009719 3300031852 Bacteria 5409
360 Ga0307410_10016662 3300031852 Bacteria 4391
361 Ga0307410_10050817 3300031852 Bacteria 2790
362 Ga0307410_10057105 3300031852 Bacteria 2656
363 Ga0307410_10165652 3300031852 Bacteria 1660
364 Ga0307406_10007554 3300031901 Bacteria 6033
365 Ga0307406_10112512 3300031901 Bacteria 1877
366 Ga0307406_10146152 3300031901 Bacteria 1680
367 Ga0307406_10217869 3300031901 Bacteria 1417
368 Ga0307407_10003358 3300031903 Bacteria 6547
369 Ga0307407_10005101 3300031903 Bacteria 5660
370 Ga0307412_10016731 3300031911 Bacteria 4375
371 Ga0307412_10054623 3300031911 Bacteria 2652
372 Ga0307409_100002889 3300031995 Bacteria 9107
373 Ga0307409_100005584 3300031995 Bacteria 7270
374 Ga0307409_100052446 3300031995 Unclassified 3127
375 Ga0307409_100099707 3300031995 Bacteria 2406
376 Ga0307416_100000330 3300032002 Bacteria 24515
377 Ga0307416_100214510 3300032002 Bacteria 1839
378 Ga0307416_100366227 3300032002 Bacteria 1465
379 Ga0307414_10002502 3300032004 Bacteria 9637
380 Ga0307414_10073330 3300032004 Bacteria 2476
381 Ga0307414_10137354 3300032004 Bacteria 1908
382 Ga0307411_10007746 3300032005 Bacteria 5502
383 Ga0307411_10047928 3300032005 Bacteria 2765
384 Ga0307415_100001175 3300032126 Bacteria 12238
385 Ga0307415_100002723 3300032126 Bacteria 8829
386 Ga0307415_100048362 3300032126 Bacteria 2870
387 Ga0307415_100106304 3300032126 Bacteria 2071
388 Ga0307415_100141604 3300032126 Bacteria 1838
389 Ga0373948_0008968 3300034817 Bacteria 1716
390 Ga0373934_0000896 3300035086 Bacteria 10746
391 Ga0373934_0030040 3300035086 Unclassified 2124
392 Ga0373940_0006438 3300035088 Bacteria 2604
393 Ga0373944_0003412 3300035089 Bacteria 4096
394 Ga0373932_0018802 3300035112 Bacteria 1792
395 Ga0373939_0005075 3300035114 Bacteria 3127
396 Ga0373939_0042556 3300035114 Unclassified 1374
397 Ga0373954_0006439 3300035118 Bacteria 5121
398 Ga0373956_0001722 3300035119 Bacteria 9022
399 Ga0373956_0094553 3300035119 Bacteria 1381
400 Ga0373943_0002907 3300035170 Bacteria 7771
401 Ga0373955_0000160 3300035172 Bacteria 27163
402 Ga0373955_0073099 3300035172 Bacteria 1921
403 Ga0373924_0013275 3300035410 Bacteria 3093
404 Ga0373931_0055759 3300035691 Bacteria 2116
405 Ga0373931_0082821 3300035691 Bacteria 1774
406 Ga0373927_0001244 3300035695 Bacteria 19325
407 Ga0373933_0001869 3300035724 Bacteria 12161
408 Ga0373933_0083875 3300035724 Unclassified 1957
409 Ga0373947_0051084 3300035725 Bacteria 2487
410 Ga0373937_0001247 3300036401 Bacteria 21413
411 Ga0373937_0201757 3300036401 Unclassified 1869
412 Ga0373925_0005487 3300037068 Bacteria 9438
413 Ga0395899_0091568 3300037312 Bacteria 2203
414 Ga0395900_0024187 3300037418 Bacteria 6219
415 Ga0395901_0002769 3300038443 Bacteria 17666
416 Ga0242420_003805 3300038996 Unclassified 2249
417 Ga0436365_1263854 3300039437 Bacteria 7200
418 Ga0439439_0001434 3300041406 Bacteria 4743
