F461128

General Info

Members Datasets Scaffolds Average Seq Length
539 199 539 178

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000216|Ga0114129_1000021616
Length 199
Sequence VKVRARWLIPLAALPVVGLLAYGFRTDPRAVPSPLVGGPAPAFALTTFDGKAVSLESQRGKVVVLNFWASWCYPACYEEAPVLEAGWRESQAKGMVVLGVAIQDKEPASLEFIRRFGLTFPNAPDPAGKVSIDYGVYGVPETFVIDRRGVIRRKHVGAVTQAVFREWVEPLLRESAATGGARHIAQAEGRPGRRLEAAR

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
141 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 99.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100212129 3300005330 Bacteria 1352
2 Ga0068869_100016410 3300005334 Bacteria 4991
3 Ga0070680_100022445 3300005336 Bacteria 5028
4 Ga0070682_100027285 3300005337 Bacteria 3425
5 Ga0070660_100076134 3300005339 Bacteria 2628
6 Ga0070689_100305675 3300005340 Bacteria 1325
7 Ga0070689_100821039 3300005340 Bacteria 819
8 Ga0070689_101614992 3300005340 Bacteria 589
9 Ga0070691_10013026 3300005341 Bacteria 3809
10 Ga0070691_10109026 3300005341 Bacteria 1383
11 Ga0070691_10375006 3300005341 Bacteria 796
12 Ga0070661_100003719 3300005344 Bacteria 10514
13 Ga0070692_10075425 3300005345 Bacteria 1806
14 Ga0070669_100308250 3300005353 Bacteria 1275
15 Ga0070688_100204349 3300005365 Bacteria 1384
16 Ga0070659_100026257 3300005366 Bacteria 4479
17 Ga0070701_10448038 3300005438 Bacteria 828
18 Ga0070705_100004541 3300005440 Bacteria 6753
19 Ga0070705_100017889 3300005440 Bacteria 3706
20 Ga0070705_100553227 3300005440 Bacteria 882
21 Ga0070694_100036700 3300005444 Bacteria 3247
22 Ga0070694_100074658 3300005444 Bacteria 2344
23 Ga0070694_100090086 3300005444 Bacteria 2150
24 Ga0070694_100090987 3300005444 Bacteria 2140
25 Ga0070708_100050694 3300005445 Bacteria 3676
26 Ga0070708_100444030 3300005445 Bacteria 1224
27 Ga0070708_100617997 3300005445 Bacteria 1021
28 Ga0070708_100625103 3300005445 Bacteria 1015
29 Ga0070662_100064949 3300005457 Bacteria 2674
30 Ga0068867_100009601 3300005459 Bacteria 6822
31 Ga0068867_100174898 3300005459 Bacteria 1703
32 Ga0070706_100091355 3300005467 Bacteria 2824
33 Ga0070706_100124994 3300005467 Bacteria 2398
34 Ga0070706_100166918 3300005467 Bacteria 2055
35 Ga0070706_100224735 3300005467 Bacteria 1752
36 Ga0070706_100329563 3300005467 Bacteria 1424
37 Ga0070706_100533191 3300005467 Bacteria 1092
38 Ga0070706_100617276 3300005467 Bacteria 1007
39 Ga0070706_100985010 3300005467 Bacteria 778
40 Ga0070707_100005569 3300005468 Bacteria 11764
41 Ga0070707_100044935 3300005468 Bacteria 4228
42 Ga0070707_100216688 3300005468 Bacteria 1865
43 Ga0070707_100947201 3300005468 Bacteria 826
44 Ga0070707_101489258 3300005468 Bacteria 643
45 Ga0070698_100080912 3300005471 Bacteria 3243
46 Ga0070698_100089109 3300005471 Bacteria 3069
47 Ga0070698_100110695 3300005471 Bacteria 2711
48 Ga0070699_100002892 3300005518 Bacteria 15285
49 Ga0070699_100018215 3300005518 Bacteria 6034
50 Ga0070699_100136319 3300005518 Bacteria 2165
51 Ga0070699_100181824 3300005518 Bacteria 1866
52 Ga0070699_100238619 3300005518 Bacteria 1622
53 Ga0070679_100001419 3300005530 Bacteria 21185
54 Ga0070697_100009741 3300005536 Bacteria 7495
55 Ga0070697_100017309 3300005536 Bacteria 5670
56 Ga0070697_100018252 3300005536 Bacteria 5531
57 Ga0070697_100072671 3300005536 Bacteria 2822
58 Ga0070697_100144806 3300005536 Bacteria 1999
59 Ga0068853_100195165 3300005539 Bacteria 1841
60 Ga0070672_100177425 3300005543 Bacteria 1774
61 Ga0070686_100101685 3300005544 Bacteria 1943
62 Ga0070695_100011721 3300005545 Bacteria 5248
63 Ga0070695_100040504 3300005545 Bacteria 2949
64 Ga0070695_100069377 3300005545 Bacteria 2304
65 Ga0070695_100080733 3300005545 Bacteria 2150
66 Ga0070695_100112130 3300005545 Bacteria 1852
67 Ga0070695_100212901 3300005545 Bacteria 1388
68 Ga0070696_100002374 3300005546 Bacteria 12453
69 Ga0070696_100177399 3300005546 Bacteria 1579
70 Ga0070696_100299156 3300005546 Bacteria 1232
71 Ga0070693_100087506 3300005547 Bacteria 1871
72 Ga0070704_100046278 3300005549 Bacteria 3033
73 Ga0070704_100144635 3300005549 Bacteria 1861
74 Ga0068855_100002166 3300005563 Bacteria 24281
75 Ga0070664_100001058 3300005564 Bacteria 21642
76 Ga0068857_100003334 3300005577 Bacteria 13364
77 Ga0068857_100136150 3300005577 Bacteria 2218
78 Ga0068857_100369714 3300005577 Bacteria 1330
79 Ga0068854_100077736 3300005578 Bacteria 2443
80 Ga0068856_100001265 3300005614 Bacteria 26620
81 Ga0068852_101319654 3300005616 Bacteria 743
82 Ga0068859_100039488 3300005617 Bacteria 4735
83 Ga0068859_100136536 3300005617 Bacteria 2525
84 Ga0068859_100954502 3300005617 Bacteria 941
85 Ga0068859_101094330 3300005617 Bacteria 876
86 Ga0068864_100007588 3300005618 Bacteria 8935
87 Ga0068866_10294923 3300005718 Bacteria 1010
88 Ga0068861_100075893 3300005719 Bacteria 2618
89 Ga0068870_10014547 3300005840 Bacteria 3718
90 Ga0068863_100047386 3300005841 Bacteria 4077
91 Ga0068863_100069724 3300005841 Bacteria 3324
92 Ga0068863_100596548 3300005841 Bacteria 1093
93 Ga0068860_100020406 3300005843 Bacteria 6419
94 Ga0068860_100055673 3300005843 Bacteria 3760
95 Ga0068862_100019777 3300005844 Bacteria 5624
96 Ga0068862_100177518 3300005844 Bacteria 1910
97 Ga0068862_100374610 3300005844 Bacteria 1326
98 Ga0070717_10927162 3300006028 Bacteria 793
99 Ga0075432_10256037 3300006058 Bacteria 712
100 Ga0070712_100001268 3300006175 Bacteria 15245
101 Ga0075428_100003079 3300006844 Bacteria 18190
102 Ga0075428_100251957 3300006844 Bacteria 1903
103 Ga0075428_100308146 3300006844 Bacteria 1702
104 Ga0075428_100421531 3300006844 Bacteria 1430
105 Ga0075430_100001340 3300006846 Bacteria 19902
106 Ga0075430_100002045 3300006846 Bacteria 16630
107 Ga0075431_100011066 3300006847 Bacteria 9078
108 Ga0075431_100037939 3300006847 Bacteria 4961
109 Ga0075431_100191636 3300006847 Bacteria 2094
110 Ga0075431_100958788 3300006847 Bacteria 823
111 Ga0075433_10002199 3300006852 Bacteria 14786
112 Ga0075433_10789645 3300006852 Bacteria 830
113 Ga0075434_100002513 3300006871 Bacteria 16177
114 Ga0075434_100004220 3300006871 Bacteria 12884
115 Ga0075434_100707905 3300006871 Bacteria 1024
116 Ga0075429_100001419 3300006880 Bacteria 19650
117 Ga0075429_100003531 3300006880 Bacteria 13321
118 Ga0075429_100582395 3300006880 Bacteria 980
119 Ga0075429_100824876 3300006880 Bacteria 812
120 Ga0075436_100031612 3300006914 Bacteria 3646
121 Ga0097620_100039488 3300006931 Bacteria 4735
122 Ga0097620_100136538 3300006931 Bacteria 2525
123 Ga0097620_100954510 3300006931 Bacteria 941
124 Ga0097620_101094325 3300006931 Bacteria 876
125 Ga0075435_100001368 3300007076 Bacteria 15741
126 Ga0075435_100010993 3300007076 Bacteria 6636
127 Ga0099794_10022751 3300007265 Bacteria 2860
128 Ga0105240_11402790 3300009093 Bacteria 734
129 Ga0111539_10003405 3300009094 Bacteria 20950
130 Ga0111539_10872097 3300009094 Bacteria 1047
131 Ga0111539_11501531 3300009094 Bacteria 781
132 Ga0105247_10626740 3300009101 Bacteria 801
133 Ga0114129_10000216 3300009147 Bacteria 63856
134 Ga0114129_10007742 3300009147 Bacteria 15286
135 Ga0114129_10024080 3300009147 Bacteria 8627
136 Ga0114129_10052158 3300009147 Bacteria 5741
137 Ga0114129_10064104 3300009147 Bacteria 5128
138 Ga0114129_10197188 3300009147 Bacteria 2729
139 Ga0114129_10208091 3300009147 Bacteria 2646
140 Ga0114129_10980917 3300009147 Bacteria 1065
141 Ga0114129_11733700 3300009147 Bacteria 761
142 Ga0105243_10448763 3300009148 Bacteria 1209
143 Ga0105241_10229871 3300009174 Bacteria 1563
144 Ga0105248_10009600 3300009177 Bacteria 10651
145 Ga0105248_10435676 3300009177 Bacteria 1477
146 Ga0105237_10456279 3300009545 Bacteria 1284
147 Ga0105249_10135934 3300009553 Bacteria 2352
148 Ga0105249_10450405 3300009553 Bacteria 1326
149 Ga0105246_10503169 3300011119 Bacteria 1029
150 Ga0105246_10786087 3300011119 Bacteria 843
151 Ga0105246_10847457 3300011119 Bacteria 815
152 Ga0157371_10339387 3300013102 Bacteria 1093
153 Ga0157369_11495955 3300013105 Bacteria 687
154 Ga0163162_10007987 3300013306 Bacteria 10320
155 Ga0163162_10242250 3300013306 Bacteria 1934
156 Ga0157372_10041609 3300013307 Bacteria 5081
157 Ga0157372_10082945 3300013307 Bacteria 3630
158 Ga0157375_10406196 3300013308 Bacteria 1528
159 Ga0157375_10496116 3300013308 Bacteria 1385
160 Ga0157380_10183068 3300014326 Bacteria 1842
161 Ga0157380_10412060 3300014326 Bacteria 1286
162 Ga0157380_11767255 3300014326 Bacteria 677
163 Ga0182008_10057446 3300014497 Bacteria 1921
164 Ga0182007_10007942 3300015262 Bacteria 4398
165 Ga0207653_10090858 3300025885 Bacteria 1069
166 Ga0207643_10006668 3300025908 Bacteria 6190
167 Ga0207684_10016691 3300025910 Bacteria 6305
