F461115

General Info

Members Datasets Scaffolds Average Seq Length
539 252 1078 260

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100072899|Ga0070684_1000728992
Length 276
Sequence MVEAPPGASTIGRSPPVTDTPLLEIRGLSKTFGSVQALTEVDFEVRAGEVMALVGDNGAGKSTLIKCIAGIHGYDSGEIVFDGQPVTIHGPKDAARLGIEVVYQDLALCDNLDVVQNMYLGREERDWLFRLKEPLMEQRTTETLRGLAVTTIRSIRQPVASLSGGQRQSVAVAKAVQWNSRLVILDEPTAALGVAQTRQVLELVKRLAEQGLAVILVSHNLHDIFEVATRITVLRLGRDVGVYDRATTTQQEVVSAITAGIPTKVAGMAETAGDVT

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 9.83
Rhizosphere 89.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100072899 3300005535 Bacteria 3024
2 ARcpr5oldR_c001330 3300000041 Bacteria 2501
3 JGI24739J22299_10028344 3300001989 Bacteria 1953
4 JGI24738J21930_10001969 3300002075 Bacteria 5524
5 Ga0070658_10010221 3300005327 Bacteria 7525
6 Ga0070676_10510577 3300005328 Bacteria 855
7 Ga0070683_100013548 3300005329 Bacteria 7116
8 Ga0070683_100038253 3300005329 Bacteria 4396
9 Ga0070683_100047892 3300005329 Bacteria 3951
10 Ga0070670_100014981 3300005331 Bacteria 6654
11 Ga0070670_100113397 3300005331 Bacteria 2337
12 Ga0068869_100023258 3300005334 Bacteria 4277
13 Ga0070680_100055467 3300005336 Bacteria 3238
14 Ga0070680_100083491 3300005336 Bacteria 2638
15 Ga0070680_100100074 3300005336 Bacteria 2406
16 Ga0070682_100034907 3300005337 Bacteria 3066
17 Ga0070682_100114685 3300005337 Bacteria 1801
18 Ga0068868_100050793 3300005338 Bacteria 3258
19 Ga0070660_100021968 3300005339 Bacteria 4713
20 Ga0070660_100074778 3300005339 Bacteria 2651
21 Ga0070691_10006978 3300005341 Bacteria 5174
22 Ga0070687_100029966 3300005343 Bacteria 2656
23 Ga0070661_100022629 3300005344 Bacteria 4500
24 Ga0070661_100038788 3300005344 Bacteria 3469
25 Ga0070692_10002758 3300005345 Bacteria 6914
26 Ga0070692_10021388 3300005345 Bacteria 3146
27 Ga0070692_10032403 3300005345 Bacteria 2627
28 Ga0070668_100134097 3300005347 Bacteria 1990
29 Ga0070669_100106964 3300005353 Bacteria 2118
30 Ga0070675_100029021 3300005354 Bacteria 4458
31 Ga0070675_100044171 3300005354 Bacteria 3644
32 Ga0070675_100052249 3300005354 Bacteria 3359
33 Ga0070675_100472624 3300005354 Bacteria 1127
34 Ga0070671_100193793 3300005355 Bacteria 1723
35 Ga0070674_100014596 3300005356 Bacteria 4886
36 Ga0070674_100060606 3300005356 Bacteria 2638
37 Ga0070674_100069071 3300005356 Bacteria 2491
38 Ga0070674_100247130 3300005356 Bacteria 1399
39 Ga0070673_100014828 3300005364 Bacteria 5449
40 Ga0070673_100035914 3300005364 Bacteria 3762
41 Ga0070673_100225557 3300005364 Bacteria 1624
42 Ga0070688_100002575 3300005365 Bacteria 9188
43 Ga0070659_100053627 3300005366 Bacteria 3174
44 Ga0070659_100063252 3300005366 Bacteria 2927
45 Ga0070659_100115830 3300005366 Bacteria 2166
46 Ga0070703_10001002 3300005406 Bacteria 8880
47 Ga0070703_10006026 3300005406 Bacteria 3394
48 Ga0070709_10458465 3300005434 Bacteria 961
49 Ga0070714_100034642 3300005435 Bacteria 4228
50 Ga0070714_100075132 3300005435 Bacteria 2932
51 Ga0070714_100352509 3300005435 Bacteria 1382
52 Ga0070713_100077361 3300005436 Bacteria 2828
53 Ga0070701_10010706 3300005438 Bacteria 4069
54 Ga0070701_10077570 3300005438 Bacteria 1791
55 Ga0070705_100029541 3300005440 Bacteria 3016
56 Ga0070700_100038585 3300005441 Bacteria 2912
57 Ga0070700_100232535 3300005441 Bacteria 1313
58 Ga0070700_100263273 3300005441 Bacteria 1242
59 Ga0070700_100330009 3300005441 Bacteria 1124
60 Ga0070708_100441917 3300005445 Bacteria 1227
61 Ga0070708_100564905 3300005445 Bacteria 1073
62 Ga0070663_100026864 3300005455 Bacteria 3902
63 Ga0070663_100028658 3300005455 Bacteria 3794
64 Ga0070663_100047859 3300005455 Bacteria 3030
65 Ga0070678_100017605 3300005456 Bacteria 4608
66 Ga0070678_100035787 3300005456 Bacteria 3470
67 Ga0070662_100024647 3300005457 Bacteria 4147
68 Ga0070662_100029960 3300005457 Bacteria 3803
69 Ga0070681_10027977 3300005458 Bacteria 5668
70 Ga0070681_10062935 3300005458 Bacteria 3683
71 Ga0070681_10161534 3300005458 Bacteria 2164
72 Ga0068867_100040283 3300005459 Bacteria 3408
73 Ga0068867_100381002 3300005459 Bacteria 1185
74 Ga0070685_10024662 3300005466 Bacteria 3304
75 Ga0070685_10196486 3300005466 Bacteria 1308
76 Ga0070706_100144577 3300005467 Bacteria 2221
77 Ga0070707_100341752 3300005468 Bacteria 1454
78 Ga0070698_100034248 3300005471 Bacteria 5259
79 Ga0070698_100100228 3300005471 Bacteria 2869
80 Ga0070698_100359524 3300005471 Bacteria 1387
81 Ga0070698_100402669 3300005471 Bacteria 1302
82 Ga0070699_100402933 3300005518 Bacteria 1237
83 Ga0070679_100074448 3300005530 Bacteria 3386
84 Ga0070679_100079670 3300005530 Bacteria 3265
85 Ga0070679_100094594 3300005530 Bacteria 2975
86 Ga0070684_100002723 3300005535 Bacteria 13056
87 Ga0070684_100063938 3300005535 Bacteria 3227
88 Ga0070697_100033789 3300005536 Bacteria 4122
89 Ga0070697_100333410 3300005536 Bacteria 1308
90 Ga0068853_100018869 3300005539 Bacteria 5712
91 Ga0070672_100014741 3300005543 Bacteria 5545
92 Ga0070672_100028755 3300005543 Bacteria 4160
93 Ga0070686_100019434 3300005544 Bacteria 4003