419 Ga0439446_0031047 3300042156 Bacteria 1546
420 Ga0466966_0041076 3300044684 Bacteria 2974
421 Ga0466966_0068830 3300044684 Bacteria 2221
422 Ga0466957_0179625 3300044842 Unclassified 1382
423 Ga0466959_0050347 3300045049 Bacteria 3058
424 Ga0451576_0232302 3300045051 Bacteria 1926
425 Ga0495592_0002403 3300046454 Bacteria 13197
426 Ga0495592_0085154 3300046454 Unclassified 2279
427 Ga0495629_0004285 3300046459 Bacteria 10693
428 Ga0495629_0010765 3300046459 Bacteria 6653
429 Ga0495629_0037070 3300046459 Bacteria 3437
430 Ga0495651_0002411 3300046462 Bacteria 14439
431 Ga0495653_0000484 3300046463 Bacteria 30830
432 Ga0495653_0036083 3300046463 Bacteria 3897
433 Ga0495580_0003742 3300046472 Bacteria 12880
434 Ga0495580_0004262 3300046472 Bacteria 12033
435 Ga0495639_0000120 3300046475 Bacteria 39851
436 Ga0495639_0005908 3300046475 Bacteria 5266
437 Ga0495662_0020629 3300046476 Unclassified 3189
438 Ga0495664_0028473 3300046477 Bacteria 3263
439 Ga0495594_0003626 3300046499 Bacteria 7941
440 Ga0495594_0011231 3300046499 Bacteria 4652
441 Ga0495608_0000694 3300046511 Bacteria 23357
442 Ga0495618_0096937 3300046514 Bacteria 1886
443 Ga0495628_0000949 3300046516 Bacteria 26612
444 Ga0495628_0015764 3300046516 Bacteria 6309
445 Ga0495630_0000163 3300046517 Bacteria 52076
446 Ga0495630_0029989 3300046517 Bacteria 4044
447 Ga0495643_0070667 3300046522 Bacteria 1833
448 Ga0495652_0000395 3300046529 Bacteria 51356
449 Ga0495652_0004855 3300046529 Bacteria 12770
450 Ga0495665_0000436 3300046531 Bacteria 21158
451 Ga0495665_0016781 3300046531 Unclassified 3942
452 Ga0495665_0129153 3300046531 Bacteria 1323
453 Ga0495586_0085595 3300046535 Unclassified 1737
454 Ga0495587_0004293 3300046536 Bacteria 9415
455 Ga0495587_0004959 3300046536 Bacteria 8723
456 Ga0495645_0013851 3300046543 Bacteria 5715
457 Ga0495667_0000423 3300046559 Bacteria 27174
458 Ga0495667_0074617 3300046559 Bacteria 2208
459 Ga0495634_0109511 3300046642 Bacteria 1777
460 Ga0495635_0000264 3300046663 Bacteria 33694
461 Ga0495588_0000771 3300046674 Bacteria 14504
462 Ga0495657_0000225 3300046675 Bacteria 51076
463 Ga0495599_0001034 3300046678 Bacteria 15628
464 Ga0495623_0000290 3300046679 Bacteria 32909
465 Ga0495623_0021020 3300046679 Bacteria 4217
466 Ga0495623_0100727 3300046679 Unclassified 1760
467 Ga0495646_0000691 3300046680 Bacteria 18594
468 Ga0495658_0000101 3300046683 Bacteria 44981
469 Ga0495613_0001866 3300046689 Bacteria 16008
470 Ga0495613_0034675 3300046689 Unclassified 3747
471 Ga0495613_0052140 3300046689 Bacteria 3014
472 Ga0495600_0000224 3300046809 Bacteria 31265
473 Ga0495600_0071346 3300046809 Bacteria 2269
474 Ga0495581_0007736 3300047315 Bacteria 6219
475 Ga0495581_0015989 3300047315 Bacteria 4360
476 Ga0495581_0077117 3300047315 Bacteria 1928
477 Ga0495604_0000523 3300047317 Bacteria 33858
478 Ga0495604_0017051 3300047317 Bacteria 5810
