F461051

General Info

Members Datasets Scaffolds Average Seq Length
538 198 513 126

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0204796|Ga0495610_0204796_104_529
Length 141
Sequence MSSSVSSIVNKQALVLFAHGARAASWAAPFERLRDLTQARMPDVPVSLAFLELMEPRLPEQVAALTADGVTHITVVPVFLGQGGHVLRDLPLMVDQLRIDYPQTTINVVEAAGENAAVLNALSDYCVSSLAAPPSTSSAPA

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2738541297 Duganella sp. GV083 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738541357 Duganella sp. GV053 Isolate Unclassified
10 2738543003 Duganella sp. GV066 Isolate Unclassified
11 2738543018 Massilia sp. GV045 Isolate Unclassified
12 2738543026 Duganella sp. GV089 Isolate Unclassified
13 2738543029 Duganella sp. GV039 Isolate Unclassified
14 2738543030 Massilia sp. GV097 Isolate Unclassified
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2857564685 Duganella sp. R-74599 Isolate Unclassified
21 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
22 2904424332 Duganella sp. 1411 Isolate Rhizosphere
23 2919476304 Duganella sp. 3397 Isolate Unclassified
24 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
25 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
26 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
27 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
100 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
189 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
190 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
191 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
197 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
198 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.8
Metatranscriptomes 0.56
Isolates 4.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.33
Nodule 0.74
Rhizoplane 5.58
Rhizosphere 64.68
Stem 0
Stem Tuber 0
Unclassified 9.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000304 3300002738 Bacteria 29042
2 JGI25158J39367_1000592 3300002739 Bacteria 7207
3 JGI25158J39367_1001545 3300002739 Bacteria 3997
4 JGI25152J39213_1000193 3300002773 Bacteria 41047
5 JGI25150J39212_1000878 3300002774 Bacteria 9898
6 JGI25150J39212_1000921 3300002774 Bacteria 9543
7 JGI25150J39212_1040638 3300002774 Bacteria 602
8 JGI25159J45721_1001446 3300002987 Bacteria 9809
9 JGI25159J45721_1026431 3300002987 Bacteria 1000
10 JGI25159J45721_1026435 3300002987 Bacteria 1000
11 JGI25153J46596_10003821 3300003215 Bacteria 8304
12 rootL2_10083590 3300003322 Bacteria 2900
13 rootL2_10083591 3300003322 Bacteria 7073
14 JGI25160J50197_1033484 3300003354 Bacteria 1291
15 JGI25160J50197_1044591 3300003354 Bacteria 988
16 JGI25161J50226_1001625 3300003374 Bacteria 6517
17 JGI25161J50226_1012704 3300003374 Bacteria 1000
18 JGI25161J50226_1012706 3300003374 Bacteria 1000
19 Ga0055529_1000342 3300003763 Bacteria 52150
20 Ga0055526_1000010 3300003771 Bacteria 241512
21 Ga0055526_1000060 3300003771 Bacteria 106424
22 Ga0055526_1007207 3300003771 Bacteria 5839
23 Ga0055537_1000592 3300003773 Bacteria 20163
24 Ga0055537_1020001 3300003773 Bacteria 1026
25 Ga0055537_1025439 3300003773 Bacteria 818
26 Ga0055524_1000025 3300003775 Bacteria 216427
27 Ga0055524_1000643 3300003775 Bacteria 24836
28 Ga0055524_1009571 3300003775 Bacteria 3926
29 Ga0055524_1010820 3300003775 Bacteria 3608
30 Ga0055524_1054369 3300003775 Bacteria 878
31 Ga0055524_1059183 3300003775 Bacteria 806
32 Ga0055524_1060596 3300003775 Bacteria 787
33 Ga0055534_1000428 3300003784 Bacteria 25148
34 Ga0055534_1006171 3300003784 Bacteria 3068
35 Ga0055534_1031171 3300003784 Bacteria 820
36 Ga0055528_1000298 3300003790 Bacteria 42146
37 Ga0055530_10003841 3300003791 Bacteria 8240
38 Ga0055530_10006135 3300003791 Bacteria 5459
39 Ga0055530_10009401 3300003791 Bacteria 3762
40 Ga0055531_10000957 3300003794 Bacteria 23173
41 Ga0055531_10039092 3300003794 Bacteria 1414
42 Ga0055543_1000252 3300004625 Bacteria 40605
43 Ga0055543_1010417 3300004625 Bacteria 1950
44 Ga0055543_1026155 3300004625 Bacteria 1038
45 Ga0065165_1000438 3300005262 Bacteria 65397
46 Ga0065165_1006099 3300005262 Bacteria 6458
47 Ga0065165_1048162 3300005262 Bacteria 1226
48 Ga0065165_1060579 3300005262 Bacteria 1038
49 Ga0065714_10101263 3300005288 Bacteria 1647
50 Ga0068867_101280412 3300005459 Bacteria 676
51 Ga0070717_10466705 3300006028 Bacteria 1139