94 Ga0070686_100155206 3300005544 Bacteria 1607
95 Ga0070696_100065742 3300005546 Bacteria 2542
96 Ga0070696_100200723 3300005546 Bacteria 1489
97 Ga0070693_100007439 3300005547 Bacteria 5356
98 Ga0070693_100017238 3300005547 Bacteria 3752
99 Ga0070693_100025144 3300005547 Bacteria 3202
100 Ga0070693_100123691 3300005547 Bacteria 1608
101 Ga0070665_100025531 3300005548 Bacteria 5951
102 Ga0070704_100026299 3300005549 Bacteria 3844
103 Ga0070704_100046800 3300005549 Bacteria 3019
104 Ga0068855_100024261 3300005563 Bacteria 7261
105 Ga0070664_100017988 3300005564 Bacteria 5803
106 Ga0070664_100083222 3300005564 Bacteria 2760
107 Ga0070664_100118439 3300005564 Bacteria 2316
108 Ga0070664_100317687 3300005564 Bacteria 1410
109 Ga0070664_100577946 3300005564 Bacteria 1041
110 Ga0068857_100171448 3300005577 Bacteria 1973
111 Ga0068854_100067513 3300005578 Bacteria 2605
112 Ga0068854_100172997 3300005578 Bacteria 1681
113 Ga0068856_100630546 3300005614 Bacteria 1093
114 Ga0068856_100742379 3300005614 Bacteria 1002
115 Ga0070702_100014589 3300005615 Bacteria 3988
116 Ga0070702_100056198 3300005615 Bacteria 2272
117 Ga0068852_100047759 3300005616 Bacteria 3654
118 Ga0068852_100084142 3300005616 Bacteria 2830
119 Ga0068859_100015815 3300005617 Bacteria 7581
120 Ga0068864_100011033 3300005618 Bacteria 7468
121 Ga0068866_10004415 3300005718 Bacteria 5775
122 Ga0068866_10128482 3300005718 Bacteria 1438
123 Ga0068861_100011331 3300005719 Bacteria 6192
124 Ga0068851_10034690 3300005834 Bacteria 2518
125 Ga0068851_10091396 3300005834 Bacteria 1602
126 Ga0068870_10003881 3300005840 Bacteria 6374
127 Ga0068863_100025518 3300005841 Bacteria 5635
128 Ga0068858_100007230 3300005842 Bacteria 10760
129 Ga0068860_100044354 3300005843 Bacteria 4238
130 Ga0068862_100334824 3300005844 Bacteria 1400
131 Ga0068862_100415054 3300005844 Bacteria 1262
132 Ga0081455_10052369 3300005937 Bacteria 3495
133 Ga0081539_10007031 3300005985 Bacteria 10430
134 Ga0075365_10265097 3300006038 Bacteria 1208
135 Ga0075364_10287099 3300006051 Bacteria 1119
136 Ga0075432_10009009 3300006058 Bacteria 3402
137 Ga0070715_10027424 3300006163 Bacteria 2275
138 Ga0070712_100048488 3300006175 Bacteria 2944
139 Ga0097621_100109550 3300006237 Bacteria 2333
140 Ga0097621_100503927 3300006237 Bacteria 1097
141 Ga0097621_100579363 3300006237 Bacteria 1024
142 Ga0068871_100032961 3300006358 Bacteria 4096
143 Ga0068871_100036664 3300006358 Bacteria 3906
144 Ga0075428_100166052 3300006844 Bacteria 2394
145 Ga0075428_100217144 3300006844 Bacteria 2065
146 Ga0075433_10002708 3300006852 Bacteria 13528
147 Ga0075433_10117631 3300006852 Bacteria 2358
148 Ga0075433_10195823 3300006852 Bacteria 1798
149 Ga0075434_100007653 3300006871 Bacteria 9993
150 Ga0075434_100128714 3300006871 Bacteria 2549
151 Ga0075434_100394203 3300006871 Bacteria 1405
152 Ga0075434_100531109 3300006871 Bacteria 1197
153 Ga0075429_100069232 3300006880 Bacteria 3073
154 Ga0075429_100202020 3300006880 Bacteria 1741
155 Ga0068865_100002899 3300006881 Bacteria 10226
156 Ga0068865_100005561 3300006881 Bacteria 7641
157 Ga0068865_100040088 3300006881 Bacteria 3180
158 Ga0068865_100334094 3300006881 Bacteria 1223
159 Ga0068865_100417079 3300006881 Bacteria 1103
160 Ga0075436_100002088 3300006914 Bacteria 13795
161 Ga0075436_100005923 3300006914 Bacteria 8399
162 Ga0075436_100066001 3300006914 Bacteria 2501
163 Ga0097620_100015816 3300006931 Bacteria 7581
164 Ga0075435_100001155 3300007076 Bacteria 16859
165 Ga0075435_100287069 3300007076 Bacteria 1405
166 Ga0105244_10203898 3300009036 Bacteria 932
167 Ga0111539_10085491 3300009094 Bacteria 3707
168 Ga0111539_10109761 3300009094 Bacteria 3237
169 Ga0111539_10166868 3300009094 Bacteria 2573
170 Ga0111539_10878484 3300009094 Bacteria 1043
171 Ga0105245_10024531 3300009098 Bacteria 5296
172 Ga0105245_10102128 3300009098 Bacteria 2655
173 Ga0105245_10276814 3300009098 Bacteria 1639
174 Ga0105245_10501099 3300009098 Bacteria 1230
175 Ga0105247_10055011 3300009101 Bacteria 2456
176 Ga0114129_10000910 3300009147 Bacteria 38506
177 Ga0114129_10021045 3300009147 Bacteria 9263
178 Ga0114129_10024232 3300009147 Bacteria 8599
179 Ga0114129_10038125 3300009147 Bacteria 6781
180 Ga0114129_10084055 3300009147 Bacteria 4420
181 Ga0114129_10124287 3300009147 Bacteria 3549
182 Ga0114129_10128269 3300009147 Bacteria 3486
183 Ga0114129_10137513 3300009147 Bacteria 3351
184 Ga0114129_10190508 3300009147 Bacteria 2785
185 Ga0114129_10410750 3300009147 Bacteria 1782
186 Ga0114129_10569024 3300009147 Bacteria 1472
187 Ga0105243_10007846 3300009148 Bacteria 8204
188 Ga0105243_10131551 3300009148 Bacteria 2123
189 Ga0105243_10132298 3300009148 Bacteria 2118
190 Ga0105243_10195827 3300009148 Bacteria 1769
191 Ga0105241_10010013 3300009174 Bacteria 6960
192 Ga0105241_10226870 3300009174 Bacteria 1573
193 Ga0105242_10014191 3300009176 Bacteria 6168
194 Ga0105242_10064775 3300009176 Bacteria 3014
195 Ga0105248_10050536 3300009177 Bacteria 4663
196 Ga0105248_10120982 3300009177 Bacteria 2953
197 Ga0105248_10208365 3300009177 Bacteria 2203
198 Ga0105248_10334828 3300009177 Bacteria 1704