479 Ga0495680_0003159 3300047322 Bacteria 16402
480 Ga0495680_0107664 3300047322 Bacteria 2070
481 Ga0495675_0002427 3300047444 Bacteria 11139
482 Ga0495675_0002888 3300047444 Bacteria 10314
483 Ga0495675_0003283 3300047444 Bacteria 9719
484 Ga0495675_0057622 3300047444 Bacteria 2464
485 Ga0495684_0000453 3300047471 Bacteria 33520
486 Ga0495684_0130082 3300047471 Unclassified 1891
487 Ga0495593_0000066 3300047673 Bacteria 44304
488 Ga0495602_0000550 3300048088 Bacteria 35034
489 Ga0495602_0007834 3300048088 Bacteria 11169
490 Ga0495614_0000001 3300048089 Bacteria 137656
491 Ga0496100_0202206 3300048903 Bacteria 1448
492 Ga0496104_0127535 3300048907 Bacteria 2443
493 Ga0496107_0112329 3300048910 Bacteria 2003
494 Ga0496109_0033897 3300048912 Bacteria 4596
495 Ga0496111_0139000 3300048914 Bacteria 1800
496 Ga0496112_0001127 3300048915 Bacteria 19878
497 Ga0496112_0061479 3300048915 Bacteria 3702
498 Ga0496115_0000688 3300048918 Bacteria 25056
499 Ga0501202_000206 3300049652 Bacteria 7585
500 Ga0501216_003605 3300049660 Bacteria 2265
501 Ga0501227_006593 3300049665 Bacteria 2493
502 Ga0501235_000030 3300049669 Bacteria 24020
503 Ga0501249_008950 3300049679 Bacteria 2080
504 Ga0501259_001249 3300049688 Bacteria 4246
505 Ga0501221_001576 3300049704 Bacteria 3788
506 Ga0501225_0001001 3300049705 Bacteria 8864
507 Ga0501234_000253 3300049707 Bacteria 7756
508 Ga0501245_005709 3300049708 Bacteria 1728
509 Ga0501081_0243267 3300049743 Bacteria 1312
510 Ga0501268_000064 3300049765 Bacteria 8311
511 nmdc:mga05p37_39970_c1 3300050507 Bacteria 5760
512 nmdc:mga05p37_69996_c1 3300050507 Bacteria 4316
513 nmdc:mga09592_10863_c1 3300050508 Bacteria 7410
514 nmdc:mga09592_15067_c1 3300050508 Bacteria 6314
515 nmdc:mga09592_36797_c1 3300050508 Bacteria 4102
516 nmdc:mga09592_94516_c1 3300050508 Bacteria 2557
517 nmdc:mga06r32_138624_c1 3300050510 Bacteria 2407
518 nmdc:mga06r32_290941_c1 3300050510 Unclassified 1620
519 nmdc:mga06r32_63275_c1 3300050510 Bacteria 3566
520 nmdc:mga06r32_75061_c1 3300050510 Unclassified 3280
521 nmdc:mga0n895_102559_c1 3300050512 Bacteria 2872
522 nmdc:mga0n895_16784_c1 3300050512 Bacteria 6728
523 nmdc:mga0n895_18331_c1 3300050512 Bacteria 6474
524 nmdc:mga0n895_20827_c1 3300050512 Bacteria 6125
525 nmdc:mga0n895_58342_c1 3300050512 Unclassified 3805
526 nmdc:mga0rr50_72390_c1 3300050513 Bacteria 2632
527 nmdc:mga08x19_171454_c1 3300050514 Bacteria 1478
528 nmdc:mga08x19_17209_c1 3300050514 Bacteria 4420
529 nmdc:mga08x19_17632_c1 3300050514 Bacteria 4372
530 nmdc:mga08x19_88964_c1 3300050514 Bacteria 2036
531 nmdc:mga0a205_106766_c1 3300050515 Bacteria 2698
532 nmdc:mga0a205_1105_c1 3300050515 Bacteria 22367
533 nmdc:mga0a205_136152_c1 3300050515 Bacteria 2357
534 nmdc:mga0a205_65632_c1 3300050515 Bacteria 3507
535 nmdc:mga0a205_67527_c1 3300050515 Bacteria 3454
536 nmdc:mga0a205_7125_c1 3300050515 Bacteria 10106