52 Ga0079104_1051186 3300006946 Bacteria 919
53 Ga0099826_10000005 3300006948 Bacteria 465206
54 Ga0105244_10000745 3300009036 Bacteria 27842
55 Ga0105244_10002851 3300009036 Bacteria 12825
56 Ga0105244_10138061 3300009036 Bacteria 1174
57 Ga0105243_12198368 3300009148 Bacteria 588
58 Ga0105243_12667589 3300009148 Bacteria 540
59 Ga0163162_11012964 3300013306 Unclassified 939
60 Ga0182008_10000724 3300014497 Bacteria 23482
61 Ga0182006_1000004 3300015261 Bacteria 622190
62 Ga0182006_1000290 3300015261 Bacteria 44220
63 Ga0182007_10000017 3300015262 Bacteria 199097
64 Ga0182007_10092361 3300015262 Bacteria 997
65 Ga0182005_1000005 3300015265 Bacteria 537378
66 Ga0182005_1000030 3300015265 Bacteria 213092
67 Ga0163161_10046467 3300017792 Bacteria 3132
68 Ga0163161_10138739 3300017792 Bacteria 1840
69 Ga0213872_10000283 3300021361 Bacteria 43308
70 Ga0213872_10000448 3300021361 Bacteria 33688
71 Ga0213872_10007921 3300021361 Bacteria 5183
72 Ga0213872_10010803 3300021361 Bacteria 4333
73 Ga0209436_100676 3300025208 Bacteria 14517
74 Ga0209436_121355 3300025208 Bacteria 854
75 Ga0209436_121356 3300025208 Bacteria 854
76 Ga0209437_103987 3300025233 Bacteria 2623
77 Ga0207425_1000017 3300025245 Bacteria 423851
78 Ga0207425_1000207 3300025245 Bacteria 46813
79 Ga0207425_1001019 3300025245 Bacteria 13102
80 Ga0207425_1010170 3300025245 Bacteria 2302
81 Ga0209646_1000036 3300025246 Bacteria 358864
82 Ga0209026_1002599 3300025250 Bacteria 6623
83 Ga0209129_1000039 3300025258 Bacteria 322444
84 Ga0209129_1000911 3300025258 Bacteria 18095
85 Ga0209565_1000068 3300025263 Bacteria 171201
86 Ga0209565_1001439 3300025263 Bacteria 10522
87 Ga0209565_1002891 3300025263 Bacteria 5886
88 Ga0209565_1004732 3300025263 Bacteria 4084
89 Ga0209565_1005049 3300025263 Bacteria 3898
90 Ga0209565_1016203 3300025263 Bacteria 1663
91 Ga0209565_1016900 3300025263 Bacteria 1611
92 Ga0209565_1038859 3300025263 Bacteria 894
93 Ga0209455_1000047 3300025272 Bacteria 379709
94 Ga0209673_1000119 3300025273 Bacteria 171203
95 Ga0209673_1059082 3300025273 Bacteria 967
96 Ga0209130_1000057 3300025284 Bacteria 210593
97 Ga0209130_1000491 3300025284 Bacteria 40619
98 Ga0209130_1032943 3300025284 Bacteria 1052
99 Ga0209130_1032961 3300025284 Bacteria 1052
100 Ga0209675_1000068 3300025291 Bacteria 171202
101 Ga0209675_1001374 3300025291 Bacteria 14247
102 Ga0209675_1012028 3300025291 Bacteria 2818
103 Ga0209675_1039098 3300025291 Bacteria 1052
104 Ga0209675_1094506 3300025291 Bacteria 535
105 Ga0209025_1002795 3300025294 Bacteria 17583
106 Ga0209564_1000060 3300025295 Bacteria 325890
107 Ga0209564_1000141 3300025295 Bacteria 179852
108 Ga0209564_1000149 3300025295 Bacteria 170958
109 Ga0209564_1002252 3300025295 Bacteria 15819
110 Ga0209564_1048881 3300025295 Bacteria 1052
111 Ga0209758_1000192 3300025297 Bacteria 136933
112 Ga0209758_1001203 3300025297 Bacteria 32670
113 Ga0209050_1000762 3300025298 Bacteria 46324
114 Ga0209050_1001013 3300025298 Bacteria 35068
115 Ga0209050_1004491 3300025298 Bacteria 9392
116 Ga0209256_1000040 3300025299 Bacteria 366839
117 Ga0209256_1000651 3300025299 Bacteria 47267
118 Ga0209256_1000744 3300025299 Bacteria 42676
119 Ga0209256_1001036 3300025299 Bacteria 32591
120 Ga0209256_1003328 3300025299 Bacteria 11401
121 Ga0207426_1002755 3300025302 Bacteria 10630
122 Ga0207426_1018898 3300025302 Bacteria 2420
123 Ga0207426_1024519 3300025302 Bacteria 2045
124 Ga0209257_1000501 3300025304 Bacteria 69426
125 Ga0209257_1012545 3300025304 Bacteria 3899
126 Ga0207655_1006610 3300025728 Bacteria 7647
127 Ga0207655_1029944 3300025728 Bacteria 2539
128 Ga0207655_1112292 3300025728 Bacteria 918
129 Ga0209281_1039709 3300027111 Bacteria 798
130 Ga0209282_1000003 3300027666 Bacteria 856377
131 Ga0268265_10980234 3300028380 Bacteria 834
132 Ga0307515_10476283 3300028794 Bacteria 861
133 Ga0316182_1408478 3300030745 Bacteria 692
134 Ga0307408_100000709 3300031548 Bacteria 27106
135 Ga0307408_100000740 3300031548 Bacteria 26386
136 Ga0307408_100005211 3300031548 Bacteria 8714
137 Ga0307408_100010861 3300031548 Bacteria 6009
138 Ga0307408_100200611 3300031548 Bacteria 1614
139 Ga0265314_10040426 3300031711 Bacteria 3347
140 Ga0307518_10087050 3300031838 Bacteria 2251
141 Ga0307412_10259812 3300031911 Bacteria 1353
142 Ga0307416_100004538 3300032002 Bacteria 8385