199 Ga0105237_10140717 3300009545 Bacteria 2407
200 Ga0105238_10097792 3300009551 Bacteria 2920
201 Ga0105249_10038292 3300009553 Bacteria 4351
202 Ga0105249_10590487 3300009553 Bacteria 1164
203 Ga0105239_10051255 3300010375 Bacteria 4525
204 Ga0105239_10107500 3300010375 Bacteria 3091
205 Ga0105239_10350208 3300010375 Bacteria 1667
206 Ga0105246_10009623 3300011119 Bacteria 5956
207 Ga0105246_10063890 3300011119 Bacteria 2569
208 Ga0105246_10117656 3300011119 Bacteria 1964
209 Ga0157371_10008275 3300013102 Bacteria 8309
210 Ga0157371_10113965 3300013102 Bacteria 1920
211 Ga0157374_10062109 3300013296 Bacteria 3500
212 Ga0157378_10275842 3300013297 Bacteria 1619
213 Ga0163162_10075023 3300013306 Bacteria 3442
214 Ga0157372_10049545 3300013307 Bacteria 4670
215 Ga0157372_10457690 3300013307 Bacteria 1487
216 Ga0157375_10127882 3300013308 Bacteria 2658
217 Ga0157375_10155109 3300013308 Bacteria 2428
218 Ga0163163_10040787 3300014325 Bacteria 4536
219 Ga0163163_10089769 3300014325 Bacteria 3086
220 Ga0182008_10000959 3300014497 Bacteria 20051
221 Ga0157377_10007828 3300014745 Bacteria 5178
222 Ga0157377_10019402 3300014745 Bacteria 3552
223 Ga0157377_10151498 3300014745 Bacteria 1434
224 Ga0157377_10273407 3300014745 Bacteria 1104
225 Ga0157379_10038870 3300014968 Bacteria 4245
226 Ga0157376_10283646 3300014969 Bacteria 1561
227 Ga0182007_10009496 3300015262 Bacteria 3917
228 Ga0207653_10000439 3300025885 Bacteria 17034
229 Ga0207653_10010509 3300025885 Bacteria 2886
230 Ga0207710_10006471 3300025900 Bacteria 4998
231 Ga0207688_10034125 3300025901 Bacteria 2816
232 Ga0207699_10256310 3300025906 Bacteria 1207
233 Ga0207643_10004645 3300025908 Bacteria 7377
234 Ga0207643_10038584 3300025908 Bacteria 2683
235 Ga0207643_10040639 3300025908 Bacteria 2619
236 Ga0207684_10104157 3300025910 Bacteria 2426
237 Ga0207654_10055724 3300025911 Bacteria 2290
238 Ga0207707_10026094 3300025912 Bacteria 5108
239 Ga0207707_10149470 3300025912 Bacteria 2042
240 Ga0207693_10006690 3300025915 Bacteria 9520
241 Ga0207663_10012162 3300025916 Bacteria 4644
242 Ga0207660_10031697 3300025917 Bacteria 3643
243 Ga0207660_10052303 3300025917 Bacteria 2907
244 Ga0207660_10108962 3300025917 Bacteria 2081
245 Ga0207660_10367074 3300025917 Bacteria 1155
246 Ga0207662_10028376 3300025918 Bacteria 3234
247 Ga0207662_10031143 3300025918 Bacteria 3099
248 Ga0207657_10036723 3300025919 Bacteria 4383
249 Ga0207657_10044449 3300025919 Bacteria 3905
250 Ga0207649_10057120 3300025920 Bacteria 2439
251 Ga0207652_10045759 3300025921 Bacteria 3731
252 Ga0207652_10064936 3300025921 Bacteria 3159
253 Ga0207646_10302531 3300025922 Bacteria 1445
254 Ga0207681_10076128 3300025923 Bacteria 2356
255 Ga0207694_10071318 3300025924 Bacteria 2714
256 Ga0207694_10084473 3300025924 Bacteria 2497
257 Ga0207650_10010855 3300025925 Bacteria 6260
258 Ga0207659_10016197 3300025926 Bacteria 4847
259 Ga0207659_10028607 3300025926 Bacteria 3789
260 Ga0207659_10037634 3300025926 Bacteria 3360
261 Ga0207659_10195442 3300025926 Bacteria 1612
262 Ga0207687_10001388 3300025927 Bacteria 16531
263 Ga0207687_10006518 3300025927 Bacteria 7711
264 Ga0207687_10026562 3300025927 Bacteria 3878
265 Ga0207687_10029361 3300025927 Bacteria 3698
266 Ga0207687_10214443 3300025927 Bacteria 1512
267 Ga0207690_10016334 3300025932 Bacteria 4513
268 Ga0207690_10042477 3300025932 Bacteria 2986
269 Ga0207690_10050981 3300025932 Bacteria 2765
270 Ga0207706_10021103 3300025933 Bacteria 5850
271 Ga0207706_10263511 3300025933 Bacteria 1504
272 Ga0207686_10032395 3300025934 Bacteria 3110
273 Ga0207686_10041367 3300025934 Bacteria 2809
274 Ga0207686_10131437 3300025934 Bacteria 1717
275 Ga0207709_10007895 3300025935 Bacteria 5899
276 Ga0207709_10021206 3300025935 Bacteria 3676
277 Ga0207709_10078348 3300025935 Bacteria 2121
278 Ga0207709_10244905 3300025935 Bacteria 1306
279 Ga0207669_10030622 3300025937 Bacteria 2992
280 Ga0207669_10043171 3300025937 Bacteria 2639
281 Ga0207704_10008867 3300025938 Bacteria 4830
282 Ga0207704_10030544 3300025938 Bacteria 3022
283 Ga0207704_10043703 3300025938 Bacteria 2648
284 Ga0207704_10122525 3300025938 Bacteria 1783
285 Ga0207665_10250458 3300025939 Bacteria 1308
286 Ga0207691_10007140 3300025940 Bacteria 10779
287 Ga0207691_10023030 3300025940 Bacteria 5867
288 Ga0207691_10217485 3300025940 Bacteria 1658
289 Ga0207711_10261500 3300025941 Bacteria 1591
290 Ga0207689_10033988 3300025942 Bacteria 4235
291 Ga0207661_10025611 3300025944 Bacteria 4486
292 Ga0207661_10034840 3300025944 Bacteria 3918
293 Ga0207661_10165820 3300025944 Bacteria 1919
294 Ga0207679_10041824 3300025945 Bacteria 3289
295 Ga0207679_10290459 3300025945 Bacteria 1405
296 Ga0207679_10291246 3300025945 Bacteria 1404
297 Ga0207679_10293046 3300025945 Bacteria 1399
298 Ga0207667_10110384 3300025949 Bacteria 2837
299 Ga0207651_10008423 3300025960 Bacteria 5570
300 Ga0207651_10049891 3300025960 Bacteria 2838
301 Ga0207712_10070831 3300025961 Bacteria 2506
302 Ga0207712_10175644 3300025961 Bacteria 1678
303 Ga0207712_10650189 3300025961 Bacteria 916