168 Ga0207684_10029061 3300025910 Bacteria 4709
169 Ga0207684_10043072 3300025910 Bacteria 3826
170 Ga0207684_10060773 3300025910 Bacteria 3209
171 Ga0207684_10065214 3300025910 Bacteria 3092
172 Ga0207684_10071673 3300025910 Bacteria 2944
173 Ga0207684_10193183 3300025910 Bacteria 1756
174 Ga0207684_10403183 3300025910 Bacteria 1176
175 Ga0207654_10137020 3300025911 Bacteria 1556
176 Ga0207707_10000150 3300025912 Bacteria 72859
177 Ga0207671_10335791 3300025914 Bacteria 1197
178 Ga0207693_10005491 3300025915 Bacteria 10561
179 Ga0207663_10052673 3300025916 Bacteria 2539
180 Ga0207660_10053081 3300025917 Bacteria 2888
181 Ga0207662_10135322 3300025918 Bacteria 1557
182 Ga0207657_10072530 3300025919 Bacteria 2912
183 Ga0207649_10031795 3300025920 Bacteria 3140
184 Ga0207652_10002718 3300025921 Bacteria 14831
185 Ga0207646_10001645 3300025922 Bacteria 27312
186 Ga0207646_10021134 3300025922 Bacteria 6020
187 Ga0207646_10032777 3300025922 Bacteria 4700
188 Ga0207646_10064752 3300025922 Bacteria 3263
189 Ga0207681_10071553 3300025923 Bacteria 2419
190 Ga0207681_10074453 3300025923 Bacteria 2379
191 Ga0207650_10017435 3300025925 Bacteria 5029
192 Ga0207690_10003228 3300025932 Bacteria 9788
193 Ga0207690_10054009 3300025932 Bacteria 2699
194 Ga0207706_10050413 3300025933 Bacteria 3678
195 Ga0207670_10169263 3300025936 Bacteria 1637
196 Ga0207670_10238940 3300025936 Bacteria 1399
197 Ga0207670_10691783 3300025936 Bacteria 843
198 Ga0207704_10292333 3300025938 Bacteria 1244
199 Ga0207665_10435467 3300025939 Bacteria 1004
200 Ga0207691_10145941 3300025940 Bacteria 2083
201 Ga0207691_10781264 3300025940 Bacteria 803
202 Ga0207711_10046929 3300025941 Bacteria 3691
203 Ga0207689_10058802 3300025942 Bacteria 3162
204 Ga0207679_10000326 3300025945 Bacteria 35506
205 Ga0207667_10000777 3300025949 Bacteria 41366
206 Ga0207712_10036706 3300025961 Bacteria 3340
207 Ga0207712_10487173 3300025961 Bacteria 1052
208 Ga0207668_10048256 3300025972 Bacteria 2921
209 Ga0207640_10069711 3300025981 Bacteria 2362
210 Ga0207703_10615670 3300026035 Bacteria 1028
211 Ga0207708_10184726 3300026075 Bacteria 1656
212 Ga0207702_10001073 3300026078 Bacteria 28000
213 Ga0207641_10026926 3300026088 Bacteria 4748
214 Ga0207648_10199528 3300026089 Bacteria 1774
215 Ga0207648_10620466 3300026089 Bacteria 998
216 Ga0207676_10008973 3300026095 Bacteria 7115
217 Ga0207674_10001586 3300026116 Bacteria 29261
218 Ga0207674_10121433 3300026116 Bacteria 2580
219 Ga0207674_10824438 3300026116 Bacteria 895
220 Ga0207675_100047650 3300026118 Bacteria 4001
221 Ga0207675_100280155 3300026118 Bacteria 1620
222 Ga0209970_1002377 3300027614 Bacteria 3207
223 Ga0209588_1027977 3300027671 Unclassified 1794
224 Ga0209971_1001693 3300027682 Bacteria 5432
225 Ga0209966_1000963 3300027695 Bacteria 5391
226 Ga0209998_10001611 3300027717 Bacteria 5417
227 Ga0207428_10000176 3300027907 Bacteria 89634
228 Ga0268265_10079770 3300028380 Bacteria 2579
229 Ga0268265_11612497 3300028380 Bacteria 654
230 Ga0268265_11668163 3300028380 Bacteria 643
231 Ga0268264_10301158 3300028381 Bacteria 1509
232 Ga0268264_11268946 3300028381 Bacteria 747
233 Ga0307408_100070434 3300031548 Bacteria 2582
234 Ga0307408_100355565 3300031548 Bacteria 1244
235 Ga0307408_100620123 3300031548 Bacteria 963
236 Ga0307410_10092717 3300031852 Bacteria 2148
237 Ga0307410_10644018 3300031852 Bacteria 888
238 Ga0307412_10053849 3300031911 Bacteria 2669
239 Ga0307409_100244235 3300031995 Bacteria 1637
240 Ga0307416_100160487 3300032002 Bacteria 2077
241 Ga0307416_100215495 3300032002 Bacteria 1836
242 Ga0307411_10006257 3300032005 Bacteria 5939
243 Ga0373940_0041292 3300035088 Bacteria 1268
244 Ga0373949_0015825 3300035090 Bacteria 1688
245 Ga0373939_0013016 3300035114 Bacteria 2132
246 Ga0373939_0024633 3300035114 Bacteria 1678
247 Ga0373939_0260871 3300035114 Bacteria 678
248 Ga0373960_0014533 3300035121 Bacteria 1997
249 Ga0373942_0014390 3300035207 Bacteria 1915
250 Ga0373962_0037545 3300035242 Bacteria 1353
251 Ga0395899_0009796 3300037312 Bacteria 7353
252 Ga0395900_0002079 3300037418 Bacteria 22453
253 Ga0395898_0015665 3300037466 Bacteria 7769
254 Ga0395901_0001177 3300038443 Bacteria 27791
255 Ga0439437_004711 3300042000 Bacteria 1492
256 Ga0439448_0062611 3300042005 Bacteria 1231
257 Ga0439456_107968 3300042013 Bacteria 633
258 Ga0450905_063647 3300042142 Bacteria 620
259 Ga0439434_0154596 3300042435 Bacteria 760
260 Ga0439459_0003020 3300042438 Bacteria 2641
261 Ga0439460_0000973 3300042461 Bacteria 6578
262 Ga0451577_0254683 3300042876 Bacteria 1589
263 Ga0453683_0367914 3300044673 Bacteria 925
264 Ga0453684_0029980 3300044712 Bacteria 7701
265 Ga0453684_0202098 3300044712 Bacteria 2316
266 Ga0453684_0319591 3300044712 Bacteria 1759
267 Ga0451576_0090634 3300045051 Bacteria 3180
268 Ga0451576_0133536 3300045051 Bacteria 2587
269 Ga0451576_0245550 3300045051 Bacteria 1871
270 Ga0451576_0305024 3300045051 Bacteria 1665
271 Ga0451576_0331242 3300045051 Bacteria 1593
272 Ga0451576_0386928 3300045051 Bacteria 1466
273 Ga0451576_0561499 3300045051 Bacteria 1199
274 Ga0451576_0645943 3300045051 Bacteria 1112
275 Ga0495584_0157581 3300046491 Bacteria 1154
276 Ga0495594_0108830 3300046499 Bacteria 1562
277 Ga0495642_0129418 3300046528 Bacteria 1086
278 Ga0495656_0222398 3300046615 Bacteria 944
279 Ga0495669_0002303 3300046684 Bacteria 7821
280 Ga0495636_0148306 3300047318 Bacteria 1051
281 Ga0496102_0012121 3300048905 Bacteria 7450
282 Ga0496107_0380993 3300048910 Bacteria 1049
283 Ga0496107_0668480 3300048910 Bacteria 765
284 Ga0496112_0173032 3300048915 Bacteria 2125
285 Ga0501031_0011845 3300049568 Bacteria 5686
286 Ga0501031_0159869 3300049568 Bacteria 1473
287 Ga0501033_0061746 3300049570 Bacteria 2761
288 Ga0501033_0108936 3300049570 Bacteria 2017
289 Ga0501033_0110899 3300049570 Bacteria 1996
290 Ga0501033_0247631 3300049570 Bacteria 1264
291 Ga0501033_0326514 3300049570 Bacteria 1077
292 Ga0501033_0337583 3300049570 Bacteria 1057
293 Ga0501036_0000853 3300049572 Bacteria 22673
294 Ga0501036_0057407 3300049572 Bacteria 3297
295 Ga0501036_0114847 3300049572 Bacteria 2275
296 Ga0501036_0187015 3300049572 Bacteria 1743
297 Ga0501036_0266160 3300049572 Bacteria 1436
298 Ga0501037_0008116 3300049573 Bacteria 7695
299 Ga0501037_0044956 3300049573 Bacteria 3242
300 Ga0501037_0408168 3300049573 Bacteria 931
301 Ga0501038_0001304 3300049574 Bacteria 22714
302 Ga0501038_0062457 3300049574 Bacteria 3183
303 Ga0501038_0102076 3300049574 Bacteria 2387
304 Ga0501038_0156072 3300049574 Bacteria 1858
305 Ga0501038_0254388 3300049574 Bacteria 1390
306 Ga0501038_0282565 3300049574 Bacteria 1306
307 Ga0501038_0392438 3300049574 Bacteria 1075
308 Ga0501038_0393330 3300049574 Bacteria 1073
309 Ga0501039_0000591 3300049575 Bacteria 26211
310 Ga0501039_0010896 3300049575 Bacteria 6929
311 Ga0501039_0041526 3300049575 Bacteria 3553
312 Ga0501039_0050001 3300049575 Bacteria 3233
313 Ga0501039_0073585 3300049575 Bacteria 2655
314 Ga0501039_0333371 3300049575 Bacteria 1192
315 Ga0501040_0000838 3300049576 Bacteria 19253
316 Ga0501040_0016640 3300049576 Bacteria 4872
317 Ga0501040_0049645 3300049576 Bacteria 2869
318 Ga0501040_0060180 3300049576 Bacteria 2610
319 Ga0501040_0193208 3300049576 Unclassified 1445
320 Ga0501040_0293788 3300049576 Bacteria 1161
321 Ga0501040_0772722 3300049576 Bacteria 695
322 Ga0501040_1282705 3300049576 Bacteria 531
323 Ga0501041_0000046 3300049577 Bacteria 42763
324 Ga0501041_0004585 3300049577 Bacteria 8016
325 Ga0501041_0006377 3300049577 Bacteria 6905
326 Ga0501041_0019426 3300049577 Bacteria 4058
327 Ga0501041_0046870 3300049577 Bacteria 2630
328 Ga0501041_0072135 3300049577 Bacteria 2121
329 Ga0501041_0191435 3300049577 Bacteria 1281
330 Ga0501041_0194977 3300049577 Bacteria 1269
331 Ga0501041_0382983 3300049577 Bacteria 890
332 Ga0501041_0408213 3300049577 Bacteria 861
333 Ga0501042_0000005 3300049578 Bacteria 65451
334 Ga0501042_0010507 3300049578 Bacteria 6211
335 Ga0501042_0029133 3300049578 Bacteria 3894
336 Ga0501042_0053220 3300049578 Bacteria 2888
337 Ga0501042_0087128 3300049578 Bacteria 2240
338 Ga0501042_0104860 3300049578 Bacteria 2034
339 Ga0501042_0105700 3300049578 Bacteria 2026
340 Ga0501042_0193486 3300049578 Bacteria 1467
341 Ga0501042_0281932 3300049578 Bacteria 1200
342 Ga0501042_0545433 3300049578 Bacteria 843
343 Ga0501042_0797670 3300049578 Bacteria 687
344 Ga0501043_0007534 3300049579 Bacteria 8638
345 Ga0501043_0185748 3300049579 Bacteria 1619
346 Ga0501043_0342970 3300049579 Bacteria 1136
347 Ga0501043_0563140 3300049579 Bacteria 845
348 Ga0501046_0000141 3300049580 Bacteria 75571