143 Ga0307416_100424559 3300032002 Bacteria 1375
144 Ga0307414_10068237 3300032004 Bacteria 2551
145 Ga0307411_10780488 3300032005 Bacteria 840
146 Ga0373939_0039168 3300035114 Bacteria 1417
147 Ga0395899_0013296 3300037312 Bacteria 6297
148 Ga0395900_0279055 3300037418 Bacteria 1663
149 Ga0395900_0749902 3300037418 Bacteria 906
150 Ga0395900_0762171 3300037418 Bacteria 897
151 Ga0395898_0629296 3300037466 Bacteria 1015
152 Ga0395905_0522720 3300037471 Bacteria 1087
153 Ga0395905_0699236 3300037471 Bacteria 916
154 Ga0395905_0872202 3300037471 Bacteria 803
155 Ga0395901_0060703 3300038443 Bacteria 3934
156 Ga0395901_0087933 3300038443 Bacteria 3249
157 Ga0436361_0296853 3300039447 Bacteria 5528
158 Ga0436361_0311825 3300039447 Bacteria 9544
159 Ga0436361_0615250 3300039447 Bacteria 17905
160 Ga0436361_0845374 3300039447 Bacteria 4165
161 Ga0436361_1222095 3300039447 Bacteria 17376
162 Ga0450906_038628 3300042145 Bacteria 842
163 Ga0466972_0076460 3300044658 Bacteria 1595
164 Ga0466981_0516460 3300044669 Bacteria 667
165 Ga0466982_0043656 3300044672 Bacteria 2724
166 Ga0466965_0026372 3300044683 Bacteria 2817
167 Ga0466965_0070834 3300044683 Bacteria 1753
168 Ga0466965_0147879 3300044683 Bacteria 1227
169 Ga0466966_0015130 3300044684 Bacteria 5103
170 Ga0466964_0271306 3300044706 Bacteria 844
171 Ga0466971_0132307 3300044719 Bacteria 1158
172 Ga0466968_0122953 3300044735 Bacteria 1175
173 Ga0466968_0286142 3300044735 Bacteria 790
174 Ga0466970_0037093 3300044765 Bacteria 2583
175 Ga0466957_0039890 3300044842 Bacteria 2834
176 Ga0466959_0011469 3300045049 Bacteria 6371
177 Ga0495617_000005 3300046452 Bacteria 404687
178 Ga0495617_002280 3300046452 Bacteria 7771
179 Ga0495617_004024 3300046452 Bacteria 5399
180 Ga0495617_005103 3300046452 Bacteria 4692
181 Ga0495617_288935 3300046452 Bacteria 501
182 Ga0495627_000038 3300046453 Bacteria 198316
183 Ga0495627_055091 3300046453 Bacteria 1187
184 Ga0495590_0000189 3300046457 Bacteria 35045
185 Ga0495590_0005476 3300046457 Bacteria 5031
186 Ga0495590_0015031 3300046457 Bacteria 2817
187 Ga0495638_0000765 3300046460 Bacteria 34151
188 Ga0495638_0015115 3300046460 Bacteria 5192
189 Ga0495638_0031283 3300046460 Bacteria 3421
190 Ga0495638_0031729 3300046460 Bacteria 3393
191 Ga0495638_0241601 3300046460 Bacteria 999
192 Ga0495653_0000172 3300046463 Bacteria 53376
193 Ga0495650_0000525 3300046471 Bacteria 55920
194 Ga0495650_0001069 3300046471 Bacteria 30311
195 Ga0495650_0001491 3300046471 Bacteria 22322
196 Ga0495650_0006359 3300046471 Bacteria 7379
197 Ga0495650_0007574 3300046471 Bacteria 6500
198 Ga0495650_0010363 3300046471 Bacteria 5206
199 Ga0495650_0154073 3300046471 Bacteria 823
200 Ga0495605_0000612 3300046474 Bacteria 27908
201 Ga0495605_0009464 3300046474 Bacteria 5475
202 Ga0495605_0043322 3300046474 Bacteria 2232
203 Ga0495605_0128448 3300046474 Bacteria 1144
204 Ga0495605_0207173 3300046474 Bacteria 852
205 Ga0495639_0005475 3300046475 Bacteria 5468
206 Ga0495584_0000007 3300046491 Bacteria 294820
207 Ga0495584_0004037 3300046491 Bacteria 7919
208 Ga0495584_0005349 3300046491 Bacteria 6803
209 Ga0495584_0023941 3300046491 Bacteria 3095
210 Ga0495584_0171502 3300046491 Bacteria 1103
211 Ga0495584_0241494 3300046491 Bacteria 918
212 Ga0495585_0001393 3300046492 Bacteria 19084
213 Ga0495585_0003005 3300046492 Bacteria 11640
214 Ga0495585_0004353 3300046492 Bacteria 9206
215 Ga0495585_0007559 3300046492 Bacteria 6645
216 Ga0495585_0019661 3300046492 Bacteria 3891
217 Ga0495585_0036188 3300046492 Bacteria 2786
218 Ga0495585_0270762 3300046492 Bacteria 842
219 Ga0495596_0001359 3300046500 Bacteria 14095
220 Ga0495596_0058012 3300046500 Bacteria 1510
221 Ga0495607_0004090 3300046501 Bacteria 10898
222 Ga0495607_0006030 3300046501 Bacteria 8588
223 Ga0495607_0018170 3300046501 Bacteria 4489
224 Ga0495607_0035974 3300046501 Bacteria 2989
225 Ga0495607_0041408 3300046501 Bacteria 2737
226 Ga0495607_0055165 3300046501 Bacteria 2287
227 Ga0495607_0113829 3300046501 Bacteria 1430
228 Ga0495607_0133211 3300046501 Bacteria 1290
229 Ga0495607_0229501 3300046501 Bacteria 903
230 Ga0495607_0301932 3300046501 Bacteria 753
231 Ga0495583_0000228 3300046506 Bacteria 93924
232 Ga0495583_0000337 3300046506 Bacteria 73928
233 Ga0495583_0001516 3300046506 Bacteria 23065