537 Ga0495601_0002461 3300053077 Bacteria 10525
538 Ga0495601_0061396 3300053077 Unclassified 2386
539 Ga0495612_0001172 3300053078 Bacteria 10788
540 Ga0495612_0014887 3300053078 Unclassified 3121
541 Ga0495619_0013301 3300053085 Bacteria 5184
542 Ga0496113_0008540
543 MBSR1b_contig_3312623
544 rootH1_10212981
545 Ga0070658_10012173
546 Ga0070683_100000429
547 Ga0070683_100001575
548 Ga0070683_100013004
549 Ga0070683_100027152
550 Ga0070683_100054284
551 Ga0070683_100119591
552 Ga0070683_100138139
553 Ga0070690_100057811
554 Ga0070690_100072599
555 Ga0070670_100031126
556 Ga0070677_10019068
557 Ga0068869_100014227
558 Ga0070666_10099571
559 Ga0070666_10189647
560 Ga0070680_100001996
561 Ga0070680_100002481
562 Ga0070680_100017215
563 Ga0070680_100168433
564 Ga0070680_100176635
565 Ga0070680_100252990
566 Ga0070682_100001884
567 Ga0070682_100003661
568 Ga0070682_100003849
569 Ga0070682_100004171
570 Ga0070660_100015055
571 Ga0070660_100020838
572 Ga0070660_100083546
573 Ga0070691_10000219
574 Ga0070691_10081019
575 Ga0070661_100031968
576 Ga0070661_100033311
577 Ga0070661_100040340
578 Ga0070661_100072123
579 Ga0070661_100240237
580 Ga0070692_10014075
581 Ga0070668_100049581
582 Ga0070669_100006004
583 Ga0070669_100076463
584 Ga0070669_100111877
585 Ga0070675_100007972
586 Ga0070675_100027083
587 Ga0070675_100044287
588 Ga0070671_100050919
589 Ga0070671_100059188
590 Ga0070671_100106317
591 Ga0070674_100223767
592 Ga0070659_100002317
593 Ga0070659_100003724
594 Ga0070659_100073180
595 Ga0070667_100102709
596 Ga0070714_100032906
597 Ga0070714_100251940
598 Ga0070713_100000457
599 Ga0070713_100047973
600 Ga0070710_10038103
601 Ga0070710_10140216
602 Ga0070701_10060261
603 Ga0070705_100004713
604 Ga0070694_100089663
605 Ga0070708_100084962
606 Ga0070708_100289715
607 Ga0070662_100023868
608 Ga0070681_10001650
609 Ga0070681_10006527
610 Ga0070681_10007313
611 Ga0070681_10011927
612 Ga0070681_10014426
613 Ga0070681_10014466
614 Ga0070681_10026752
615 Ga0070681_10048842
616 Ga0070681_10086494
617 Ga0070681_10143642
618 Ga0070681_10144266
619 Ga0070681_10280557
620 Ga0070706_100019959
621 Ga0070707_100003112
622 Ga0070707_100275069
623 Ga0070698_100000018
624 Ga0070698_100003611
625 Ga0070698_100018438
626 Ga0070679_100000866
627 Ga0070679_100001055
628 Ga0070679_100010507
629 Ga0070679_100015528
630 Ga0070679_100019955
631 Ga0070679_100033634
632 Ga0070679_100069686
633 Ga0070679_100073480
634 Ga0070679_100159880
635 Ga0070679_100314597
636 Ga0070684_100000975
637 Ga0070684_100004192
638 Ga0070684_100010409
639 Ga0070684_100030860
640 Ga0070684_100043478
641 Ga0070684_100083512
642 Ga0070684_100184290
643 Ga0070684_100212569
644 Ga0068853_100039674
645 Ga0068853_100095008
646 Ga0068853_100200288
647 Ga0070672_100039936
648 Ga0070672_100077285
649 Ga0070672_100156340
650 Ga0070695_100016818
651 Ga0070696_100002265