349 Ga0501046_0000373 3300049580 Bacteria 45356
350 Ga0501046_0058604 3300049580 Bacteria 3018
351 Ga0501046_0373676 3300049580 Bacteria 1033
352 Ga0501046_0403145 3300049580 Bacteria 988
353 Ga0501047_0024996 3300049581 Bacteria 5737
354 Ga0501048_0003890 3300049582 Bacteria 11363
355 Ga0501048_0033021 3300049582 Bacteria 3740
356 Ga0501048_0048263 3300049582 Bacteria 3037
357 Ga0501048_0119286 3300049582 Bacteria 1864
358 Ga0501048_0273201 3300049582 Bacteria 1201
359 Ga0501048_0396522 3300049582 Bacteria 986
360 Ga0501068_0004994 3300049584 Bacteria 7224
361 Ga0501068_0012291 3300049584 Bacteria 4847
362 Ga0501068_0154578 3300049584 Bacteria 1443
363 Ga0501068_0503296 3300049584 Bacteria 786
364 Ga0501068_0641399 3300049584 Bacteria 693
365 Ga0501069_0035223 3300049585 Bacteria 2757
366 Ga0501071_0000085 3300049587 Bacteria 34269
367 Ga0501071_0012073 3300049587 Bacteria 5841
368 Ga0501071_0045796 3300049587 Bacteria 3140
369 Ga0501071_0077026 3300049587 Bacteria 2436
370 Ga0501071_0243796 3300049587 Bacteria 1355
371 Ga0501072_0000073 3300049588 Bacteria 72845
372 Ga0501072_0004739 3300049588 Bacteria 10361
373 Ga0501072_0011014 3300049588 Bacteria 6900
374 Ga0501072_0040487 3300049588 Bacteria 3659
375 Ga0501072_0057018 3300049588 Bacteria 3078
376 Ga0501072_0100889 3300049588 Bacteria 2294
377 Ga0501072_0311419 3300049588 Bacteria 1251
378 Ga0501072_0328070 3300049588 Bacteria 1216
379 Ga0501072_0340422 3300049588 Bacteria 1191
380 Ga0501072_0630522 3300049588 Bacteria 844
381 Ga0501072_0750773 3300049588 Bacteria 765
382 Ga0501074_0026418 3300049590 Bacteria 4210
383 Ga0501074_0045329 3300049590 Bacteria 3182
384 Ga0501074_0062015 3300049590 Bacteria 2694
385 Ga0501074_0515907 3300049590 Bacteria 847
386 Ga0501074_0580915 3300049590 Bacteria 793
387 Ga0501074_0846100 3300049590 Bacteria 644
388 Ga0501075_0000001 3300049591 Bacteria 229051
389 Ga0501075_0000219 3300049591 Bacteria 30396
390 Ga0501075_0014099 3300049591 Bacteria 5725
391 Ga0501075_0154703 3300049591 Bacteria 1748
392 Ga0501075_0168540 3300049591 Bacteria 1671
393 Ga0501075_0196570 3300049591 Bacteria 1538
394 Ga0501075_0276711 3300049591 Bacteria 1279
395 Ga0501075_0317933 3300049591 Bacteria 1186
396 Ga0501075_0373718 3300049591 Bacteria 1086
397 Ga0501075_0545933 3300049591 Bacteria 884
398 Ga0501075_0852374 3300049591 Bacteria 693
399 Ga0501076_0000001 3300049592 Bacteria 173877
400 Ga0501076_0000204 3300049592 Bacteria 35673
401 Ga0501076_0000842 3300049592 Bacteria 19857
402 Ga0501076_0011465 3300049592 Bacteria 6604
403 Ga0501076_0022040 3300049592 Bacteria 4892
404 Ga0501076_0032553 3300049592 Bacteria 4069
405 Ga0501076_0095892 3300049592 Bacteria 2389
406 Ga0501076_0221823 3300049592 Bacteria 1545
407 Ga0501076_0265530 3300049592 Bacteria 1405
408 Ga0501076_0314657 3300049592 Bacteria 1284
409 Ga0501076_0316217 3300049592 Bacteria 1281
410 Ga0501076_0594460 3300049592 Bacteria 913
411 Ga0501077_0000023 3300049593 Bacteria 77383
412 Ga0501077_0004553 3300049593 Bacteria 8429
413 Ga0501077_0035669 3300049593 Bacteria 3167
414 Ga0501077_0040082 3300049593 Bacteria 2984
415 Ga0501077_0085655 3300049593 Bacteria 1998
416 Ga0501077_0099200 3300049593 Bacteria 1846
417 Ga0501077_0203702 3300049593 Bacteria 1257
418 Ga0501077_0265164 3300049593 Bacteria 1092
419 Ga0501077_0283805 3300049593 Bacteria 1054
420 Ga0501216_067479 3300049660 Bacteria 733
421 Ga0501079_0000015 3300049741 Bacteria 67161
422 Ga0501079_0002202 3300049741 Bacteria 14059
423 Ga0501079_0003943 3300049741 Bacteria 10963
424 Ga0501079_0016366 3300049741 Bacteria 5666
425 Ga0501079_0021996 3300049741 Bacteria 4885
426 Ga0501079_0027808 3300049741 Bacteria 4338
427 Ga0501079_0046202 3300049741 Bacteria 3360
428 Ga0501079_0096245 3300049741 Bacteria 2295
429 Ga0501079_0128591 3300049741 Bacteria 1971
430 Ga0501079_0155480 3300049741 Bacteria 1783
431 Ga0501079_0168009 3300049741 Bacteria 1711
432 Ga0501079_0319878 3300049741 Bacteria 1215
433 Ga0501079_1139629 3300049741 Bacteria 614
434 Ga0501080_0000495 3300049742 Bacteria 30778
435 Ga0501080_0014683 3300049742 Bacteria 7211
436 Ga0501080_0038738 3300049742 Bacteria 4449
437 Ga0501080_0060309 3300049742 Bacteria 3531
438 Ga0501080_0143232 3300049742 Bacteria 2210
439 Ga0501080_0206417 3300049742 Bacteria 1802
440 Ga0501080_0236045 3300049742 Bacteria 1670
441 Ga0501080_0505376 3300049742 Bacteria 1080
442 Ga0501081_0000182 3300049743 Bacteria 29938
443 Ga0501081_0001420 3300049743 Bacteria 14651
444 Ga0501081_0002786 3300049743 Bacteria 11086
445 Ga0501081_0003132 3300049743 Bacteria 10508
446 Ga0501081_0018056 3300049743 Bacteria 4680
447 Ga0501081_0021004 3300049743 Bacteria 4357
448 Ga0501081_0024979 3300049743 Bacteria 4017
449 Ga0501081_0173882 3300049743 Bacteria 1556
450 Ga0501081_0237336 3300049743 Bacteria 1329
451 Ga0501081_0387371 3300049743 Bacteria 1033
452 Ga0501081_0396724 3300049743 Bacteria 1021
453 Ga0501081_0540596 3300049743 Bacteria 870
454 Ga0501083_0016105 3300049744 Bacteria 5235
455 Ga0501083_0062638 3300049744 Bacteria 2481
456 Ga0501083_0145728 3300049744 Bacteria 1550
457 Ga0501035_0008834 3300049822 Bacteria 9378
458 Ga0501035_0064452 3300049822 Bacteria 3257
459 Ga0501035_0437130 3300049822 Bacteria 1084
460 Ga0501035_0497026 3300049822 Bacteria 1004
461 Ga0501044_0268592 3300049823 Bacteria 1642
462 Ga0501045_0001141 3300049824 Bacteria 17583
463 Ga0501045_0002341 3300049824 Bacteria 12864
464 Ga0501045_0003038 3300049824 Bacteria 11476
465 Ga0501045_0006123 3300049824 Bacteria 8335
466 Ga0501045_0012899 3300049824 Bacteria 5891
467 Ga0501045_0035961 3300049824 Bacteria 3596
468 Ga0501045_0106015 3300049824 Bacteria 2083
469 Ga0501045_0164804 3300049824 Bacteria 1651
470 Ga0501045_0907192 3300049824 Bacteria 647
471 nmdc:mga05p37_1240038_c1 3300050507 Bacteria 766
472 nmdc:mga05p37_15776_c1 3300050507 Bacteria 9085
473 nmdc:mga05p37_210537_c1 3300050507 Bacteria 2350
474 nmdc:mga05p37_2413_c1 3300050507 Bacteria 21749
475 nmdc:mga05p37_256609_c1 3300050507 Bacteria 2095
476 nmdc:mga05p37_3105_c1 3300050507 Bacteria 19299
477 nmdc:mga05p37_3324_c1 3300050507 Bacteria 18759
478 nmdc:mga05p37_54149_c1 3300050507 Bacteria 4936
479 nmdc:mga05p37_62075_c1 3300050507 Bacteria 4600
480 nmdc:mga09592_264044_c1 3300050508 Bacteria 1493
481 nmdc:mga09592_44881_c1 3300050508 Bacteria 3722
482 nmdc:mga09592_5329_c1 3300050508 Bacteria 10456
483 nmdc:mga0qj67_134086_c1 3300050509 Bacteria 1441
484 nmdc:mga0qj67_15447_c1 3300050509 Bacteria 5781
485 nmdc:mga0qj67_3133_c1 3300050509 Bacteria 11903
486 nmdc:mga06r32_1028856_c1 3300050510 Bacteria 775
487 nmdc:mga06r32_128191_c1 3300050510 Bacteria 2507
488 nmdc:mga06r32_42231_c1 3300050510 Bacteria 4335
489 nmdc:mga06r32_437245_c1 3300050510 Bacteria 1289
490 nmdc:mga06r32_9162_c1 3300050510 Bacteria 8920
491 nmdc:mga08y16_1847194_c1 3300050511 Bacteria 556
492 nmdc:mga08y16_19972_c1 3300050511 Bacteria 7069
493 nmdc:mga08y16_662076_c1 3300050511 Bacteria 1047
494 nmdc:mga08y16_890_c1 3300050511 Bacteria 28805
495 nmdc:mga0n895_33093_c1 3300050512 Bacteria 4967
496 nmdc:mga0n895_45790_c1 3300050512 Bacteria 4271
497 nmdc:mga0n895_579754_c1 3300050512 Bacteria 1126
498 nmdc:mga0rr50_10564_c1 3300050513 Bacteria 5866
499 nmdc:mga0rr50_3653_c1 3300050513 Bacteria 8902
500 nmdc:mga08x19_27868_c1 3300050514 Bacteria 3535
501 nmdc:mga0a205_122070_c1 3300050515 Bacteria 2505
502 nmdc:mga0a205_154340_c2 3300050515 Bacteria 1724
503 nmdc:mga0a205_24194_c1 3300050515 Bacteria 5770
504 nmdc:mga0a205_538515_c1 3300050515 Bacteria 1023
505 nmdc:mga0a205_586826_c1 3300050515 Bacteria 968
506 nmdc:mga0a205_692726_c1 3300050515 Bacteria 869
507 Ga0501084_0000142 3300054114 Bacteria 54295
508 Ga0501084_0028771 3300054114 Bacteria 4646
509 Ga0501084_0039077 3300054114 Bacteria 3969
510 Ga0501084_0044573 3300054114 Bacteria 3713
511 Ga0501084_0108719 3300054114 Bacteria 2329
512 Ga0501084_0321597 3300054114 Bacteria 1307
513 Ga0501084_0370284 3300054114 Bacteria 1211
514 Ga0501084_0372671 3300054114 Bacteria 1206
515 Ga0590077_028156 3300059426 Bacteria 1220
516 Ga0501082_0000146 3300060353 Bacteria 58922
517 Ga0501082_0000718 3300060353 Bacteria 29158
518 Ga0501082_0005631 3300060353 Bacteria 10874
519 Ga0501082_0020684 3300060353 Bacteria 5672
520 Ga0501082_0027952 3300060353 Bacteria 4858
521 Ga0501082_0134400 3300060353 Bacteria 2146
522 Ga0501082_0290515 3300060353 Bacteria 1423
523 Ga0501082_0526502 3300060353 Bacteria 1033
524 Ga0501082_0539155 3300060353 Bacteria 1020
525 Ga0501082_0783289 3300060353 Bacteria 834
526 Ga0501082_0787927 3300060353 Bacteria 832