234 Ga0495583_0004976 3300046506 Bacteria 9221
235 Ga0495583_0010523 3300046506 Bacteria 5389
236 Ga0495583_0020994 3300046506 Bacteria 3366
237 Ga0495583_0136211 3300046506 Bacteria 1025
238 Ga0495606_0000077 3300046507 Bacteria 166824
239 Ga0495606_0000622 3300046507 Bacteria 55871
240 Ga0495606_0001807 3300046507 Bacteria 27215
241 Ga0495606_0002364 3300046507 Bacteria 22150
242 Ga0495606_0003880 3300046507 Bacteria 15427
243 Ga0495606_0003966 3300046507 Bacteria 15179
244 Ga0495606_0005790 3300046507 Bacteria 11670
245 Ga0495606_0008415 3300046507 Bacteria 8972
246 Ga0495606_0010503 3300046507 Bacteria 7670
247 Ga0495606_0128295 3300046507 Bacteria 1510
248 Ga0495610_0000038 3300046512 Bacteria 181669
249 Ga0495610_0002303 3300046512 Bacteria 16138
250 Ga0495610_0008294 3300046512 Bacteria 6747
251 Ga0495610_0012214 3300046512 Bacteria 5185
252 Ga0495610_0015722 3300046512 Bacteria 4387
253 Ga0495610_0016219 3300046512 Bacteria 4298
254 Ga0495610_0032672 3300046512 Bacteria 2700
255 Ga0495610_0204796 3300046512 Bacteria 805
256 Ga0495616_0000809 3300046513 Bacteria 22839
257 Ga0495616_0002449 3300046513 Bacteria 12316
258 Ga0495616_0002707 3300046513 Bacteria 11618
259 Ga0495616_0006609 3300046513 Bacteria 7005
260 Ga0495616_0007325 3300046513 Bacteria 6602
261 Ga0495616_0014486 3300046513 Bacteria 4412
262 Ga0495631_0007950 3300046518 Bacteria 5364
263 Ga0495637_0003796 3300046520 Bacteria 7940
264 Ga0495637_0005114 3300046520 Bacteria 6729
265 Ga0495637_0026521 3300046520 Bacteria 2599
266 Ga0495643_0000576 3300046522 Bacteria 45056
267 Ga0495643_0001479 3300046522 Bacteria 21441
268 Ga0495643_0041635 3300046522 Bacteria 2504
269 Ga0495643_0232989 3300046522 Bacteria 867
270 Ga0495644_0001721 3300046523 Bacteria 8856
271 Ga0495644_0004311 3300046523 Bacteria 5587
272 Ga0495648_0001432 3300046524 Bacteria 23348
273 Ga0495648_0002442 3300046524 Bacteria 17173
274 Ga0495648_0002498 3300046524 Bacteria 16874
275 Ga0495648_0016113 3300046524 Bacteria 5394
276 Ga0495648_0017212 3300046524 Bacteria 5176
277 Ga0495648_0023163 3300046524 Bacteria 4259
278 Ga0495648_0025539 3300046524 Bacteria 3997
279 Ga0495648_0031143 3300046524 Bacteria 3516
280 Ga0495648_0075759 3300046524 Bacteria 1934
281 Ga0495648_0205353 3300046524 Bacteria 983
282 Ga0495663_0006683 3300046525 Bacteria 3183
283 Ga0495663_0018634 3300046525 Bacteria 1977
284 Ga0495642_0005707 3300046528 Bacteria 4776
285 Ga0495642_0016962 3300046528 Bacteria 2843
286 Ga0495642_0027937 3300046528 Bacteria 2245
287 Ga0495654_0000233 3300046530 Bacteria 52038
288 Ga0495654_0007384 3300046530 Bacteria 6141
289 Ga0495654_0011038 3300046530 Bacteria 4905
290 Ga0495654_0020169 3300046530 Bacteria 3477
291 Ga0495654_0022446 3300046530 Bacteria 3277
292 Ga0495609_0001170 3300046538 Bacteria 18085
293 Ga0495609_0001426 3300046538 Bacteria 15913
294 Ga0495609_0005105 3300046538 Bacteria 6997
295 Ga0495609_0010200 3300046538 Bacteria 4515
296 Ga0495609_0016788 3300046538 Bacteria 3409
297 Ga0495609_0019685 3300046538 Bacteria 3120
298 Ga0495609_0020971 3300046538 Bacteria 3015
299 Ga0495609_0086654 3300046538 Bacteria 1365
300 Ga0495609_0095924 3300046538 Bacteria 1287
301 Ga0495609_0096749 3300046538 Bacteria 1281
302 Ga0495621_0002057 3300046539 Bacteria 5324
303 Ga0495597_0001069 3300046542 Bacteria 20901
304 Ga0495597_0003173 3300046542 Bacteria 9829
305 Ga0495597_0020064 3300046542 Bacteria 3119
306 Ga0495597_0047306 3300046542 Bacteria 1904
307 Ga0495597_0126756 3300046542 Bacteria 1061
308 Ga0495622_0000434 3300046557 Bacteria 27206
309 Ga0495622_0001583 3300046557 Bacteria 11259
310 Ga0495622_0224483 3300046557 Bacteria 831
311 Ga0495633_0000606 3300046558 Bacteria 34316
312 Ga0495633_0001184 3300046558 Bacteria 20944
313 Ga0495633_0004862 3300046558 Bacteria 8402
314 Ga0495633_0006099 3300046558 Bacteria 7219
315 Ga0495633_0007259 3300046558 Bacteria 6411
316 Ga0495633_0008143 3300046558 Bacteria 5944
317 Ga0495633_0011352 3300046558 Bacteria 4808
318 Ga0495633_0019897 3300046558 Bacteria 3386
319 Ga0495633_0024293 3300046558 Bacteria 2996
320 Ga0495633_0066647 3300046558 Bacteria 1681
321 Ga0495633_0147165 3300046558 Unclassified 1088
322 Ga0495656_0014985 3300046615 Bacteria 2917
323 Ga0495656_0020290 3300046615 Bacteria 2576
324 Ga0495668_0000064 3300046616 Bacteria 180583