652 Ga0070693_100002286
653 Ga0070693_100013318
654 Ga0070693_100061851
655 Ga0070704_100073243
656 Ga0070704_100095543
657 Ga0068855_100007857
658 Ga0068855_100058123
659 Ga0068855_100064358
660 Ga0068855_100276530
661 Ga0070664_100007779
662 Ga0070664_100027365
663 Ga0070664_100042618
664 Ga0070664_100079029
665 Ga0070664_100152699
666 Ga0070664_100166987
667 Ga0070664_100172432
668 Ga0068857_100002489
669 Ga0068857_100003542
670 Ga0068857_100053694
671 Ga0068854_100066925
672 Ga0068856_100002052
673 Ga0068856_100075475
674 Ga0070702_100007650
675 Ga0068852_100029191
676 Ga0068852_100117741
677 Ga0068859_100010712
678 Ga0068859_100060568
679 Ga0068859_100153842
680 Ga0068864_100018061
681 Ga0068864_100330966
682 Ga0068851_10015325
683 Ga0068851_10043062
684 Ga0068870_10046990
685 Ga0068863_100017061
686 Ga0068858_100157736
687 Ga0068860_100024437
688 Ga0068862_100027697
689 Ga0068862_100069736
690 Ga0068862_100174662
691 Ga0068862_100282742
692 Ga0081455_10091381
693 Ga0081540_1021462
694 Ga0081539_10000354
695 Ga0070712_100009011
696 Ga0097621_100123104
697 Ga0068871_100003795
698 Ga0068871_100199068
699 Ga0075428_100088266
700 Ga0075430_100056881
701 Ga0075430_100071492
702 Ga0075431_100030254
703 Ga0075431_100183104
704 Ga0075431_100303259
705 Ga0075433_10005651
706 Ga0075433_10006595
707 Ga0075433_10012807
708 Ga0075433_10089341
709 Ga0075434_100005356
710 Ga0075429_100017454
711 Ga0075429_100039050
712 Ga0075429_100098677
713 Ga0068865_100018231
714 Ga0075436_100001457
715 Ga0075436_100016547
716 Ga0075436_100044067
717 Ga0097620_100010712
718 Ga0097620_100060570
719 Ga0097620_100153844
720 Ga0075435_100020937
721 Ga0075435_100225872
722 Ga0075435_100261186
723 Ga0099794_10009748
724 Ga0105240_10046499
725 Ga0105240_10050534
726 Ga0105240_10232274
727 Ga0111539_10002395
728 Ga0111539_10052347
729 Ga0111539_10060079
730 Ga0105245_10010645
731 Ga0105245_10042296
732 Ga0105245_10055461
733 Ga0114129_10005598
734 Ga0114129_10019984
735 Ga0114129_10084675
736 Ga0114129_10134101
737 Ga0114129_10262500
738 Ga0105241_10000100
739 Ga0105241_10018730
740 Ga0105241_10131505
741 Ga0105242_10002377
742 Ga0105242_10048246
743 Ga0105242_10151774
744 Ga0105248_10003991
745 Ga0105248_10018493
746 Ga0105248_10041515
747 Ga0105248_10082137
748 Ga0105248_10150139
749 Ga0105248_10230944
750 Ga0105238_10069649
751 Ga0105238_10193974
752 Ga0105249_10238557
753 Ga0105246_10002895
754 Ga0157373_10005224
755 Ga0157373_10009909
756 Ga0157373_10028495
757 Ga0157373_10032063
758 Ga0157373_10085385
759 Ga0157370_10002501
760 Ga0157370_10064099
761 Ga0157370_10065646
762 Ga0157369_10148232
763 Ga0157369_10261164
764 Ga0157369_10292523
765 Ga0157374_10047696
766 Ga0157374_10074605
767 Ga0157378_10076018
768 Ga0163162_10204366
769 Ga0157372_10003954
770 Ga0157372_10007712
771 Ga0157372_10024696
772 Ga0157372_10056402
773 Ga0157372_10091841