527 Ga0501082_0865647 3300060353 Bacteria 790
528 Ga0501082_1135632 3300060353 Bacteria 683
529 Ga0530510_0000002 3300061734 Bacteria 284155
530 Ga0530510_0000403 3300061734 Bacteria 28096
531 Ga0530510_0000410 3300061734 Bacteria 27864
532 Ga0530510_0000633 3300061734 Bacteria 22634
533 Ga0530510_0032272 3300061734 Bacteria 3767
534 Ga0530510_0067991 3300061734 Bacteria 2585
535 Ga0530510_0070495 3300061734 Bacteria 2537
536 Ga0530510_0105353 3300061734 Bacteria 2064
537 Ga0530510_0143829 3300061734 Bacteria 1758
538 Ga0530510_0217084 3300061734 Bacteria 1421
539 Ga0530510_0266490 3300061734 Bacteria 1278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0540596 Ga0501081_0540596_317_820 141
2 3300042013 Ga0439456_107968 Ga0439456_107968_53_610 142
3 3300049824 Ga0501045_0002341 Ga0501045_0002341_5771_6277 158
4 3300009094 Ga0111539_11501531 Ga0111539_115015311 160
5 3300049576 Ga0501040_0772722 Ga0501040_0772722_23_670 160
6 3300049577 Ga0501041_0194977 Ga0501041_0194977_16_498 160
7 3300049590 Ga0501074_0062015 Ga0501074_0062015_2202_2684 160
8 3300049593 Ga0501077_0265164 Ga0501077_0265164_23_508 160
9 3300042435 Ga0439434_0154596 Ga0439434_0154596_245_730 161
10 3300049576 Ga0501040_1282705 Ga0501040_1282705_36_521 161
11 3300049577 Ga0501041_0382983 Ga0501041_0382983_393_878 161
12 3300049578 Ga0501042_0105700 Ga0501042_0105700_380_865 161
13 3300049588 Ga0501072_0750773 Ga0501072_0750773_162_647 161
14 3300049590 Ga0501074_0515907 Ga0501074_0515907_347_835 161
15 3300049592 Ga0501076_0594460 Ga0501076_0594460_89_574 161
16 3300049824 Ga0501045_0106015 Ga0501045_0106015_414_899 161
17 3300060353 Ga0501082_0865647 Ga0501082_0865647_278_763 161
18 3300009147 Ga0114129_10208091 Ga0114129_102080912 163
19 3300050507 nmdc:mga05p37_210537_c1 nmdc:mga05p37_210537_c1_1689_2222 163
20 3300050507 nmdc:mga05p37_3105_c1 nmdc:mga05p37_3105_c1_5803_6303 163
21 3300050509 nmdc:mga0qj67_15447_c1 nmdc:mga0qj67_15447_c1_305_805 163
22 3300050510 nmdc:mga06r32_9162_c1 nmdc:mga06r32_9162_c1_4235_4735 163
23 3300050511 nmdc:mga08y16_1847194_c1 nmdc:mga08y16_1847194_c1_18_518 163
24 3300045051 Ga0451576_0245550 Ga0451576_0245550_1097_1591 164
25 3300047318 Ga0495636_0148306 Ga0495636_0148306_254_748 164
26 3300049578 Ga0501042_0545433 Ga0501042_0545433_139_666 164
27 3300049741 Ga0501079_0319878 Ga0501079_0319878_585_1112 164
28 3300054114 Ga0501084_0370284 Ga0501084_0370284_598_1125 164
29 3300049572 Ga0501036_0266160 Ga0501036_0266160_729_1241 166
30 3300049574 Ga0501038_0393330 Ga0501038_0393330_55_567 166
31 3300049575 Ga0501039_0073585 Ga0501039_0073585_1180_1692 166
32 3300049576 Ga0501040_0293788 Ga0501040_0293788_330_842 166
33 3300049578 Ga0501042_0087128 Ga0501042_0087128_491_1003 166
34 3300049588 Ga0501072_0011014 Ga0501072_0011014_683_1192 166
35 3300049591 Ga0501075_0317933 Ga0501075_0317933_44_553 166
36 3300049592 Ga0501076_0032553 Ga0501076_0032553_421_933 166
37 3300049593 Ga0501077_0283805 Ga0501077_0283805_381_893 166
38 3300049741 Ga0501079_0128591 Ga0501079_0128591_195_707 166
39 3300049742 Ga0501080_0505376 Ga0501080_0505376_172_684 166
40 3300049822 Ga0501035_0497026 Ga0501035_0497026_121_633 166
41 3300060353 Ga0501082_0134400 Ga0501082_0134400_77_589 166
42 3300061734 Ga0530510_0105353 Ga0530510_0105353_1095_1607 166
43 3300049592 Ga0501076_0011465 Ga0501076_0011465_3912_4451 167
44 3300011119 Ga0105246_10847457 Ga0105246_108474572 168
45 3300035114 Ga0373939_0013016 Ga0373939_0013016_526_1041 168
46 3300035121 Ga0373960_0014533 Ga0373960_0014533_697_1212 168
47 3300035207 Ga0373942_0014390 Ga0373942_0014390_924_1439 168
48 3300035242 Ga0373962_0037545 Ga0373962_0037545_381_896 168
49 3300048905 Ga0496102_0012121 Ga0496102_0012121_2323_2838 168
50 3300048910 Ga0496107_0380993 Ga0496107_0380993_480_995 168
51 3300042005 Ga0439448_0062611 Ga0439448_0062611_508_1047 170
52 3300042461 Ga0439460_0000973 Ga0439460_0000973_463_1002 170
53 3300042876 Ga0451577_0254683 Ga0451577_0254683_77_598 170
54 3300044712 Ga0453684_0029980 Ga0453684_0029980_901_1422 170
55 3300044712 Ga0453684_0319591 Ga0453684_0319591_86_607 170
56 3300049568 Ga0501031_0159869 Ga0501031_0159869_98_637 170
57 3300049570 Ga0501033_0108936 Ga0501033_0108936_524_1063 170
58 3300049573 Ga0501037_0044956 Ga0501037_0044956_283_822 170
59 3300049574 Ga0501038_0062457 Ga0501038_0062457_1897_2436 170
60 3300049575 Ga0501039_0050001 Ga0501039_0050001_608_1147 170
61 3300049576 Ga0501040_0016640 Ga0501040_0016640_2240_2779 170
62 3300049577 Ga0501041_0004585 Ga0501041_0004585_3893_4432 170
63 3300049578 Ga0501042_0010507 Ga0501042_0010507_3897_4436 170
64 3300049579 Ga0501043_0563140 Ga0501043_0563140_285_824 170
65 3300049580 Ga0501046_0000141 Ga0501046_0000141_25822_26361 170
66 3300049581 Ga0501047_0024996 Ga0501047_0024996_999_1538 170
67 3300049582 Ga0501048_0033021 Ga0501048_0033021_1129_1668 170
68 3300049587 Ga0501071_0045796 Ga0501071_0045796_1714_2253 170
69 3300049590 Ga0501074_0026418 Ga0501074_0026418_1626_2165 170
70 3300049593 Ga0501077_0035669 Ga0501077_0035669_1928_2467 170
71 3300049741 Ga0501079_0003943 Ga0501079_0003943_2870_3409 170
72 3300049742 Ga0501080_0014683 Ga0501080_0014683_1600_2139 170
73 3300049743 Ga0501081_0001420 Ga0501081_0001420_14099_14638 170
74 3300049744 Ga0501083_0062638 Ga0501083_0062638_502_1041 170
75 3300049822 Ga0501035_0437130 Ga0501035_0437130_150_689 170
76 3300049824 Ga0501045_0003038 Ga0501045_0003038_8880_9419 170
77 3300054114 Ga0501084_0028771 Ga0501084_0028771_2264_2803 170
78 3300060353 Ga0501082_0000146 Ga0501082_0000146_21054_21593 170
79 3300061734 Ga0530510_0070495 Ga0530510_0070495_1114_1653 170
80 3300045051 Ga0451576_0645943 Ga0451576_0645943_50_574 171
81 3300006914 Ga0075436_100031612 Ga0075436_1000316125 172
82 3300049570 Ga0501033_0326514 Ga0501033_0326514_481_999 172
83 3300049575 Ga0501039_0333371 Ga0501039_0333371_477_995 172
84 3300049577 Ga0501041_0019426 Ga0501041_0019426_433_951 172
85 3300049582 Ga0501048_0396522 Ga0501048_0396522_86_604 172
86 3300049588 Ga0501072_0311419 Ga0501072_0311419_330_848 172
87 3300049590 Ga0501074_0045329 Ga0501074_0045329_1338_1856 172
88 3300049591 Ga0501075_0168540 Ga0501075_0168540_376_894 172
89 3300049592 Ga0501076_0000842 Ga0501076_0000842_7968_8486 172
90 3300049593 Ga0501077_0004553 Ga0501077_0004553_908_1426 172
91 3300049743 Ga0501081_0003132 Ga0501081_0003132_8522_9040 172
92 3300050514 nmdc:mga08x19_27868_c1 nmdc:mga08x19_27868_c1_2109_2627 172
93 3300060353 Ga0501082_0005631 Ga0501082_0005631_7848_8366 172
94 3300061734 Ga0530510_0000403 Ga0530510_0000403_19454_19972 172
95 3300005445 Ga0070708_100625103 Ga0070708_1006251032 173
96 3300005467 Ga0070706_100617276 Ga0070706_1006172761 173
97 3300005518 Ga0070699_100002892 Ga0070699_1000028925 173
98 3300005536 Ga0070697_100017309 Ga0070697_1000173092 173
99 3300009101 Ga0105247_10626740 Ga0105247_106267402 173
100 3300060353 Ga0501082_0787927 Ga0501082_0787927_215_742 173
101 3300049574 Ga0501038_0254388 Ga0501038_0254388_557_1084 174
102 3300049591 Ga0501075_0373718 Ga0501075_0373718_74_601 174
103 3300049741 Ga0501079_0046202 Ga0501079_0046202_1749_2276 174
104 3300049742 Ga0501080_0143232 Ga0501080_0143232_1560_2087 174
105 3300049743 Ga0501081_0018056 Ga0501081_0018056_1761_2288 174
106 3300054114 Ga0501084_0372671 Ga0501084_0372671_618_1145 174
107 3300005440 Ga0070705_100004541 Ga0070705_1000045417 175
108 3300005459 Ga0068867_100174898 Ga0068867_1001748982 175
109 3300005841 Ga0068863_100596548 Ga0068863_1005965482 175
110 3300006844 Ga0075428_100003079 Ga0075428_1000030797 175
111 3300006847 Ga0075431_100958788 Ga0075431_1009587881 175
112 3300006852 Ga0075433_10789645 Ga0075433_107896452 175
113 3300006871 Ga0075434_100002513 Ga0075434_1000025133 175
114 3300006880 Ga0075429_100582395 Ga0075429_1005823952 175
115 3300007076 Ga0075435_100010993 Ga0075435_1000109932 175
116 3300009094 Ga0111539_10003405 Ga0111539_100034057 175
117 3300009147 Ga0114129_10052158 Ga0114129_100521587 175
118 3300014326 Ga0157380_11767255 Ga0157380_117672551 175
119 3300025923 Ga0207681_10074453 Ga0207681_100744532 175
120 3300025938 Ga0207704_10292333 Ga0207704_102923331 175
121 3300025939 Ga0207665_10435467 Ga0207665_104354672 175
122 3300026089 Ga0207648_10199528 Ga0207648_101995282 175
123 3300027907 Ga0207428_10000176 Ga0207428_1000017622 175
124 3300028380 Ga0268265_11668163 Ga0268265_116681632 175
125 3300035088 Ga0373940_0041292 Ga0373940_0041292_43_579 175
126 3300035114 Ga0373939_0024633 Ga0373939_0024633_705_1238 175
127 3300044673 Ga0453683_0367914 Ga0453683_0367914_71_607 175