325 Ga0495668_0000330 3300046616 Bacteria 64685
326 Ga0495668_0000979 3300046616 Bacteria 31250
327 Ga0495668_0001639 3300046616 Bacteria 20890
328 Ga0495668_0004175 3300046616 Bacteria 10424
329 Ga0495668_0005135 3300046616 Bacteria 8999
330 Ga0495668_0006552 3300046616 Bacteria 7606
331 Ga0495668_0014307 3300046616 Bacteria 4656
332 Ga0495668_0033243 3300046616 Bacteria 2898
333 Ga0495668_0255950 3300046616 Bacteria 958
334 Ga0495611_0034719 3300046648 Bacteria 2230
335 Ga0495611_0113226 3300046648 Bacteria 1263
336 Ga0495611_0446565 3300046648 Bacteria 589
337 Ga0495625_0001154 3300046660 Bacteria 34018
338 Ga0495625_0002821 3300046660 Bacteria 18290
339 Ga0495625_0003372 3300046660 Bacteria 16017
340 Ga0495625_0003568 3300046660 Bacteria 15346
341 Ga0495625_0012993 3300046660 Bacteria 6719
342 Ga0495625_0015756 3300046660 Bacteria 5969
343 Ga0495625_0036283 3300046660 Bacteria 3625
344 Ga0495625_0048890 3300046660 Bacteria 3042
345 Ga0495625_0068648 3300046660 Bacteria 2491
346 Ga0495625_0093694 3300046660 Bacteria 2073
347 Ga0495625_0433027 3300046660 Bacteria 816
348 Ga0495625_0627060 3300046660 Bacteria 643
349 Ga0495659_0000829 3300046664 Bacteria 10983
350 Ga0495659_0001900 3300046664 Bacteria 6883
351 Ga0495659_0003731 3300046664 Bacteria 4844
352 Ga0495659_0163842 3300046664 Bacteria 899
353 Ga0495661_0026411 3300046665 Bacteria 3741
354 Ga0495661_0033656 3300046665 Bacteria 3231
355 Ga0495661_0035569 3300046665 Bacteria 3123
356 Ga0495661_0192129 3300046665 Bacteria 1074
357 Ga0495661_0288320 3300046665 Bacteria 825
358 Ga0495661_0357751 3300046665 Bacteria 717
359 Ga0495661_0358512 3300046665 Bacteria 716
360 Ga0495588_0069844 3300046674 Bacteria 1825
361 Ga0495669_0009011 3300046684 Bacteria 4204
362 Ga0495670_0003436 3300046691 Bacteria 7782
363 Ga0495670_0005000 3300046691 Bacteria 6518
364 Ga0495670_0006220 3300046691 Bacteria 5861
365 Ga0495670_0056958 3300046691 Bacteria 1961
366 Ga0495670_0243298 3300046691 Bacteria 958
367 Ga0495671_0000044 3300046692 Bacteria 160337
368 Ga0495671_0004545 3300046692 Bacteria 8271
369 Ga0495671_0013159 3300046692 Bacteria 4491
370 Ga0495671_0017226 3300046692 Bacteria 3846
371 Ga0495671_0065292 3300046692 Bacteria 1791
372 Ga0495671_0066155 3300046692 Bacteria 1779
373 Ga0495671_0178322 3300046692 Bacteria 1032
374 Ga0495671_0201352 3300046692 Bacteria 965
375 Ga0495649_0006524 3300046694 Bacteria 7259
376 Ga0495649_0015661 3300046694 Bacteria 4311
377 Ga0495649_0067524 3300046694 Bacteria 1918
378 Ga0495649_0269372 3300046694 Bacteria 872
379 Ga0495589_0169167 3300046794 Bacteria 1039
380 Ga0495589_0207810 3300046794 Bacteria 922
381 Ga0495660_0001360 3300046810 Bacteria 16828
382 Ga0495660_0004559 3300046810 Bacteria 8366
383 Ga0495660_0007552 3300046810 Bacteria 6382
384 Ga0495660_0022140 3300046810 Bacteria 3632
385 Ga0495660_0024487 3300046810 Bacteria 3437
386 Ga0495660_0226855 3300046810 Bacteria 877
387 Ga0495660_0261568 3300046810 Bacteria 799
388 Ga0495636_0000384 3300047318 Bacteria 16665
389 Ga0495636_0001011 3300047318 Bacteria 10549
390 Ga0495636_0020295 3300047318 Bacteria 2677
391 Ga0495636_0043216 3300047318 Bacteria 1874
392 Ga0495636_0092899 3300047318 Bacteria 1311
393 Ga0495672_0000361 3300047320 Bacteria 58121
394 Ga0495672_0000883 3300047320 Bacteria 31542
395 Ga0495672_0002769 3300047320 Bacteria 15681
396 Ga0495672_0007539 3300047320 Bacteria 8168
397 Ga0495683_0000083 3300047323 Bacteria 93743
398 Ga0495683_0000641 3300047323 Bacteria 26026
399 Ga0495683_0003345 3300047323 Bacteria 9375
400 Ga0495683_0016552 3300047323 Bacteria 3828
401 Ga0495687_001058 3300047443 Bacteria 27224
402 Ga0495687_001886 3300047443 Bacteria 18083
403 Ga0495687_004618 3300047443 Bacteria 9203
404 Ga0495687_082540 3300047443 Bacteria 1254
405 Ga0495687_086268 3300047443 Bacteria 1214
406 Ga0495677_0000605 3300047445 Bacteria 14685
407 Ga0495677_0028442 3300047445 Bacteria 2029
408 Ga0495677_0040027 3300047445 Bacteria 1714
409 Ga0495677_0077050 3300047445 Bacteria 1247
410 Ga0495677_0117037 3300047445 Bacteria 1015
411 Ga0495679_003904 3300047446 Bacteria 7051
412 Ga0495679_016357 3300047446 Bacteria 2685
413 Ga0495679_045446 3300047446 Bacteria 1341
414 Ga0495679_111092 3300047446 Bacteria 754
415 Ga0495685_000089 3300047447 Bacteria 33778
416 Ga0495685_001094 3300047447 Bacteria 8266