304 Ga0207668_10073074 3300025972 Bacteria 2456
305 Ga0207640_10032916 3300025981 Bacteria 3219
306 Ga0207677_10032409 3300026023 Bacteria 3359
307 Ga0207703_10034360 3300026035 Bacteria 4023
308 Ga0207639_10028970 3300026041 Bacteria 4049
309 Ga0207639_10034916 3300026041 Bacteria 3719
310 Ga0207639_10087157 3300026041 Bacteria 2488
311 Ga0207639_10405144 3300026041 Bacteria 1229
312 Ga0207678_10031025 3300026067 Bacteria 4664
313 Ga0207678_10040661 3300026067 Bacteria 4031
314 Ga0207678_10048161 3300026067 Bacteria 3684
315 Ga0207678_10199837 3300026067 Bacteria 1709
316 Ga0207708_10062626 3300026075 Bacteria 2842
317 Ga0207708_10422104 3300026075 Bacteria 1106
318 Ga0207702_10027615 3300026078 Bacteria 4714
319 Ga0207641_10008963 3300026088 Bacteria 8265
320 Ga0207648_10009519 3300026089 Bacteria 9297
321 Ga0207648_10116232 3300026089 Bacteria 2351
322 Ga0207648_10314311 3300026089 Bacteria 1407
323 Ga0207676_10007259 3300026095 Bacteria 7850
324 Ga0207675_100021620 3300026118 Bacteria 5991
325 Ga0207675_100245975 3300026118 Bacteria 1730
326 Ga0207683_10031436 3300026121 Bacteria 4607
327 Ga0207683_10341644 3300026121 Bacteria 1373
328 Ga0207698_10040116 3300026142 Bacteria 3475
329 Ga0207698_10106839 3300026142 Bacteria 2335
330 Ga0207428_10032727 3300027907 Bacteria 4276
331 Ga0207428_10048584 3300027907 Bacteria 3403
332 Ga0207428_10050938 3300027907 Bacteria 3310
333 Ga0207428_10362278 3300027907 Bacteria 1066
334 Ga0268265_10225807 3300028380 Bacteria 1642
335 Ga0373928_0015238 3300035084 Bacteria 1563
336 Ga0373932_0000816 3300035112 Bacteria 9230
337 Ga0373939_0126580 3300035114 Bacteria 907
338 Ga0373941_0205649 3300035115 Bacteria 750
339 Ga0373942_0068535 3300035207 Bacteria 1031
340 Ga0373961_0008215 3300035241 Bacteria 2537
341 Ga0373961_0009743 3300035241 Bacteria 2355
342 Ga0373961_0117071 3300035241 Bacteria 879
343 Ga0373931_0002516 3300035691 Bacteria 8137
344 Ga0395899_0037380 3300037312 Bacteria 3639
345 Ga0395899_0088988 3300037312 Bacteria 2240
346 Ga0395899_0153653 3300037312 Bacteria 1630
347 Ga0395899_0299357 3300037312 Bacteria 1089
348 Ga0395900_0000672 3300037418 Bacteria 45487
349 Ga0395900_0023688 3300037418 Bacteria 6282
350 Ga0395900_0062397 3300037418 Bacteria 3831
351 Ga0395900_0126645 3300037418 Bacteria 2620
352 Ga0395900_0215714 3300037418 Bacteria 1936
353 Ga0395900_0436979 3300037418 Bacteria 1267
354 Ga0395898_0017705 3300037466 Bacteria 7272
355 Ga0395898_0042644 3300037466 Bacteria 4475
356 Ga0395898_0145794 3300037466 Bacteria 2266
357 Ga0395898_0163727 3300037466 Bacteria 2127
358 Ga0395898_0179152 3300037466 Bacteria 2025
359 Ga0395905_0065953 3300037471 Bacteria 3390
360 Ga0395905_0085118 3300037471 Bacteria 2963
361 Ga0395905_0085678 3300037471 Bacteria 2952
362 Ga0395905_0181392 3300037471 Bacteria 1976
363 Ga0395905_0195141 3300037471 Bacteria 1898
364 Ga0395905_0198566 3300037471 Bacteria 1881
365 Ga0395905_0425630 3300037471 Bacteria 1224
366 Ga0395901_0009214 3300038443 Bacteria 10001
367 Ga0395901_0011712 3300038443 Bacteria 8889
368 Ga0395901_0013130 3300038443 Bacteria 8407
369 Ga0395901_0029437 3300038443 Bacteria 5655
370 Ga0395901_0039688 3300038443 Bacteria 4873
371 Ga0395901_0201334 3300038443 Bacteria 2087
372 Ga0395901_0513602 3300038443 Bacteria 1218
373 Ga0450918_024187 3300042531 Bacteria 1063
374 Ga0466965_0174534 3300044683 Bacteria 1132
375 Ga0466963_0014940 3300044694 Bacteria 4797
376 Ga0466963_0044124 3300044694 Bacteria 2934
377 Ga0466957_0138262 3300044842 Bacteria 1567
378 Ga0466958_0009247 3300045836 Bacteria 5487
379 Ga0466958_0201203 3300045836 Bacteria 1267
380 Ga0495603_0089794 3300046455 Bacteria 1798
381 Ga0495603_0232976 3300046455 Bacteria 1061
382 Ga0495582_0070950 3300046473 Bacteria 1928
383 Ga0495582_0107144 3300046473 Bacteria 1568
384 Ga0495662_0184613 3300046476 Bacteria 1028
385 Ga0495664_0364342 3300046477 Bacteria 870
386 Ga0495630_0415795 3300046517 Bacteria 1030
387 Ga0495587_0070661 3300046536 Bacteria 2032
388 Ga0495656_0226365 3300046615 Bacteria 937
389 Ga0495634_0079808 3300046642 Bacteria 2142
390 Ga0495599_0084355 3300046678 Bacteria 1984
391 Ga0495647_0080468 3300046681 Bacteria 1320
392 Ga0495658_0026891 3300046683 Bacteria 3089
393 Ga0495676_0059402 3300047321 Bacteria 3003
394 Ga0495602_0073552 3300048088 Bacteria 2909
395 Ga0496100_0013108 3300048903 Bacteria 4772
396 Ga0496100_0022888 3300048903 Bacteria 3787
397 Ga0496100_0044100 3300048903 Bacteria 2855
398 Ga0496101_0045574 3300048904 Bacteria 3142
399 Ga0496101_0122660 3300048904 Bacteria 1966
400 Ga0496101_0151496 3300048904 Bacteria 1774
401 Ga0496101_0342591 3300048904 Bacteria 1174
402 Ga0496101_0407671 3300048904 Bacteria 1071
403 Ga0496102_0184579 3300048905 Bacteria 1965
404 Ga0496102_0773799 3300048905 Bacteria 882
405 Ga0496103_0008107 3300048906 Bacteria 6239
406 Ga0496103_0012020 3300048906 Bacteria 5142
407 Ga0496103_0025543 3300048906 Bacteria 3571
408 Ga0496104_0009591 3300048907 Bacteria 8618
409 Ga0496104_0016998 3300048907 Bacteria 6618
410 Ga0496104_0038406 3300048907 Bacteria 4480