128 3300045051 Ga0451576_0305024 Ga0451576_0305024_266_802 175
129 3300046491 Ga0495584_0157581 Ga0495584_0157581_123_659 175
130 3300046528 Ga0495642_0129418 Ga0495642_0129418_258_794 175
131 3300049580 Ga0501046_0373676 Ga0501046_0373676_201_731 175
132 3300049584 Ga0501068_0641399 Ga0501068_0641399_141_671 175
133 3300049591 Ga0501075_0154703 Ga0501075_0154703_644_1174 175
134 3300049743 Ga0501081_0396724 Ga0501081_0396724_246_773 175
135 3300049824 Ga0501045_0907192 Ga0501045_0907192_61_591 175
136 3300050507 nmdc:mga05p37_54149_c1 nmdc:mga05p37_54149_c1_4360_4893 175
137 3300050510 nmdc:mga06r32_437245_c1 nmdc:mga06r32_437245_c1_44_577 175
138 3300050511 nmdc:mga08y16_19972_c1 nmdc:mga08y16_19972_c1_4780_5319 175
139 3300050511 nmdc:mga08y16_890_c1 nmdc:mga08y16_890_c1_20598_21131 175
140 3300050512 nmdc:mga0n895_33093_c1 nmdc:mga0n895_33093_c1_2931_3467 175
141 3300050515 nmdc:mga0a205_154340_c2 nmdc:mga0a205_154340_c2_178_714 175
142 3300050515 nmdc:mga0a205_586826_c1 nmdc:mga0a205_586826_c1_390_923 175
143 3300060353 Ga0501082_0526502 Ga0501082_0526502_305_835 175
144 3300061734 Ga0530510_0000410 Ga0530510_0000410_25213_25740 175
145 3300005336 Ga0070680_100022445 Ga0070680_1000224453 176
146 3300005340 Ga0070689_100821039 Ga0070689_1008210392 176
147 3300005353 Ga0070669_100308250 Ga0070669_1003082502 176
148 3300005365 Ga0070688_100204349 Ga0070688_1002043491 176
149 3300005438 Ga0070701_10448038 Ga0070701_104480382 176
150 3300005440 Ga0070705_100017889 Ga0070705_1000178892 176
151 3300005444 Ga0070694_100074658 Ga0070694_1000746584 176
152 3300005445 Ga0070708_100050694 Ga0070708_1000506944 176
153 3300005445 Ga0070708_100617997 Ga0070708_1006179972 176
154 3300005467 Ga0070706_100224735 Ga0070706_1002247352 176
155 3300005468 Ga0070707_100216688 Ga0070707_1002166882 176
156 3300005471 Ga0070698_100080912 Ga0070698_1000809125 176
157 3300005471 Ga0070698_100089109 Ga0070698_1000891092 176
158 3300005518 Ga0070699_100018215 Ga0070699_1000182153 176
159 3300005518 Ga0070699_100136319 Ga0070699_1001363192 176
160 3300005536 Ga0070697_100072671 Ga0070697_1000726713 176
161 3300005545 Ga0070695_100112130 Ga0070695_1001121302 176
162 3300005545 Ga0070695_100212901 Ga0070695_1002129012 176
163 3300005546 Ga0070696_100177399 Ga0070696_1001773992 176
164 3300005546 Ga0070696_100299156 Ga0070696_1002991563 176
165 3300005549 Ga0070704_100046278 Ga0070704_1000462782 176
166 3300005718 Ga0068866_10294923 Ga0068866_102949231 176
167 3300005719 Ga0068861_100075893 Ga0068861_1000758934 176
168 3300005841 Ga0068863_100069724 Ga0068863_1000697243 176
169 3300005843 Ga0068860_100055673 Ga0068860_1000556732 176
170 3300005844 Ga0068862_100374610 Ga0068862_1003746102 176
171 3300006058 Ga0075432_10256037 Ga0075432_102560372 176
172 3300006844 Ga0075428_100308146 Ga0075428_1003081463 176
173 3300006844 Ga0075428_100421531 Ga0075428_1004215313 176
174 3300006846 Ga0075430_100001340 Ga0075430_10000134017 176
175 3300006846 Ga0075430_100002045 Ga0075430_10000204514 176
176 3300006847 Ga0075431_100011066 Ga0075431_1000110668 176
177 3300006847 Ga0075431_100037939 Ga0075431_1000379394 176
178 3300006852 Ga0075433_10002199 Ga0075433_100021992 176
179 3300006871 Ga0075434_100004220 Ga0075434_1000042207 176
180 3300006871 Ga0075434_100707905 Ga0075434_1007079052 176
181 3300006880 Ga0075429_100001419 Ga0075429_10000141911 176
182 3300006880 Ga0075429_100003531 Ga0075429_1000035315 176
183 3300007076 Ga0075435_100001368 Ga0075435_10000136814 176
184 3300009147 Ga0114129_10000216 Ga0114129_1000021616 176
185 3300009147 Ga0114129_10007742 Ga0114129_100077428 176
186 3300009147 Ga0114129_10024080 Ga0114129_100240803 176
187 3300009147 Ga0114129_10064104 Ga0114129_100641046 176
188 3300009147 Ga0114129_10197188 Ga0114129_101971884 176
189 3300009147 Ga0114129_10980917 Ga0114129_109809172 176
190 3300009553 Ga0105249_10135934 Ga0105249_101359343 176
191 3300011119 Ga0105246_10786087 Ga0105246_107860872 176
192 3300013306 Ga0163162_10007987 Ga0163162_1000798711 176
193 3300013308 Ga0157375_10406196 Ga0157375_104061962 176
194 3300014326 Ga0157380_10412060 Ga0157380_104120602 176
195 3300025910 Ga0207684_10060773 Ga0207684_100607731 176
196 3300025910 Ga0207684_10065214 Ga0207684_100652142 176
197 3300025917 Ga0207660_10053081 Ga0207660_100530812 176
198 3300025918 Ga0207662_10135322 Ga0207662_101353222 176
199 3300025923 Ga0207681_10071553 Ga0207681_100715533 176
200 3300025932 Ga0207690_10054009 Ga0207690_100540092 176
201 3300025936 Ga0207670_10238940 Ga0207670_102389402 176
202 3300025940 Ga0207691_10781264 Ga0207691_107812642 176
203 3300025961 Ga0207712_10487173 Ga0207712_104871732 176
204 3300025972 Ga0207668_10048256 Ga0207668_100482562 176
205 3300026118 Ga0207675_100047650 Ga0207675_1000476502 176
206 3300028381 Ga0268264_11268946 Ga0268264_112689462 176
207 3300031548 Ga0307408_100070434 Ga0307408_1000704343 176
208 3300031548 Ga0307408_100355565 Ga0307408_1003555653 176
209 3300031852 Ga0307410_10092717 Ga0307410_100927171 176
210 3300031852 Ga0307410_10644018 Ga0307410_106440182 176
211 3300031911 Ga0307412_10053849 Ga0307412_100538492 176
212 3300031995 Ga0307409_100244235 Ga0307409_1002442353 176
213 3300032002 Ga0307416_100160487 Ga0307416_1001604873 176
214 3300032002 Ga0307416_100215495 Ga0307416_1002154953 176
215 3300032005 Ga0307411_10006257 Ga0307411_100062578 176
216 3300037312 Ga0395899_0009796 Ga0395899_0009796_5347_5886 176
217 3300037418 Ga0395900_0002079 Ga0395900_0002079_13485_14024 176
218 3300037466 Ga0395898_0015665 Ga0395898_0015665_6170_6709 176
219 3300038443 Ga0395901_0001177 Ga0395901_0001177_4548_5087 176
220 3300045051 Ga0451576_0386928 Ga0451576_0386928_308_853 176
221 3300046499 Ga0495594_0108830 Ga0495594_0108830_754_1296 176
222 3300046615 Ga0495656_0222398 Ga0495656_0222398_155_697 176
223 3300046684 Ga0495669_0002303 Ga0495669_0002303_1621_2163 176
224 3300048910 Ga0496107_0668480 Ga0496107_0668480_140_670 176
225 3300049568 Ga0501031_0011845 Ga0501031_0011845_4664_5263 176
226 3300049570 Ga0501033_0061746 Ga0501033_0061746_1805_2338 176
227 3300049570 Ga0501033_0110899 Ga0501033_0110899_803_1402 176
228 3300049570 Ga0501033_0337583 Ga0501033_0337583_348_881 176
229 3300049572 Ga0501036_0000853 Ga0501036_0000853_12818_13417 176
230 3300049572 Ga0501036_0057407 Ga0501036_0057407_2276_2809 176
231 3300049572 Ga0501036_0114847 Ga0501036_0114847_1136_1669 176
232 3300049572 Ga0501036_0187015 Ga0501036_0187015_90_620 176
233 3300049573 Ga0501037_0008116 Ga0501037_0008116_5523_6122 176
234 3300049573 Ga0501037_0408168 Ga0501037_0408168_102_632 176
235 3300049574 Ga0501038_0001304 Ga0501038_0001304_5778_6377 176
236 3300049574 Ga0501038_0102076 Ga0501038_0102076_1354_1887 176
237 3300049574 Ga0501038_0156072 Ga0501038_0156072_743_1276 176
238 3300049575 Ga0501039_0000591 Ga0501039_0000591_20223_20822 176
239 3300049575 Ga0501039_0010896 Ga0501039_0010896_5635_6165 176
240 3300049575 Ga0501039_0041526 Ga0501039_0041526_242_775 176
241 3300049576 Ga0501040_0000838 Ga0501040_0000838_10211_10810 176
242 3300049576 Ga0501040_0060180 Ga0501040_0060180_686_1219 176
243 3300049576 Ga0501040_0193208 Ga0501040_0193208_546_1076 176
244 3300049577 Ga0501041_0000046 Ga0501041_0000046_5661_6260 176
245 3300049577 Ga0501041_0006377 Ga0501041_0006377_678_1211 176
246 3300049577 Ga0501041_0191435 Ga0501041_0191435_93_626 176
247 3300049577 Ga0501041_0408213 Ga0501041_0408213_117_647 176
248 3300049578 Ga0501042_0000005 Ga0501042_0000005_58867_59466 176
249 3300049578 Ga0501042_0053220 Ga0501042_0053220_1983_2516 176
250 3300049578 Ga0501042_0104860 Ga0501042_0104860_1413_1943 176
251 3300049578 Ga0501042_0193486 Ga0501042_0193486_868_1398 176
252 3300049578 Ga0501042_0281932 Ga0501042_0281932_393_926 176
253 3300049579 Ga0501043_0007534 Ga0501043_0007534_2746_3345 176
254 3300049579 Ga0501043_0185748 Ga0501043_0185748_205_738 176
255 3300049580 Ga0501046_0000373 Ga0501046_0000373_33774_34373 176
256 3300049580 Ga0501046_0058604 Ga0501046_0058604_2441_2974 176
257 3300049582 Ga0501048_0003890 Ga0501048_0003890_8041_8640 176
258 3300049582 Ga0501048_0048263 Ga0501048_0048263_1482_2015 176
259 3300049582 Ga0501048_0119286 Ga0501048_0119286_1064_1594 176
260 3300049584 Ga0501068_0004994 Ga0501068_0004994_3392_3991 176
261 3300049584 Ga0501068_0012291 Ga0501068_0012291_992_1525 176
262 3300049584 Ga0501068_0503296 Ga0501068_0503296_80_610 176
263 3300049585 Ga0501069_0035223 Ga0501069_0035223_1792_2391 176
264 3300049587 Ga0501071_0000085 Ga0501071_0000085_21407_22006 176
265 3300049587 Ga0501071_0012073 Ga0501071_0012073_4025_4558 176