417 Ga0495685_002906 3300047447 Bacteria 5416
418 Ga0495685_013104 3300047447 Bacteria 2812
419 Ga0495673_0000085 3300047469 Bacteria 193245
420 Ga0495673_0000409 3300047469 Bacteria 50226
421 Ga0495673_0000522 3300047469 Bacteria 40373
422 Ga0495673_0006016 3300047469 Bacteria 7213
423 Ga0495673_0014601 3300047469 Bacteria 4080
424 Ga0495673_0266590 3300047469 Bacteria 621
425 Ga0495681_0016777 3300047470 Bacteria 4089
426 Ga0495681_0261937 3300047470 Bacteria 679
427 Ga0495686_0001924 3300047472 Bacteria 20689
428 Ga0495686_0007324 3300047472 Bacteria 8282
429 Ga0495686_0008480 3300047472 Bacteria 7536
430 Ga0495686_0014990 3300047472 Bacteria 5313
431 Ga0495686_0074531 3300047472 Bacteria 2082
432 Ga0495686_0388865 3300047472 Bacteria 751
433 Ga0495615_0004672 3300048090 Bacteria 2409
434 Ga0495615_0009612 3300048090 Bacteria 1909
435 Ga0495626_0008425 3300048091 Bacteria 5654
436 Ga0495626_0038688 3300048091 Bacteria 2260
437 Ga0496100_0151409 3300048903 Bacteria 1655
438 Ga0496100_0186526 3300048903 Bacteria 1503
439 Ga0496100_0291217 3300048903 Bacteria 1220
440 Ga0496101_0041098 3300048904 Bacteria 3296
441 Ga0496101_0339099 3300048904 Bacteria 1180
442 Ga0496102_0000711 3300048905 Bacteria 32978
443 Ga0496102_0041369 3300048905 Bacteria 4172
444 Ga0496102_0726233 3300048905 Bacteria 916
445 Ga0496102_1447414 3300048905 Bacteria 606
446 Ga0496103_0007131 3300048906 Bacteria 6671
447 Ga0496103_0054108 3300048906 Bacteria 2488
448 Ga0496103_0059060 3300048906 Bacteria 2383
449 Ga0496103_0273083 3300048906 Bacteria 1088
450 Ga0496103_0945195 3300048906 Bacteria 539
451 Ga0496104_0054128 3300048907 Bacteria 3793
452 Ga0496104_0202915 3300048907 Bacteria 1895
453 Ga0496105_0227134 3300048908 Bacteria 1518
454 Ga0496106_0098362 3300048909 Bacteria 2267
455 Ga0496108_0035020 3300048911 Bacteria 4172
456 Ga0496109_0261985 3300048912 Bacteria 1628
457 Ga0496109_1537588 3300048912 Unclassified 600
458 Ga0496110_0385314 3300048913 Bacteria 1277
459 Ga0496110_1114695 3300048913 Bacteria 697
460 Ga0496110_1126439 3300048913 Bacteria 693
461 Ga0496111_0009665 3300048914 Bacteria 6445
462 Ga0496111_0150857 3300048914 Bacteria 1724
463 Ga0496114_0221464 3300048917 Bacteria 1661
464 Ga0496114_0657089 3300048917 Bacteria 922
465 Ga0496114_1579978 3300048917 Bacteria 544
466 Ga0496116_0051421 3300048919 Bacteria 2737
467 Ga0496116_0201257 3300048919 Bacteria 1042
468 Ga0496117_0000011 3300048920 Bacteria 610930
469 Ga0496118_0000010 3300048921 Bacteria 610930
470 Ga0496121_0006064 3300048924 Bacteria 15219
471 Ga0496121_0008022 3300048924 Bacteria 12593
472 Ga0496121_0112489 3300048924 Bacteria 2074
473 Ga0496121_0814751 3300048924 Bacteria 547
474 Ga0496122_0002864 3300048925 Bacteria 23629
475 Ga0496122_0026094 3300048925 Bacteria 5053
476 Ga0496122_0060258 3300048925 Bacteria 2796
477 Ga0496123_0009443 3300048926 Bacteria 8782
478 Ga0496123_0049429 3300048926 Bacteria 2820
479 Ga0496123_0165582 3300048926 Bacteria 1173
480 Ga0496124_0075602 3300048927 Bacteria 2782
481 Ga0496124_0076905 3300048927 Bacteria 2754
482 Ga0496124_0091986 3300048927 Bacteria 2471
483 Ga0496124_0214097 3300048927 Bacteria 1455
484 Ga0496124_0241912 3300048927 Bacteria 1341
485 Ga0496125_0038675 3300048928 Bacteria 4123
486 Ga0496125_0263728 3300048928 Bacteria 1078
487 Ga0496126_0159763 3300048929 Bacteria 1926
488 Ga0496126_0608381 3300048929 Bacteria 860
489 Ga0501306_006991 3300049127 Bacteria 1340
490 Ga0501310_056401 3300049130 Bacteria 578
491 Ga0495678_000001 3300049459 Bacteria 1060340
492 Ga0495678_000454 3300049459 Bacteria 40665
493 Ga0495678_001236 3300049459 Bacteria 20809
494 Ga0495678_001731 3300049459 Bacteria 16268
495 Ga0495678_004661 3300049459 Bacteria 7863
496 Ga0495678_007739 3300049459 Bacteria 5535
497 Ga0495682_0003670 3300049460 Bacteria 6767
498 Ga0495682_0007321 3300049460 Bacteria 4401
499 Ga0495682_0201355 3300049460 Bacteria 706
500 Ga0501227_005429 3300049665 Bacteria 2727
501 Ga0501249_001545 3300049679 Bacteria 4717
502 Ga0501269_000490 3300049766 Bacteria 8265
503 Ga0501279_002590 3300049775 Bacteria 2364
504 Ga0501044_0290307 3300049823 Bacteria 1567
505 Ga0500594_0047721 3300053118 Bacteria 1195
506 Ga0500608_206184 3300053122 Bacteria 808
507 Ga0500618_000776 3300053125 Bacteria 17938