411 Ga0496105_0005632 3300048908 Bacteria 9529
412 Ga0496105_0033270 3300048908 Bacteria 4232
413 Ga0496105_0235987 3300048908 Bacteria 1485
414 Ga0496106_0260193 3300048909 Bacteria 1388
415 Ga0496107_0037177 3300048910 Bacteria 3493
416 Ga0496107_0042683 3300048910 Bacteria 3257
417 Ga0496107_0101295 3300048910 Bacteria 2112
418 Ga0496108_0037313 3300048911 Bacteria 4047
419 Ga0496108_0109714 3300048911 Bacteria 2358
420 Ga0496109_0038439 3300048912 Bacteria 4326
421 Ga0496109_0135735 3300048912 Bacteria 2298
422 Ga0496109_0264062 3300048912 Bacteria 1622
423 Ga0496109_0578872 3300048912 Bacteria 1058
424 Ga0496110_0016423 3300048913 Bacteria 6181
425 Ga0496110_0022350 3300048913 Bacteria 5369
426 Ga0496110_0038293 3300048913 Bacteria 4172
427 Ga0496110_0313894 3300048913 Bacteria 1427
428 Ga0496110_0491805 3300048913 Bacteria 1117
429 Ga0496111_0006194 3300048914 Bacteria 7748
430 Ga0496111_0012124 3300048914 Bacteria 5830
431 Ga0496111_0107858 3300048914 Bacteria 2050
432 Ga0496111_0116131 3300048914 Bacteria 1974
433 Ga0496111_0475545 3300048914 Bacteria 921
434 Ga0496112_0136264 3300048915 Bacteria 2425
435 Ga0496112_0209796 3300048915 Bacteria 1905
436 Ga0496112_0617560 3300048915 Bacteria 1015
437 Ga0496112_0800568 3300048915 Bacteria 867
438 Ga0496113_0037039 3300048916 Bacteria 3577
439 Ga0496113_0107644 3300048916 Bacteria 2166
440 Ga0496114_0005683 3300048917 Bacteria 9782
441 Ga0496114_0006536 3300048917 Bacteria 9186
442 Ga0496114_0007040 3300048917 Bacteria 8875
443 Ga0496114_0081575 3300048917 Bacteria 2732
444 Ga0496114_0153064 3300048917 Bacteria 2001
445 Ga0496114_0397863 3300048917 Bacteria 1220
446 Ga0496115_0042771 3300048918 Bacteria 3610
447 Ga0496115_0148791 3300048918 Bacteria 1933
448 Ga0501031_0000628 3300049568 Bacteria 20865
449 Ga0501031_0092647 3300049568 Bacteria 1972
450 Ga0501033_0198911 3300049570 Bacteria 1432
451 Ga0501036_0004868 3300049572 Bacteria 10847
452 Ga0501036_0288707 3300049572 Bacteria 1373
453 Ga0501037_0071709 3300049573 Bacteria 2520
454 Ga0501038_0061656 3300049574 Bacteria 3207
455 Ga0501038_0423489 3300049574 Bacteria 1027
456 Ga0501039_0001256 3300049575 Bacteria 18532
457 Ga0501040_0001265 3300049576 Bacteria 16070
458 Ga0501043_0425686 3300049579 Bacteria 1000
459 Ga0501046_0041599 3300049580 Bacteria 3666
460 Ga0501048_0030521 3300049582 Bacteria 3900
461 Ga0501048_0339329 3300049582 Bacteria 1071
462 Ga0501067_0001642 3300049583 Bacteria 12275
463 Ga0501067_0033923 3300049583 Bacteria 2832
464 Ga0501067_0036545 3300049583 Bacteria 2727
465 Ga0501067_0124559 3300049583 Bacteria 1434
466 Ga0501067_0165545 3300049583 Bacteria 1231
467 Ga0501067_0191807 3300049583 Bacteria 1138
468 Ga0501068_0019882 3300049584 Bacteria 3906
469 Ga0501068_0092597 3300049584 Bacteria 1866
470 Ga0501069_0002855 3300049585 Bacteria 8850
471 Ga0501069_0003207 3300049585 Bacteria 8379
472 Ga0501069_0201873 3300049585 Bacteria 1152
473 Ga0501069_0330566 3300049585 Bacteria 896
474 Ga0501071_0000047 3300049587 Bacteria 42225
475 Ga0501071_0090444 3300049587 Bacteria 2247
476 Ga0501072_0001186 3300049588 Bacteria 19416
477 Ga0501072_0006186 3300049588 Bacteria 9117
478 Ga0501072_0752983 3300049588 Bacteria 764
479 Ga0501074_0232927 3300049590 Bacteria 1311
480 Ga0501075_0000079 3300049591 Bacteria 43500
481 Ga0501075_0010991 3300049591 Bacteria 6387
482 Ga0501075_0320976 3300049591 Bacteria 1180
483 Ga0501076_0001595 3300049592 Bacteria 15258
484 Ga0501076_0016881 3300049592 Bacteria 5543
485 Ga0501077_0002196 3300049593 Bacteria 11782
486 Ga0501077_0004352 3300049593 Bacteria 8588
487 Ga0501079_0001611 3300049741 Bacteria 16086
488 Ga0501079_0021548 3300049741 Bacteria 4929
489 Ga0501080_0322500 3300049742 Bacteria 1398
490 Ga0501081_0009125 3300049743 Bacteria 6454
491 Ga0501081_0092207 3300049743 Bacteria 2131
492 Ga0501083_0440747 3300049744 Bacteria 847
493 Ga0501035_0030535 3300049822 Bacteria 4911
494 Ga0501045_0002089 3300049824 Bacteria 13496
495 Ga0501045_0004518 3300049824 Bacteria 9614
496 Ga0501045_0242397 3300049824 Bacteria 1342
497 nmdc:mga0yw44_195912_c1 3300050492 Bacteria 1333
498 nmdc:mga05p37_117254_c1 3300050507 Bacteria 3272
499 nmdc:mga05p37_130256_c1 3300050507 Bacteria 3086
500 nmdc:mga05p37_141950_c1 3300050507 Bacteria 2942
501 nmdc:mga05p37_158289_c1 3300050507 Bacteria 2767
502 nmdc:mga05p37_194812_c1 3300050507 Bacteria 2458
503 nmdc:mga05p37_311994_c1 3300050507 Bacteria 1864
504 nmdc:mga05p37_452887_c1 3300050507 Bacteria 1485
505 nmdc:mga05p37_5959_c1 3300050507 Bacteria 14344
506 nmdc:mga05p37_98114_c1 3300050507 Bacteria 3609
507 nmdc:mga09592_46135_c1 3300050508 Bacteria 3671
508 nmdc:mga0qj67_123189_c1 3300050509 Bacteria 2097
509 nmdc:mga08y16_24200_c1 3300050511 Bacteria 6410
510 nmdc:mga08y16_276338_c1 3300050511 Bacteria 1733
511 nmdc:mga08y16_455646_c1 3300050511 Bacteria 1304
512 nmdc:mga08y16_799786_c1 3300050511 Bacteria 936
513 nmdc:mga08y16_87236_c1 3300050511 Bacteria 3251
514 nmdc:mga0n895_239998_c1 3300050512 Bacteria 1839
515 nmdc:mga0n895_354669_c1 3300050512 Bacteria 1486