266 3300049587 Ga0501071_0077026 Ga0501071_0077026_52_594 176
267 3300049587 Ga0501071_0243796 Ga0501071_0243796_339_869 176
268 3300049588 Ga0501072_0000073 Ga0501072_0000073_50677_51276 176
269 3300049588 Ga0501072_0004739 Ga0501072_0004739_2486_3019 176
270 3300049588 Ga0501072_0040487 Ga0501072_0040487_2147_2677 176
271 3300049588 Ga0501072_0057018 Ga0501072_0057018_1079_1621 176
272 3300049588 Ga0501072_0328070 Ga0501072_0328070_600_1130 176
273 3300049590 Ga0501074_0580915 Ga0501074_0580915_235_777 176
274 3300049591 Ga0501075_0000001 Ga0501075_0000001_38003_38536 176
275 3300049591 Ga0501075_0000219 Ga0501075_0000219_8995_9594 176
276 3300049591 Ga0501075_0014099 Ga0501075_0014099_5154_5696 176
277 3300049591 Ga0501075_0276711 Ga0501075_0276711_686_1219 176
278 3300049591 Ga0501075_0852374 Ga0501075_0852374_152_682 176
279 3300049592 Ga0501076_0000001 Ga0501076_0000001_106633_107166 176
280 3300049592 Ga0501076_0000204 Ga0501076_0000204_16210_16809 176
281 3300049592 Ga0501076_0022040 Ga0501076_0022040_2425_2955 176
282 3300049592 Ga0501076_0095892 Ga0501076_0095892_96_629 176
283 3300049592 Ga0501076_0316217 Ga0501076_0316217_201_731 176
284 3300049593 Ga0501077_0000023 Ga0501077_0000023_20931_21530 176
285 3300049593 Ga0501077_0040082 Ga0501077_0040082_415_948 176
286 3300049660 Ga0501216_067479 Ga0501216_067479_180_710 176
287 3300049741 Ga0501079_0000015 Ga0501079_0000015_21990_22589 176
288 3300049741 Ga0501079_0002202 Ga0501079_0002202_7118_7651 176
289 3300049741 Ga0501079_0021996 Ga0501079_0021996_1501_2031 176
290 3300049741 Ga0501079_0027808 Ga0501079_0027808_1976_2509 176
291 3300049741 Ga0501079_0096245 Ga0501079_0096245_773_1303 176
292 3300049741 Ga0501079_0155480 Ga0501079_0155480_541_1083 176
293 3300049742 Ga0501080_0000495 Ga0501080_0000495_12693_13292 176
294 3300049742 Ga0501080_0038738 Ga0501080_0038738_1551_2084 176
295 3300049742 Ga0501080_0060309 Ga0501080_0060309_2688_3218 176
296 3300049742 Ga0501080_0206417 Ga0501080_0206417_231_773 176
297 3300049743 Ga0501081_0000182 Ga0501081_0000182_19640_20239 176
298 3300049743 Ga0501081_0021004 Ga0501081_0021004_417_950 176
299 3300049743 Ga0501081_0024979 Ga0501081_0024979_2798_3328 176
300 3300049743 Ga0501081_0237336 Ga0501081_0237336_129_671 176
301 3300049743 Ga0501081_0387371 Ga0501081_0387371_461_994 176
302 3300049744 Ga0501083_0016105 Ga0501083_0016105_2347_2946 176
303 3300049822 Ga0501035_0008834 Ga0501035_0008834_6979_7578 176
304 3300049822 Ga0501035_0064452 Ga0501035_0064452_2023_2556 176
305 3300049823 Ga0501044_0268592 Ga0501044_0268592_643_1242 176
306 3300049824 Ga0501045_0001141 Ga0501045_0001141_7225_7824 176
307 3300049824 Ga0501045_0006123 Ga0501045_0006123_3384_3914 176
308 3300049824 Ga0501045_0035961 Ga0501045_0035961_291_824 176
309 3300049824 Ga0501045_0164804 Ga0501045_0164804_337_867 176
310 3300050507 nmdc:mga05p37_15776_c1 nmdc:mga05p37_15776_c1_8379_8918 176
311 3300050507 nmdc:mga05p37_256609_c1 nmdc:mga05p37_256609_c1_848_1387 176
312 3300050507 nmdc:mga05p37_3324_c1 nmdc:mga05p37_3324_c1_122_802 176
313 3300050507 nmdc:mga05p37_62075_c1 nmdc:mga05p37_62075_c1_2811_3347 176
314 3300050508 nmdc:mga09592_44881_c1 nmdc:mga09592_44881_c1_1115_1651 176
315 3300050508 nmdc:mga09592_5329_c1 nmdc:mga09592_5329_c1_8507_9046 176
316 3300050509 nmdc:mga0qj67_3133_c1 nmdc:mga0qj67_3133_c1_4093_4632 176
317 3300050510 nmdc:mga06r32_1028856_c1 nmdc:mga06r32_1028856_c1_86_619 176
318 3300050510 nmdc:mga06r32_128191_c1 nmdc:mga06r32_128191_c1_296_832 176
319 3300050512 nmdc:mga0n895_45790_c1 nmdc:mga0n895_45790_c1_1600_2136 176
320 3300050512 nmdc:mga0n895_579754_c1 nmdc:mga0n895_579754_c1_234_770 176
321 3300050513 nmdc:mga0rr50_10564_c1 nmdc:mga0rr50_10564_c1_620_1156 176
322 3300050513 nmdc:mga0rr50_3653_c1 nmdc:mga0rr50_3653_c1_7674_8210 176
323 3300050515 nmdc:mga0a205_122070_c1 nmdc:mga0a205_122070_c1_1220_1759 176
324 3300050515 nmdc:mga0a205_24194_c1 nmdc:mga0a205_24194_c1_918_1454 176
325 3300050515 nmdc:mga0a205_538515_c1 nmdc:mga0a205_538515_c1_205_741 176
326 3300050515 nmdc:mga0a205_692726_c1 nmdc:mga0a205_692726_c1_256_819 176
327 3300054114 Ga0501084_0000142 Ga0501084_0000142_22646_23245 176
328 3300054114 Ga0501084_0039077 Ga0501084_0039077_2713_3243 176
329 3300054114 Ga0501084_0108719 Ga0501084_0108719_1241_1774 176
330 3300059426 Ga0590077_028156 Ga0590077_028156_346_888 176
331 3300060353 Ga0501082_0000718 Ga0501082_0000718_8707_9306 176
332 3300060353 Ga0501082_0020684 Ga0501082_0020684_940_1473 176
333 3300060353 Ga0501082_0290515 Ga0501082_0290515_623_1156 176
334 3300060353 Ga0501082_0539155 Ga0501082_0539155_383_925 176
335 3300060353 Ga0501082_1135632 Ga0501082_1135632_107_637 176
336 3300061734 Ga0530510_0000002 Ga0530510_0000002_188707_189240 176
337 3300061734 Ga0530510_0000633 Ga0530510_0000633_15553_16152 176
338 3300061734 Ga0530510_0032272 Ga0530510_0032272_1985_2527 176
339 3300061734 Ga0530510_0143829 Ga0530510_0143829_838_1368 176
340 3300061734 Ga0530510_0217084 Ga0530510_0217084_552_1085 176
341 3300005467 Ga0070706_100091355 Ga0070706_1000913553 177
342 3300005468 Ga0070707_100005569 Ga0070707_1000055694 177
343 3300005518 Ga0070699_100238619 Ga0070699_1002386192 177
344 3300005536 Ga0070697_100009741 Ga0070697_1000097413 177
345 3300005577 Ga0068857_100369714 Ga0068857_1003697142 177
346 3300005616 Ga0068852_101319654 Ga0068852_1013196541 177
347 3300006175 Ga0070712_100001268 Ga0070712_1000012682 177
348 3300006844 Ga0075428_100251957 Ga0075428_1002519572 177
349 3300006847 Ga0075431_100191636 Ga0075431_1001916362 177
350 3300006880 Ga0075429_100824876 Ga0075429_1008248762 177
351 3300007265 Ga0099794_10022751 Ga0099794_100227512 177
352 3300009094 Ga0111539_10872097 Ga0111539_108720972 177
353 3300009147 Ga0114129_11733700 Ga0114129_117337001 177
354 3300009177 Ga0105248_10435676 Ga0105248_104356762 177
355 3300009553 Ga0105249_10450405 Ga0105249_104504051 177
356 3300025910 Ga0207684_10029061 Ga0207684_100290616 177
357 3300025910 Ga0207684_10071673 Ga0207684_100716733 177
358 3300025915 Ga0207693_10005491 Ga0207693_100054912 177
359 3300025916 Ga0207663_10052673 Ga0207663_100526732 177
360 3300025922 Ga0207646_10032777 Ga0207646_100327774 177
361 3300026116 Ga0207674_10824438 Ga0207674_108244382 177
362 3300027671 Ga0209588_1027977 Ga0209588_10279774 177
363 3300028380 Ga0268265_11612497 Ga0268265_116124971 177
364 3300028381 Ga0268264_10301158 Ga0268264_103011582 177
365 3300031548 Ga0307408_100620123 Ga0307408_1006201232 177
366 3300049577 Ga0501041_0072135 Ga0501041_0072135_1217_1759 177
367 3300049580 Ga0501046_0403145 Ga0501046_0403145_322_858 177
368 3300049593 Ga0501077_0203702 Ga0501077_0203702_493_1035 177
369 3300050507 nmdc:mga05p37_1240038_c1 nmdc:mga05p37_1240038_c1_189_722 177
370 3300050508 nmdc:mga09592_264044_c1 nmdc:mga09592_264044_c1_919_1452 177
371 3300050509 nmdc:mga0qj67_134086_c1 nmdc:mga0qj67_134086_c1_187_729 177
372 3300050510 nmdc:mga06r32_42231_c1 nmdc:mga06r32_42231_c1_282_815 177
373 3300050511 nmdc:mga08y16_662076_c1 nmdc:mga08y16_662076_c1_198_731 177
374 3300049592 Ga0501076_0265530 Ga0501076_0265530_195_731 178
375 3300049741 Ga0501079_1139629 Ga0501079_1139629_43_579 178
376 3300005330 Ga0070690_100212129 Ga0070690_1002121291 179
377 3300005334 Ga0068869_100016410 Ga0068869_1000164103 179
378 3300005337 Ga0070682_100027285 Ga0070682_1000272853 179
379 3300005339 Ga0070660_100076134 Ga0070660_1000761342 179
380 3300005340 Ga0070689_100305675 Ga0070689_1003056752 179
381 3300005340 Ga0070689_101614992 Ga0070689_1016149921 179
382 3300005341 Ga0070691_10013026 Ga0070691_100130262 179
383 3300005341 Ga0070691_10109026 Ga0070691_101090263 179
384 3300005341 Ga0070691_10375006 Ga0070691_103750062 179
385 3300005344 Ga0070661_100003719 Ga0070661_1000037192 179
386 3300005345 Ga0070692_10075425 Ga0070692_100754251 179
387 3300005366 Ga0070659_100026257 Ga0070659_1000262574 179
388 3300005440 Ga0070705_100553227 Ga0070705_1005532272 179
389 3300005444 Ga0070694_100036700 Ga0070694_1000367002 179
390 3300005444 Ga0070694_100090086 Ga0070694_1000900863 179
391 3300005444 Ga0070694_100090987 Ga0070694_1000909872 179
392 3300005445 Ga0070708_100444030 Ga0070708_1004440302 179
393 3300005457 Ga0070662_100064949 Ga0070662_1000649492 179
394 3300005459 Ga0068867_100009601 Ga0068867_1000096012 179
395 3300005467 Ga0070706_100124994 Ga0070706_1001249944 179
396 3300005467 Ga0070706_100166918 Ga0070706_1001669182 179
397 3300005467 Ga0070706_100329563 Ga0070706_1003295632 179
398 3300005467 Ga0070706_100533191 Ga0070706_1005331912 179