508 Ga0500618_014938 3300053125 Bacteria 1972
509 Ga0500618_114208 3300053125 Bacteria 611
510 Ga0500586_000447 3300053145 Bacteria 8231
511 Ga0500586_006822 3300053145 Bacteria 2998
512 Ga0500624_022698 3300053157 Bacteria 1023
513 Ga0587115_068063 3300059626 Bacteria 610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0243298 Ga0495670_0243298_579_947 116
2 3300046692 Ga0495671_0201352 Ga0495671_0201352_595_945 116
3 3300046453 Ga0495627_055091 Ga0495627_055091_12_368 118
4 3300046810 Ga0495660_0022140 Ga0495660_0022140_1540_1896 118
5 iso_pu_bacteria 2919476304 2919480983 118
6 3300046557 Ga0495622_0000434 Ga0495622_0000434_15024_15383 119
7 3300046660 Ga0495625_0068648 Ga0495625_0068648_1228_1590 119
8 iso_pu_bacteria 2738541297 2738827089 119
9 iso_pu_bacteria 2738541357 2739150886 119
10 iso_pu_bacteria 2738543003 2739192805 119
11 iso_pu_bacteria 2738543026 2739319282 119
12 iso_pu_bacteria 2738543029 2739337523 119
13 iso_pu_bacteria 2821131069 2821134405 119
14 iso_pu_bacteria 2857558681 2857564105 119
15 3300044672 Ga0466982_0043656 Ga0466982_0043656_1946_2326 120
16 3300048905 Ga0496102_1447414 Ga0496102_1447414_181_543 120
17 3300030745 Ga0316182_1408478 Ga0316182_14084782 121
18 3300046457 Ga0495590_0005476 Ga0495590_0005476_3956_4327 121
19 3300046474 Ga0495605_0207173 Ga0495605_0207173_42_413 121
20 3300046501 Ga0495607_0133211 Ga0495607_0133211_345_716 121
21 3300046506 Ga0495583_0020994 Ga0495583_0020994_1446_1817 121
22 3300046513 Ga0495616_0014486 Ga0495616_0014486_42_413 121
23 3300046518 Ga0495631_0007950 Ga0495631_0007950_961_1332 121
24 3300046520 Ga0495637_0026521 Ga0495637_0026521_809_1180 121
25 3300046524 Ga0495648_0023163 Ga0495648_0023163_2935_3306 121
26 3300046530 Ga0495654_0011038 Ga0495654_0011038_1615_1986 121
27 3300046542 Ga0495597_0047306 Ga0495597_0047306_1255_1626 121
28 3300046616 Ga0495668_0000979 Ga0495668_0000979_27482_27853 121
29 3300046660 Ga0495625_0036283 Ga0495625_0036283_1664_2035 121
30 3300046665 Ga0495661_0357751 Ga0495661_0357751_305_676 121
31 3300046665 Ga0495661_0358512 Ga0495661_0358512_304_675 121
32 3300046692 Ga0495671_0013159 Ga0495671_0013159_1079_1450 121
33 3300046810 Ga0495660_0226855 Ga0495660_0226855_345_716 121
34 3300046810 Ga0495660_0261568 Ga0495660_0261568_162_533 121
35 3300047323 Ga0495683_0016552 Ga0495683_0016552_2910_3275 121
36 3300047446 Ga0495679_003904 Ga0495679_003904_2133_2504 121
37 3300047447 Ga0495685_002906 Ga0495685_002906_1771_2142 121
38 3300047470 Ga0495681_0016777 Ga0495681_0016777_3061_3432 121
39 3300048091 Ga0495626_0038688 Ga0495626_0038688_1250_1621 121
40 3300049459 Ga0495678_001236 Ga0495678_001236_3272_3643 121
41 iso_pu_bacteria 2643221638 2644216399 121
42 iso_pu_bacteria 2738541280 2738742977 121
43 iso_pu_bacteria 2738541300 2738847060 121
44 iso_pu_bacteria 2738543018 2739277830 121
45 iso_pu_bacteria 2738543030 2739346873 121
46 iso_pu_bacteria 2857553236 2857557230 121
47 3300006946 Ga0079104_1051186 Ga0079104_10511862 122
48 3300013306 Ga0163162_11012964 Ga0163162_110129642 122
49 3300015261 Ga0182006_1000290 Ga0182006_100029015 122
50 3300015262 Ga0182007_10092361 Ga0182007_100923612 122
51 3300027111 Ga0209281_1039709 Ga0209281_10397092 122
52 3300044842 Ga0466957_0039890 Ga0466957_0039890_978_1346 122
53 3300046452 Ga0495617_004024 Ga0495617_004024_3960_4328 122
54 3300046474 Ga0495605_0128448 Ga0495605_0128448_540_908 122
55 3300046491 Ga0495584_0000007 Ga0495584_0000007_195840_196208 122
56 3300046491 Ga0495584_0005349 Ga0495584_0005349_3136_3504 122
57 3300046491 Ga0495584_0171502 Ga0495584_0171502_511_879 122
58 3300046492 Ga0495585_0004353 Ga0495585_0004353_5453_5821 122
59 3300046492 Ga0495585_0007559 Ga0495585_0007559_3826_4194 122
60 3300046492 Ga0495585_0019661 Ga0495585_0019661_1072_1440 122
61 3300046492 Ga0495585_0270762 Ga0495585_0270762_399_767 122
62 3300046500 Ga0495596_0001359 Ga0495596_0001359_10708_11076 122
63 3300046500 Ga0495596_0058012 Ga0495596_0058012_376_744 122
64 3300046501 Ga0495607_0035974 Ga0495607_0035974_1820_2188 122
65 3300046501 Ga0495607_0301932 Ga0495607_0301932_235_603 122
66 3300046513 Ga0495616_0000809 Ga0495616_0000809_3317_3685 122
67 3300046513 Ga0495616_0006609 Ga0495616_0006609_3259_3627 122
68 3300046524 Ga0495648_0016113 Ga0495648_0016113_3955_4323 122