516 nmdc:mga0n895_83782_c1 3300050512 Bacteria 3181
517 nmdc:mga0n895_8849_c1 3300050512 Bacteria 8763
518 nmdc:mga0rr50_1433_c1 3300050513 Bacteria 13116
519 nmdc:mga0rr50_67186_c1 3300050513 Bacteria 2723
520 nmdc:mga08x19_106552_c1 3300050514 Bacteria 1865
521 nmdc:mga08x19_14717_c1 3300050514 Bacteria 4751
522 nmdc:mga08x19_160834_c1 3300050514 Bacteria 1525
523 nmdc:mga08x19_5498_c1 3300050514 Bacteria 7495
524 nmdc:mga0a205_107017_c1 3300050515 Bacteria 2694
525 nmdc:mga0a205_23983_c1 3300050515 Bacteria 5792
526 Ga0501084_0000362 3300054114 Bacteria 34708
527 Ga0501084_0008926 3300054114 Bacteria 8295
528 Ga0501084_0283831 3300054114 Bacteria 1398
529 Ga0590075_012245 3300059424 Bacteria 2082
530 Ga0590077_005061 3300059426 Bacteria 2694
531 Ga0587094_016781 3300059513 Bacteria 1023
532 Ga0587079_019692 3300059647 Bacteria 1197
533 Ga0501082_0002526 3300060353 Bacteria 16018
534 Ga0501082_0070007 3300060353 Bacteria 3021
535 Ga0466962_0064676 3300061719 Bacteria 1746
536 Ga0530510_0005226 3300061734 Bacteria 8964
537 Ga0530510_0025546 3300061734 Bacteria 4224
538 Ga0530510_0056204 3300061734 Bacteria 2843
539 Ga0530510_0183343 3300061734 Bacteria 1553
540 Ga0070684_100072899
541 ARcpr5oldR_c001330
542 JGI24739J22299_10028344
543 JGI24738J21930_10001969
544 Ga0070658_10010221
545 Ga0070676_10510577
546 Ga0070683_100013548
547 Ga0070683_100038253
548 Ga0070683_100047892
549 Ga0070670_100014981
550 Ga0070670_100113397
551 Ga0068869_100023258
552 Ga0070680_100055467
553 Ga0070680_100083491
554 Ga0070680_100100074
555 Ga0070682_100034907
556 Ga0070682_100114685
557 Ga0068868_100050793
558 Ga0070660_100021968
559 Ga0070660_100074778
560 Ga0070691_10006978
561 Ga0070687_100029966
562 Ga0070661_100022629
563 Ga0070661_100038788
564 Ga0070692_10002758
565 Ga0070692_10021388
566 Ga0070692_10032403
567 Ga0070668_100134097
568 Ga0070669_100106964
569 Ga0070675_100029021
570 Ga0070675_100044171
571 Ga0070675_100052249
572 Ga0070675_100472624
573 Ga0070671_100193793
574 Ga0070674_100014596
575 Ga0070674_100060606
576 Ga0070674_100069071
577 Ga0070674_100247130
578 Ga0070673_100014828
579 Ga0070673_100035914
580 Ga0070673_100225557
581 Ga0070688_100002575
582 Ga0070659_100053627
583 Ga0070659_100063252
584 Ga0070659_100115830
585 Ga0070703_10001002
586 Ga0070703_10006026
587 Ga0070709_10458465
588 Ga0070714_100034642
589 Ga0070714_100075132
590 Ga0070714_100352509
591 Ga0070713_100077361
592 Ga0070701_10010706
593 Ga0070701_10077570
594 Ga0070705_100029541
595 Ga0070700_100038585
596 Ga0070700_100232535
597 Ga0070700_100263273
598 Ga0070700_100330009
599 Ga0070708_100441917
600 Ga0070708_100564905
601 Ga0070663_100026864
602 Ga0070663_100028658
603 Ga0070663_100047859
604 Ga0070678_100017605
605 Ga0070678_100035787
606 Ga0070662_100024647
607 Ga0070662_100029960
608 Ga0070681_10027977
609 Ga0070681_10062935
610 Ga0070681_10161534
611 Ga0068867_100040283
612 Ga0068867_100381002
613 Ga0070685_10024662
614 Ga0070685_10196486
615 Ga0070706_100144577
616 Ga0070707_100341752
617 Ga0070698_100034248
618 Ga0070698_100100228
619 Ga0070698_100359524
620 Ga0070698_100402669
621 Ga0070699_100402933
622 Ga0070679_100074448
623 Ga0070679_100079670
624 Ga0070679_100094594
625 Ga0070684_100002723
626 Ga0070684_100063938
627 Ga0070697_100033789
628 Ga0070697_100333410
629 Ga0068853_100018869
630 Ga0070672_100014741
631 Ga0070672_100028755
632 Ga0070686_100019434
633 Ga0070686_100155206
634 Ga0070696_100065742
635 Ga0070696_100200723
636 Ga0070693_100007439
637 Ga0070693_100017238
638 Ga0070693_100025144
639 Ga0070693_100123691
640 Ga0070665_100025531
641 Ga0070704_100026299
642 Ga0070704_100046800
643 Ga0068855_100024261
644 Ga0070664_100017988
645 Ga0070664_100083222
646 Ga0070664_100118439
647 Ga0070664_100317687
648 Ga0070664_100577946
649 Ga0068857_100171448
650 Ga0068854_100067513
651 Ga0068854_100172997
652 Ga0068856_100630546
653 Ga0068856_100742379
654 Ga0070702_100014589
655 Ga0070702_100056198
656 Ga0068852_100047759
657 Ga0068852_100084142
658 Ga0068859_100015815
659 Ga0068864_100011033
660 Ga0068866_10004415
661 Ga0068866_10128482
662 Ga0068861_100011331
663 Ga0068851_10034690
664 Ga0068851_10091396
665 Ga0068870_10003881
666 Ga0068863_100025518
667 Ga0068858_100007230
668 Ga0068860_100044354
669 Ga0068862_100334824
670 Ga0068862_100415054
671 Ga0081455_10052369
672 Ga0081539_10007031
673 Ga0075365_10265097
674 Ga0075364_10287099
675 Ga0075432_10009009
676 Ga0070715_10027424
677 Ga0070712_100048488
678 Ga0097621_100109550
679 Ga0097621_100503927
680 Ga0097621_100579363
681 Ga0068871_100032961
682 Ga0068871_100036664
683 Ga0075428_100166052
684 Ga0075428_100217144
685 Ga0075433_10002708
686 Ga0075433_10117631
687 Ga0075433_10195823
688 Ga0075434_100007653
689 Ga0075434_100128714
690 Ga0075434_100394203
691 Ga0075434_100531109
692 Ga0075429_100069232
693 Ga0075429_100202020
694 Ga0068865_100002899
695 Ga0068865_100005561
696 Ga0068865_100040088
697 Ga0068865_100334094
698 Ga0068865_100417079
699 Ga0075436_100002088
700 Ga0075436_100005923
701 Ga0075436_100066001