399 3300005467 Ga0070706_100985010 Ga0070706_1009850102 179
400 3300005468 Ga0070707_100044935 Ga0070707_1000449352 179
401 3300005468 Ga0070707_100947201 Ga0070707_1009472012 179
402 3300005468 Ga0070707_101489258 Ga0070707_1014892581 179
403 3300005471 Ga0070698_100110695 Ga0070698_1001106953 179
404 3300005518 Ga0070699_100181824 Ga0070699_1001818243 179
405 3300005530 Ga0070679_100001419 Ga0070679_10000141918 179
406 3300005536 Ga0070697_100018252 Ga0070697_1000182526 179
407 3300005536 Ga0070697_100144806 Ga0070697_1001448062 179
408 3300005539 Ga0068853_100195165 Ga0068853_1001951651 179
409 3300005543 Ga0070672_100177425 Ga0070672_1001774252 179
410 3300005544 Ga0070686_100101685 Ga0070686_1001016852 179
411 3300005545 Ga0070695_100011721 Ga0070695_1000117212 179
412 3300005545 Ga0070695_100040504 Ga0070695_1000405042 179
413 3300005545 Ga0070695_100069377 Ga0070695_1000693772 179
414 3300005545 Ga0070695_100080733 Ga0070695_1000807332 179
415 3300005546 Ga0070696_100002374 Ga0070696_1000023742 179
416 3300005547 Ga0070693_100087506 Ga0070693_1000875063 179
417 3300005549 Ga0070704_100144635 Ga0070704_1001446352 179
418 3300005563 Ga0068855_100002166 Ga0068855_1000021662 179
419 3300005564 Ga0070664_100001058 Ga0070664_1000010585 179
420 3300005577 Ga0068857_100003334 Ga0068857_1000033342 179
421 3300005577 Ga0068857_100136150 Ga0068857_1001361502 179
422 3300005578 Ga0068854_100077736 Ga0068854_1000777362 179
423 3300005614 Ga0068856_100001265 Ga0068856_10000126518 179
424 3300005617 Ga0068859_100039488 Ga0068859_1000394884 179
425 3300005617 Ga0068859_100136536 Ga0068859_1001365363 179
426 3300005617 Ga0068859_100954502 Ga0068859_1009545022 179
427 3300005617 Ga0068859_101094330 Ga0068859_1010943302 179
428 3300005618 Ga0068864_100007588 Ga0068864_1000075887 179
429 3300005840 Ga0068870_10014547 Ga0068870_100145472 179
430 3300005841 Ga0068863_100047386 Ga0068863_1000473864 179
431 3300005843 Ga0068860_100020406 Ga0068860_1000204064 179
432 3300005844 Ga0068862_100019777 Ga0068862_1000197775 179
433 3300005844 Ga0068862_100177518 Ga0068862_1001775182 179
434 3300006028 Ga0070717_10927162 Ga0070717_109271622 179
435 3300006931 Ga0097620_100039488 Ga0097620_1000394884 179
436 3300006931 Ga0097620_100136538 Ga0097620_1001365383 179
437 3300006931 Ga0097620_100954510 Ga0097620_1009545102 179
438 3300006931 Ga0097620_101094325 Ga0097620_1010943252 179
439 3300009093 Ga0105240_11402790 Ga0105240_114027902 179
440 3300009148 Ga0105243_10448763 Ga0105243_104487632 179
441 3300009174 Ga0105241_10229871 Ga0105241_102298712 179
442 3300009177 Ga0105248_10009600 Ga0105248_100096003 179
443 3300009545 Ga0105237_10456279 Ga0105237_104562792 179
444 3300011119 Ga0105246_10503169 Ga0105246_105031692 179
445 3300013102 Ga0157371_10339387 Ga0157371_103393872 179
446 3300013105 Ga0157369_11495955 Ga0157369_114959552 179
447 3300013306 Ga0163162_10242250 Ga0163162_102422503 179
448 3300013307 Ga0157372_10041609 Ga0157372_100416094 179
449 3300013307 Ga0157372_10082945 Ga0157372_100829453 179
450 3300013308 Ga0157375_10496116 Ga0157375_104961162 179
451 3300014326 Ga0157380_10183068 Ga0157380_101830682 179
452 3300014497 Ga0182008_10057446 Ga0182008_100574462 179
453 3300015262 Ga0182007_10007942 Ga0182007_100079423 179
454 3300025885 Ga0207653_10090858 Ga0207653_100908582 179
455 3300025908 Ga0207643_10006668 Ga0207643_100066682 179
456 3300025910 Ga0207684_10016691 Ga0207684_100166914 179
457 3300025910 Ga0207684_10043072 Ga0207684_100430724 179
458 3300025910 Ga0207684_10193183 Ga0207684_101931832 179
459 3300025910 Ga0207684_10403183 Ga0207684_104031832 179
460 3300025911 Ga0207654_10137020 Ga0207654_101370203 179
461 3300025912 Ga0207707_10000150 Ga0207707_1000015066 179
462 3300025914 Ga0207671_10335791 Ga0207671_103357912 179
463 3300025919 Ga0207657_10072530 Ga0207657_100725302 179
464 3300025920 Ga0207649_10031795 Ga0207649_100317953 179
465 3300025921 Ga0207652_10002718 Ga0207652_100027184 179
466 3300025922 Ga0207646_10001645 Ga0207646_100016453 179
467 3300025922 Ga0207646_10021134 Ga0207646_100211344 179
468 3300025922 Ga0207646_10064752 Ga0207646_100647526 179
469 3300025925 Ga0207650_10017435 Ga0207650_100174354 179
470 3300025932 Ga0207690_10003228 Ga0207690_100032287 179
471 3300025933 Ga0207706_10050413 Ga0207706_100504132 179
472 3300025936 Ga0207670_10169263 Ga0207670_101692632 179
473 3300025936 Ga0207670_10691783 Ga0207670_106917831 179
474 3300025940 Ga0207691_10145941 Ga0207691_101459413 179
475 3300025941 Ga0207711_10046929 Ga0207711_100469293 179
476 3300025942 Ga0207689_10058802 Ga0207689_100588023 179
477 3300025945 Ga0207679_10000326 Ga0207679_1000032626 179
478 3300025949 Ga0207667_10000777 Ga0207667_1000077719 179
479 3300025961 Ga0207712_10036706 Ga0207712_100367062 179
480 3300025981 Ga0207640_10069711 Ga0207640_100697113 179
481 3300026035 Ga0207703_10615670 Ga0207703_106156702 179
482 3300026075 Ga0207708_10184726 Ga0207708_101847262 179
483 3300026078 Ga0207702_10001073 Ga0207702_1000107312 179
484 3300026088 Ga0207641_10026926 Ga0207641_100269262 179
485 3300026089 Ga0207648_10620466 Ga0207648_106204662 179
486 3300026095 Ga0207676_10008973 Ga0207676_100089734 179
487 3300026116 Ga0207674_10001586 Ga0207674_1000158611 179
488 3300026116 Ga0207674_10121433 Ga0207674_101214332 179
489 3300026118 Ga0207675_100280155 Ga0207675_1002801552 179
490 3300027614 Ga0209970_1002377 Ga0209970_10023772 179
491 3300027682 Ga0209971_1001693 Ga0209971_10016935 179
492 3300027695 Ga0209966_1000963 Ga0209966_10009635 179
493 3300027717 Ga0209998_10001611 Ga0209998_100016115 179
494 3300028380 Ga0268265_10079770 Ga0268265_100797702 179
495 3300035090 Ga0373949_0015825 Ga0373949_0015825_1002_1541 179
496 3300035114 Ga0373939_0260871 Ga0373939_0260871_23_562 179
497 3300042000 Ga0439437_004711 Ga0439437_004711_857_1396 179
498 3300042142 Ga0450905_063647 Ga0450905_063647_43_585 179
499 3300042438 Ga0439459_0003020 Ga0439459_0003020_773_1312 179
500 3300044712 Ga0453684_0202098 Ga0453684_0202098_367_906 179
501 3300045051 Ga0451576_0090634 Ga0451576_0090634_1947_2486 179
502 3300045051 Ga0451576_0133536 Ga0451576_0133536_173_712 179
503 3300045051 Ga0451576_0331242 Ga0451576_0331242_21_560 179
504 3300045051 Ga0451576_0561499 Ga0451576_0561499_209_748 179
505 3300048915 Ga0496112_0173032 Ga0496112_0173032_858_1397 179
506 3300049570 Ga0501033_0247631 Ga0501033_0247631_487_1026 179
507 3300049574 Ga0501038_0282565 Ga0501038_0282565_203_742 179
508 3300049574 Ga0501038_0392438 Ga0501038_0392438_302_841 179
509 3300049576 Ga0501040_0049645 Ga0501040_0049645_2140_2679 179
510 3300049577 Ga0501041_0046870 Ga0501041_0046870_1310_1849 179
511 3300049578 Ga0501042_0029133 Ga0501042_0029133_204_743 179
512 3300049578 Ga0501042_0797670 Ga0501042_0797670_106_645 179
513 3300049579 Ga0501043_0342970 Ga0501043_0342970_490_1029 179
514 3300049582 Ga0501048_0273201 Ga0501048_0273201_267_806 179
515 3300049584 Ga0501068_0154578 Ga0501068_0154578_818_1357 179
516 3300049588 Ga0501072_0100889 Ga0501072_0100889_248_787 179
517 3300049588 Ga0501072_0340422 Ga0501072_0340422_253_792 179
518 3300049588 Ga0501072_0630522 Ga0501072_0630522_178_717 179
519 3300049590 Ga0501074_0846100 Ga0501074_0846100_72_611 179
520 3300049591 Ga0501075_0196570 Ga0501075_0196570_515_1054 179
521 3300049591 Ga0501075_0545933 Ga0501075_0545933_155_694 179
522 3300049592 Ga0501076_0221823 Ga0501076_0221823_845_1384 179
523 3300049592 Ga0501076_0314657 Ga0501076_0314657_205_744 179
524 3300049593 Ga0501077_0085655 Ga0501077_0085655_1171_1710 179
525 3300049593 Ga0501077_0099200 Ga0501077_0099200_1086_1625 179
526 3300049741 Ga0501079_0016366 Ga0501079_0016366_4141_4680 179
527 3300049741 Ga0501079_0168009 Ga0501079_0168009_829_1368 179
528 3300049742 Ga0501080_0236045 Ga0501080_0236045_174_713 179
529 3300049743 Ga0501081_0002786 Ga0501081_0002786_6688_7227 179
530 3300049743 Ga0501081_0173882 Ga0501081_0173882_510_1049 179
531 3300049744 Ga0501083_0145728 Ga0501083_0145728_621_1160 179
532 3300049824 Ga0501045_0012899 Ga0501045_0012899_1565_2104 179
533 3300050507 nmdc:mga05p37_2413_c1 nmdc:mga05p37_2413_c1_1651_2190 179
534 3300054114 Ga0501084_0044573 Ga0501084_0044573_2153_2692 179
535 3300054114 Ga0501084_0321597 Ga0501084_0321597_158_697 179
536 3300060353 Ga0501082_0027952 Ga0501082_0027952_2075_2614 179
537 3300060353 Ga0501082_0783289 Ga0501082_0783289_129_668 179
538 3300061734 Ga0530510_0067991 Ga0530510_0067991_1114_1653 179
539 3300061734 Ga0530510_0266490 Ga0530510_0266490_78_617 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