774 Ga0157372_10148325
775 Ga0157372_10149204
776 Ga0157375_10010264
777 Ga0157375_10023505
778 Ga0157375_10029152
779 Ga0157375_10035367
780 Ga0157375_10170402
781 Ga0163163_10038263
782 Ga0157377_10024008
783 Ga0157376_10027890
784 Ga0213876_10003936
785 Ga0207656_10029244
786 Ga0207680_10037198
787 Ga0207647_10105148
788 Ga0207699_10000707
789 Ga0207645_10080812
790 Ga0207645_10124579
791 Ga0207643_10057087
792 Ga0207705_10000670
793 Ga0207705_10014887
794 Ga0207705_10171801
795 Ga0207684_10018254
796 Ga0207684_10018997
797 Ga0207684_10073311
798 Ga0207654_10016668
799 Ga0207707_10000822
800 Ga0207707_10001106
801 Ga0207707_10019103
802 Ga0207707_10036962
803 Ga0207707_10070236
804 Ga0207707_10075260
805 Ga0207695_10002009
806 Ga0207695_10023937
807 Ga0207695_10251949
808 Ga0207693_10005682
809 Ga0207693_10028306
810 Ga0207660_10008802
811 Ga0207660_10219184
812 Ga0207662_10004923
813 Ga0207662_10050335
814 Ga0207657_10001978
815 Ga0207657_10014269
816 Ga0207657_10071220
817 Ga0207657_10095870
818 Ga0207649_10019863
819 Ga0207649_10024748
820 Ga0207649_10072231
821 Ga0207649_10077829
822 Ga0207649_10232922
823 Ga0207652_10001406
824 Ga0207652_10009561
825 Ga0207652_10009770
826 Ga0207652_10012300
827 Ga0207652_10083907
828 Ga0207652_10097804
829 Ga0207652_10108180
830 Ga0207646_10003599
831 Ga0207646_10101343
832 Ga0207681_10026329
833 Ga0207694_10131738
834 Ga0207650_10016939
835 Ga0207650_10143134
836 Ga0207687_10096814
837 Ga0207664_10004807
838 Ga0207664_10018054
839 Ga0207644_10020523
840 Ga0207644_10092151
841 Ga0207690_10006901
842 Ga0207690_10021208
843 Ga0207706_10002611
844 Ga0207706_10018663
845 Ga0207706_10058805
846 Ga0207686_10042376
847 Ga0207704_10008021
848 Ga0207704_10040241
849 Ga0207665_10009491
850 Ga0207691_10024650
851 Ga0207691_10033076
852 Ga0207691_10053614
853 Ga0207711_10037887
854 Ga0207711_10069623
855 Ga0207689_10046742
856 Ga0207661_10000363
857 Ga0207661_10001020
858 Ga0207661_10001219
859 Ga0207661_10090429
860 Ga0207661_10143515
861 Ga0207679_10002053
862 Ga0207679_10033744
863 Ga0207679_10037986
864 Ga0207679_10043120
865 Ga0207679_10075785
866 Ga0207679_10134516
867 Ga0207679_10144191
868 Ga0207679_10146124
869 Ga0207679_10167086
870 Ga0207658_10102251
871 Ga0207658_10169512
872 Ga0207703_10108269
873 Ga0207639_10152978
874 Ga0207678_10003013
875 Ga0207708_10146616
876 Ga0207702_10062168
877 Ga0207702_10140644
878 Ga0207641_10058029
879 Ga0207648_10032753
880 Ga0207648_10047956
881 Ga0207676_10005668
882 Ga0207674_10001269
883 Ga0207674_10004648
884 Ga0207674_10006919
885 Ga0207674_10015375
886 Ga0207675_100138097
887 Ga0207683_10206819
888 Ga0207698_10168339
889 Ga0209998_10001323
890 Ga0207428_10000238
891 Ga0268265_10056887
892 Ga0268265_10139786
893 Ga0307408_100085986
894 Ga0307408_100230193
895 Ga0307405_10000678
896 Ga0307405_10025935
897 Ga0307413_10002547