702 Ga0097620_100015816
703 Ga0075435_100001155
704 Ga0075435_100287069
705 Ga0105244_10203898
706 Ga0111539_10085491
707 Ga0111539_10109761
708 Ga0111539_10166868
709 Ga0111539_10878484
710 Ga0105245_10024531
711 Ga0105245_10102128
712 Ga0105245_10276814
713 Ga0105245_10501099
714 Ga0105247_10055011
715 Ga0114129_10000910
716 Ga0114129_10021045
717 Ga0114129_10024232
718 Ga0114129_10038125
719 Ga0114129_10084055
720 Ga0114129_10124287
721 Ga0114129_10128269
722 Ga0114129_10137513
723 Ga0114129_10190508
724 Ga0114129_10410750
725 Ga0114129_10569024
726 Ga0105243_10007846
727 Ga0105243_10131551
728 Ga0105243_10132298
729 Ga0105243_10195827
730 Ga0105241_10010013
731 Ga0105241_10226870
732 Ga0105242_10014191
733 Ga0105242_10064775
734 Ga0105248_10050536
735 Ga0105248_10120982
736 Ga0105248_10208365
737 Ga0105248_10334828
738 Ga0105237_10140717
739 Ga0105238_10097792
740 Ga0105249_10038292
741 Ga0105249_10590487
742 Ga0105239_10051255
743 Ga0105239_10107500
744 Ga0105239_10350208
745 Ga0105246_10009623
746 Ga0105246_10063890
747 Ga0105246_10117656
748 Ga0157371_10008275
749 Ga0157371_10113965
750 Ga0157374_10062109
751 Ga0157378_10275842
752 Ga0163162_10075023
753 Ga0157372_10049545
754 Ga0157372_10457690
755 Ga0157375_10127882
756 Ga0157375_10155109
757 Ga0163163_10040787
758 Ga0163163_10089769
759 Ga0182008_10000959
760 Ga0157377_10007828
761 Ga0157377_10019402
762 Ga0157377_10151498
763 Ga0157377_10273407
764 Ga0157379_10038870
765 Ga0157376_10283646
766 Ga0182007_10009496
767 Ga0207653_10000439
768 Ga0207653_10010509
769 Ga0207710_10006471
770 Ga0207688_10034125
771 Ga0207699_10256310
772 Ga0207643_10004645
773 Ga0207643_10038584
774 Ga0207643_10040639
775 Ga0207684_10104157
776 Ga0207654_10055724
777 Ga0207707_10026094
778 Ga0207707_10149470
779 Ga0207693_10006690
780 Ga0207663_10012162
781 Ga0207660_10031697
782 Ga0207660_10052303
783 Ga0207660_10108962
784 Ga0207660_10367074
785 Ga0207662_10028376
786 Ga0207662_10031143
787 Ga0207657_10036723
788 Ga0207657_10044449
789 Ga0207649_10057120
790 Ga0207652_10045759
791 Ga0207652_10064936
792 Ga0207646_10302531
793 Ga0207681_10076128
794 Ga0207694_10071318
795 Ga0207694_10084473
796 Ga0207650_10010855
797 Ga0207659_10016197
798 Ga0207659_10028607
799 Ga0207659_10037634
800 Ga0207659_10195442
801 Ga0207687_10001388
802 Ga0207687_10006518
803 Ga0207687_10026562
804 Ga0207687_10029361
805 Ga0207687_10214443
806 Ga0207690_10016334
807 Ga0207690_10042477
808 Ga0207690_10050981
809 Ga0207706_10021103
810 Ga0207706_10263511
811 Ga0207686_10032395
812 Ga0207686_10041367
813 Ga0207686_10131437
814 Ga0207709_10007895
815 Ga0207709_10021206
816 Ga0207709_10078348
817 Ga0207709_10244905
818 Ga0207669_10030622
819 Ga0207669_10043171
820 Ga0207704_10008867
821 Ga0207704_10030544
822 Ga0207704_10043703
823 Ga0207704_10122525
824 Ga0207665_10250458
825 Ga0207691_10007140
826 Ga0207691_10023030
827 Ga0207691_10217485
828 Ga0207711_10261500
829 Ga0207689_10033988
830 Ga0207661_10025611
831 Ga0207661_10034840
832 Ga0207661_10165820
833 Ga0207679_10041824
834 Ga0207679_10290459
835 Ga0207679_10291246
836 Ga0207679_10293046
837 Ga0207667_10110384
838 Ga0207651_10008423
839 Ga0207651_10049891
840 Ga0207712_10070831
841 Ga0207712_10175644
842 Ga0207712_10650189
843 Ga0207668_10073074
844 Ga0207640_10032916
845 Ga0207677_10032409
846 Ga0207703_10034360
847 Ga0207639_10028970
848 Ga0207639_10034916
849 Ga0207639_10087157
850 Ga0207639_10405144
851 Ga0207678_10031025
852 Ga0207678_10040661
853 Ga0207678_10048161
854 Ga0207678_10199837
855 Ga0207708_10062626
856 Ga0207708_10422104
857 Ga0207702_10027615
858 Ga0207641_10008963
859 Ga0207648_10009519
860 Ga0207648_10116232
861 Ga0207648_10314311
862 Ga0207676_10007259
863 Ga0207675_100021620
864 Ga0207675_100245975
865 Ga0207683_10031436
866 Ga0207683_10341644
867 Ga0207698_10040116
868 Ga0207698_10106839
869 Ga0207428_10032727
870 Ga0207428_10048584
871 Ga0207428_10050938
872 Ga0207428_10362278
873 Ga0268265_10225807
874 Ga0373928_0015238
875 Ga0373932_0000816
876 Ga0373939_0126580
877 Ga0373941_0205649
878 Ga0373942_0068535
879 Ga0373961_0008215
880 Ga0373961_0009743
881 Ga0373961_0117071
882 Ga0373931_0002516
883 Ga0395899_0037380
884 Ga0395899_0088988
885 Ga0395899_0153653
886 Ga0395899_0299357
887 Ga0395900_0000672
888 Ga0395900_0023688
889 Ga0395900_0062397
890 Ga0395900_0126645
891 Ga0395900_0215714
892 Ga0395900_0436979
893 Ga0395898_0017705
894 Ga0395898_0042644
895 Ga0395898_0145794
896 Ga0395898_0163727
897 Ga0395898_0179152
898 Ga0395905_0065953
899 Ga0395905_0085118
900 Ga0395905_0085678
901 Ga0395905_0181392
902 Ga0395905_0195141
903 Ga0395905_0198566
904 Ga0395905_0425630
905 Ga0395901_0009214
906 Ga0395901_0011712
907 Ga0395901_0013130
908 Ga0395901_0029437
909 Ga0395901_0039688
910 Ga0395901_0201334
911 Ga0395901_0513602
912 Ga0450918_024187
913 Ga0466965_0174534
914 Ga0466963_0014940
915 Ga0466963_0044124
916 Ga0466957_0138262
917 Ga0466958_0009247
918 Ga0466958_0201203
919 Ga0495603_0089794
920 Ga0495603_0232976
921 Ga0495582_0070950
922 Ga0495582_0107144