36

154

0.96

PF08534

Redoxin

Redoxin

35

166

0.95

PF13905

Thioredoxin_8

Thioredoxin-like

60

151

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.9527 39 175
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.9507 41 174
2h1b-assembly2.cif.gz_B resa e80q 0.9492 40 174
2h1a-assembly1.cif.gz_A resa c74a variant 0.9401 41 177
3c73-assembly1.cif.gz_A structure of cehc variant resa 0.94 41 177
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9479 40 174 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9365 46 174 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9216 40 174 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9193 45 177 3.40.30.10
2l5oA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8977 43 174 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V7HQ72-F1-model_v4 Thioredoxin domain-containing protein 0.9868 38 174 GO:0016209
GO:0016491
AF-A0A2H5YDY6-F1-model_v4 Thiol-disulfide oxidoreductase ResA 0.9816 42 175 GO:0016209
GO:0016491
AF-A0A382PYB5-F1-model_v4 Thioredoxin domain-containing protein 0.9783 36 175 GO:0016209
GO:0016491
AF-A0A1G0FVZ1-F1-model_v4 Thioredoxin domain-containing protein 0.9772 42 174 GO:0015036
GO:0017004
GO:0030313
AF-A0A2V7HQ72-F1-model_v4 Thioredoxin domain-containing protein 0.9728 38 174 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
91 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map