898 Ga0307413_10041384
899 Ga0307413_10049140
900 Ga0307410_10009719
901 Ga0307410_10016662
902 Ga0307410_10050817
903 Ga0307410_10057105
904 Ga0307410_10165652
905 Ga0307406_10007554
906 Ga0307406_10112512
907 Ga0307406_10146152
908 Ga0307406_10217869
909 Ga0307407_10003358
910 Ga0307407_10005101
911 Ga0307412_10016731
912 Ga0307412_10054623
913 Ga0307409_100002889
914 Ga0307409_100005584
915 Ga0307409_100052446
916 Ga0307409_100099707
917 Ga0307416_100000330
918 Ga0307416_100214510
919 Ga0307416_100366227
920 Ga0307414_10002502
921 Ga0307414_10073330
922 Ga0307414_10137354
923 Ga0307411_10007746
924 Ga0307411_10047928
925 Ga0307415_100001175
926 Ga0307415_100002723
927 Ga0307415_100048362
928 Ga0307415_100106304
929 Ga0307415_100141604
930 Ga0373948_0008968
931 Ga0373934_0000896
932 Ga0373934_0030040
933 Ga0373940_0006438
934 Ga0373944_0003412
935 Ga0373932_0018802
936 Ga0373939_0005075
937 Ga0373939_0042556
938 Ga0373954_0006439
939 Ga0373956_0001722
940 Ga0373956_0094553
941 Ga0373943_0002907
942 Ga0373955_0000160
943 Ga0373955_0073099
944 Ga0373924_0013275
945 Ga0373931_0055759
946 Ga0373931_0082821
947 Ga0373927_0001244
948 Ga0373933_0001869
949 Ga0373933_0083875
950 Ga0373947_0051084
951 Ga0373937_0001247
952 Ga0373937_0201757
953 Ga0373925_0005487
954 Ga0395899_0091568
955 Ga0395900_0024187
956 Ga0395901_0002769
957 Ga0242420_003805
958 Ga0436365_1263854
959 Ga0439439_0001434
960 Ga0439446_0031047
961 Ga0466966_0041076
962 Ga0466966_0068830
963 Ga0466957_0179625
964 Ga0466959_0050347
965 Ga0451576_0232302
966 Ga0495592_0002403
967 Ga0495592_0085154
968 Ga0495629_0004285
969 Ga0495629_0010765
970 Ga0495629_0037070
971 Ga0495651_0002411
972 Ga0495653_0000484
973 Ga0495653_0036083
974 Ga0495580_0003742
975 Ga0495580_0004262
976 Ga0495639_0000120
977 Ga0495639_0005908
978 Ga0495662_0020629
979 Ga0495664_0028473
980 Ga0495594_0003626
981 Ga0495594_0011231
982 Ga0495608_0000694
983 Ga0495618_0096937
984 Ga0495628_0000949
985 Ga0495628_0015764
986 Ga0495630_0000163
987 Ga0495630_0029989
988 Ga0495643_0070667
989 Ga0495652_0000395
990 Ga0495652_0004855
991 Ga0495665_0000436
992 Ga0495665_0016781
993 Ga0495665_0129153
994 Ga0495586_0085595
995 Ga0495587_0004293
996 Ga0495587_0004959
997 Ga0495645_0013851
998 Ga0495667_0000423
999 Ga0495667_0074617
1000 Ga0495634_0109511
1001 Ga0495635_0000264
1002 Ga0495588_0000771
1003 Ga0495657_0000225
1004 Ga0495599_0001034
1005 Ga0495623_0000290
1006 Ga0495623_0021020
1007 Ga0495623_0100727
1008 Ga0495646_0000691
1009 Ga0495658_0000101
1010 Ga0495613_0001866
1011 Ga0495613_0034675
1012 Ga0495613_0052140
1013 Ga0495600_0000224
1014 Ga0495600_0071346
1015 Ga0495581_0007736
1016 Ga0495581_0015989
1017 Ga0495581_0077117
1018 Ga0495604_0000523
1019 Ga0495604_0017051
1020 Ga0495680_0003159
1021 Ga0495680_0107664
1022 Ga0495675_0002427
1023 Ga0495675_0002888
1024 Ga0495675_0003283
1025 Ga0495675_0057622