923 Ga0495662_0184613
924 Ga0495664_0364342
925 Ga0495630_0415795
926 Ga0495587_0070661
927 Ga0495656_0226365
928 Ga0495634_0079808
929 Ga0495599_0084355
930 Ga0495647_0080468
931 Ga0495658_0026891
932 Ga0495676_0059402
933 Ga0495602_0073552
934 Ga0496100_0013108
935 Ga0496100_0022888
936 Ga0496100_0044100
937 Ga0496101_0045574
938 Ga0496101_0122660
939 Ga0496101_0151496
940 Ga0496101_0342591
941 Ga0496101_0407671
942 Ga0496102_0184579
943 Ga0496102_0773799
944 Ga0496103_0008107
945 Ga0496103_0012020
946 Ga0496103_0025543
947 Ga0496104_0009591
948 Ga0496104_0016998
949 Ga0496104_0038406
950 Ga0496105_0005632
951 Ga0496105_0033270
952 Ga0496105_0235987
953 Ga0496106_0260193
954 Ga0496107_0037177
955 Ga0496107_0042683
956 Ga0496107_0101295
957 Ga0496108_0037313
958 Ga0496108_0109714
959 Ga0496109_0038439
960 Ga0496109_0135735
961 Ga0496109_0264062
962 Ga0496109_0578872
963 Ga0496110_0016423
964 Ga0496110_0022350
965 Ga0496110_0038293
966 Ga0496110_0313894
967 Ga0496110_0491805
968 Ga0496111_0006194
969 Ga0496111_0012124
970 Ga0496111_0107858
971 Ga0496111_0116131
972 Ga0496111_0475545
973 Ga0496112_0136264
974 Ga0496112_0209796
975 Ga0496112_0617560
976 Ga0496112_0800568
977 Ga0496113_0037039
978 Ga0496113_0107644
979 Ga0496114_0005683
980 Ga0496114_0006536
981 Ga0496114_0007040
982 Ga0496114_0081575
983 Ga0496114_0153064
984 Ga0496114_0397863
985 Ga0496115_0042771
986 Ga0496115_0148791
987 Ga0501031_0000628
988 Ga0501031_0092647
989 Ga0501033_0198911
990 Ga0501036_0004868
991 Ga0501036_0288707
992 Ga0501037_0071709
993 Ga0501038_0061656
994 Ga0501038_0423489
995 Ga0501039_0001256
996 Ga0501040_0001265
997 Ga0501043_0425686
998 Ga0501046_0041599
999 Ga0501048_0030521
1000 Ga0501048_0339329
1001 Ga0501067_0001642
1002 Ga0501067_0033923
1003 Ga0501067_0036545
1004 Ga0501067_0124559
1005 Ga0501067_0165545
1006 Ga0501067_0191807
1007 Ga0501068_0019882
1008 Ga0501068_0092597
1009 Ga0501069_0002855
1010 Ga0501069_0003207
1011 Ga0501069_0201873
1012 Ga0501069_0330566
1013 Ga0501071_0000047
1014 Ga0501071_0090444
1015 Ga0501072_0001186
1016 Ga0501072_0006186
1017 Ga0501072_0752983
1018 Ga0501074_0232927
1019 Ga0501075_0000079
1020 Ga0501075_0010991
1021 Ga0501075_0320976
1022 Ga0501076_0001595
1023 Ga0501076_0016881
1024 Ga0501077_0002196
1025 Ga0501077_0004352
1026 Ga0501079_0001611
1027 Ga0501079_0021548
1028 Ga0501080_0322500
1029 Ga0501081_0009125
1030 Ga0501081_0092207
1031 Ga0501083_0440747
1032 Ga0501035_0030535
1033 Ga0501045_0002089
1034 Ga0501045_0004518
1035 Ga0501045_0242397
1036 nmdc:mga0yw44_195912_c1
1037 nmdc:mga05p37_117254_c1
1038 nmdc:mga05p37_130256_c1
1039 nmdc:mga05p37_141950_c1
1040 nmdc:mga05p37_158289_c1
1041 nmdc:mga05p37_194812_c1
1042 nmdc:mga05p37_311994_c1
1043 nmdc:mga05p37_452887_c1
1044 nmdc:mga05p37_5959_c1
1045 nmdc:mga05p37_98114_c1
1046 nmdc:mga09592_46135_c1
1047 nmdc:mga0qj67_123189_c1
1048 nmdc:mga08y16_24200_c1
1049 nmdc:mga08y16_276338_c1
1050 nmdc:mga08y16_455646_c1
1051 nmdc:mga08y16_799786_c1
1052 nmdc:mga08y16_87236_c1
1053 nmdc:mga0n895_239998_c1
1054 nmdc:mga0n895_354669_c1
1055 nmdc:mga0n895_83782_c1
1056 nmdc:mga0n895_8849_c1
1057 nmdc:mga0rr50_1433_c1
1058 nmdc:mga0rr50_67186_c1
1059 nmdc:mga08x19_106552_c1
1060 nmdc:mga08x19_14717_c1
1061 nmdc:mga08x19_160834_c1
1062 nmdc:mga08x19_5498_c1
1063 nmdc:mga0a205_107017_c1
1064 nmdc:mga0a205_23983_c1
1065 Ga0501084_0000362
1066 Ga0501084_0008926
1067 Ga0501084_0283831
1068 Ga0590075_012245
1069 Ga0590077_005061
1070 Ga0587094_016781
1071 Ga0587079_019692
1072 Ga0501082_0002526
1073 Ga0501082_0070007
1074 Ga0466962_0064676
1075 Ga0530510_0005226
1076 Ga0530510_0025546
1077 Ga0530510_0056204
1078 Ga0530510_0183343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

38

190

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.891 7 229
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8878 7 229
2awn-assembly1.cif.gz_A crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8085 7 229
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.7735 4 228
6ha8-assembly1.cif.gz_V cryo-em structure of the abcf protein vmlr bound to the bacillus subtilis ribosome 0.7673 4 227
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8907 7 226 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8867 5 70 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8733 7 226 3.40.50.300
af_A0A0P0XZV4_2_138_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.82 145 240 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8076 2 80 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A838H0G4-F1-model_v4 Heme ABC transporter ATP-binding protein 0.8305 151 259 GO:0005524
AF-A4AIX1-F1-model_v4 ABC sugar transporter, ATPase subunit 0.8127 1 242 GO:0005524
GO:0016887
AF-A0A540W282-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.8109 2 242 GO:0005524
GO:0016887
AF-A0A2T0UCU5-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.8102 7 242 GO:0005524
GO:0016887
AF-A0A2M8BJG8-F1-model_v4 ABC transporter domain-containing protein 0.8092 2 244 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Map