1026 Ga0495684_0000453
1027 Ga0495684_0130082
1028 Ga0495593_0000066
1029 Ga0495602_0000550
1030 Ga0495602_0007834
1031 Ga0495614_0000001
1032 Ga0496100_0202206
1033 Ga0496104_0127535
1034 Ga0496107_0112329
1035 Ga0496109_0033897
1036 Ga0496111_0139000
1037 Ga0496112_0001127
1038 Ga0496112_0061479
1039 Ga0496115_0000688
1040 Ga0501202_000206
1041 Ga0501216_003605
1042 Ga0501227_006593
1043 Ga0501235_000030
1044 Ga0501249_008950
1045 Ga0501259_001249
1046 Ga0501221_001576
1047 Ga0501225_0001001
1048 Ga0501234_000253
1049 Ga0501245_005709
1050 Ga0501081_0243267
1051 Ga0501268_000064
1052 nmdc:mga05p37_39970_c1
1053 nmdc:mga05p37_69996_c1
1054 nmdc:mga09592_10863_c1
1055 nmdc:mga09592_15067_c1
1056 nmdc:mga09592_36797_c1
1057 nmdc:mga09592_94516_c1
1058 nmdc:mga06r32_138624_c1
1059 nmdc:mga06r32_290941_c1
1060 nmdc:mga06r32_63275_c1
1061 nmdc:mga06r32_75061_c1
1062 nmdc:mga0n895_102559_c1
1063 nmdc:mga0n895_16784_c1
1064 nmdc:mga0n895_18331_c1
1065 nmdc:mga0n895_20827_c1
1066 nmdc:mga0n895_58342_c1
1067 nmdc:mga0rr50_72390_c1
1068 nmdc:mga08x19_171454_c1
1069 nmdc:mga08x19_17209_c1
1070 nmdc:mga08x19_17632_c1
1071 nmdc:mga08x19_88964_c1
1072 nmdc:mga0a205_106766_c1
1073 nmdc:mga0a205_1105_c1
1074 nmdc:mga0a205_136152_c1
1075 nmdc:mga0a205_65632_c1
1076 nmdc:mga0a205_67527_c1
1077 nmdc:mga0a205_7125_c1
1078 Ga0495601_0002461
1079 Ga0495601_0061396
1080 Ga0495612_0001172
1081 Ga0495612_0014887
1082 Ga0495619_0013301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05977

MFS_3

Transmembrane secretion effector

33

439

0.94

PF07690

MFS_1

Major Facilitator Superfamily

50

392

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8597 18 399
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8508 18 399
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.8415 20 397
4xnj-assembly1.cif.gz_A x-ray structure of peptst2 0.8372 17 406
6eia-assembly1.cif.gz_A peptst in complex with hepes (100 mm) 0.8353 17 406
ID Description Score Start End Superfamily
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9495 14 402 1.20.1250.20
af_P24077_14_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9424 14 402 1.20.1250.20
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9066 7 208 1.20.1250.20
af_Q7KWK4_204_629_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9019 17 397 1.20.1250.20
af_Q7JWI7_454_654_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9012 223 405 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A651GM92-F1-model_v4 MFS transporter 0.9525 2 404 GO:0005886
GO:0022857
AF-A0A2S6U5E8-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9473 1 404 GO:0005886
GO:0022857
AF-A0A651GM92-F1-model_v4 MFS transporter 0.9434 2 404 GO:0005886
GO:0022857
AF-A0A075KBT5-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9433 16 402 GO:0005886
GO:0022857
AF-A0A4Q5QDM9-F1-model_v4 deleted 0.9412 9 404

Map