69 3300046530 Ga0495654_0022446 Ga0495654_0022446_2486_2866 122
70 3300046538 Ga0495609_0020971 Ga0495609_0020971_969_1337 122
71 3300046538 Ga0495609_0095924 Ga0495609_0095924_732_1100 122
72 3300046538 Ga0495609_0096749 Ga0495609_0096749_117_485 122
73 3300046542 Ga0495597_0003173 Ga0495597_0003173_3097_3465 122
74 3300046542 Ga0495597_0020064 Ga0495597_0020064_172_552 122
75 3300046558 Ga0495633_0008143 Ga0495633_0008143_3210_3578 122
76 3300046558 Ga0495633_0011352 Ga0495633_0011352_2247_2615 122
77 3300046558 Ga0495633_0066647 Ga0495633_0066647_652_1020 122
78 3300046616 Ga0495668_0005135 Ga0495668_0005135_5347_5715 122
79 3300046616 Ga0495668_0033243 Ga0495668_0033243_1693_2061 122
80 3300046664 Ga0495659_0003731 Ga0495659_0003731_3196_3576 122
81 3300046665 Ga0495661_0033656 Ga0495661_0033656_1752_2135 122
82 3300046691 Ga0495670_0003436 Ga0495670_0003436_4095_4463 122
83 3300046691 Ga0495670_0006220 Ga0495670_0006220_3810_4178 122
84 3300046692 Ga0495671_0004545 Ga0495671_0004545_4903_5304 122
85 3300046794 Ga0495589_0207810 Ga0495589_0207810_437_805 122
86 3300047320 Ga0495672_0002769 Ga0495672_0002769_8246_8647 122
87 3300047323 Ga0495683_0000083 Ga0495683_0000083_15647_16015 122
88 3300047443 Ga0495687_082540 Ga0495687_082540_463_831 122
89 3300047445 Ga0495677_0077050 Ga0495677_0077050_139_507 122
90 3300047469 Ga0495673_0014601 Ga0495673_0014601_2901_3269 122
91 3300048091 Ga0495626_0008425 Ga0495626_0008425_3790_4173 122
92 3300048906 Ga0496103_0945195 Ga0496103_0945195_68_436 122
93 3300048924 Ga0496121_0112489 Ga0496121_0112489_947_1321 122
94 3300048924 Ga0496121_0814751 Ga0496121_0814751_100_474 122
95 iso_pu_bacteria 2643221554 2643788001 122
96 iso_pu_bacteria 2643221664 2644359729 122
97 iso_pu_bacteria 2842711865 2842714934 122
98 iso_pu_bacteria 2857564685 2857570179 122
99 3300003773 Ga0055537_1025439 Ga0055537_10254392 123
100 3300003775 Ga0055524_1000025 Ga0055524_1000025171 123
101 3300006948 Ga0099826_10000005 Ga0099826_1000000516 123
102 3300009036 Ga0105244_10138061 Ga0105244_101380612 123
103 3300021361 Ga0213872_10000283 Ga0213872_1000028316 123
104 3300021361 Ga0213872_10000448 Ga0213872_1000044814 123
105 3300021361 Ga0213872_10007921 Ga0213872_100079213 123
106 3300021361 Ga0213872_10010803 Ga0213872_100108035 123
107 3300025245 Ga0207425_1001019 Ga0207425_100101911 123
108 3300025263 Ga0209565_1005049 Ga0209565_10050493 123
109 3300025294 Ga0209025_1002795 Ga0209025_100279512 123
110 3300025297 Ga0209758_1001203 Ga0209758_100120314 123
111 3300025299 Ga0209256_1000040 Ga0209256_100004016 123
112 3300025728 Ga0207655_1112292 Ga0207655_11122922 123
113 3300027666 Ga0209282_1000003 Ga0209282_1000003784 123
114 3300031711 Ga0265314_10040426 Ga0265314_100404265 123
115 3300039447 Ga0436361_0296853 Ga0436361_0296853_3907_4278 123
116 3300039447 Ga0436361_0311825 Ga0436361_0311825_5628_6008 123
117 3300039447 Ga0436361_0615250 Ga0436361_0615250_8570_8941 123
118 3300039447 Ga0436361_1222095 Ga0436361_1222095_3453_3848 123
119 3300044658 Ga0466972_0076460 Ga0466972_0076460_824_1195 123
120 3300044683 Ga0466965_0070834 Ga0466965_0070834_160_531 123
121 3300044683 Ga0466965_0147879 Ga0466965_0147879_337_708 123
122 3300044684 Ga0466966_0015130 Ga0466966_0015130_1548_1919 123
123 3300044706 Ga0466964_0271306 Ga0466964_0271306_325_699 123
124 3300044719 Ga0466971_0132307 Ga0466971_0132307_318_689 123
125 3300044735 Ga0466968_0122953 Ga0466968_0122953_327_701 123
126 3300044735 Ga0466968_0286142 Ga0466968_0286142_64_447 123
127 3300046452 Ga0495617_000005 Ga0495617_000005_19181_19552 123
128 3300046453 Ga0495627_000038 Ga0495627_000038_183192_183563 123
129 3300046457 Ga0495590_0000189 Ga0495590_0000189_16835_17236 123
130 3300046460 Ga0495638_0000765 Ga0495638_0000765_17194_17595 123
131 3300046460 Ga0495638_0031729 Ga0495638_0031729_1828_2232 123
132 3300046460 Ga0495638_0241601 Ga0495638_0241601_373_744 123
133 3300046463 Ga0495653_0000172 Ga0495653_0000172_35378_35749 123
134 3300046471 Ga0495650_0000525 Ga0495650_0000525_14672_15043 123
135 3300046471 Ga0495650_0001491 Ga0495650_0001491_16909_17310 123
136 3300046471 Ga0495650_0007574 Ga0495650_0007574_3366_3770 123
137 3300046474 Ga0495605_0000612 Ga0495605_0000612_13993_14367 123
138 3300046475 Ga0495639_0005475 Ga0495639_0005475_4635_5036 123
139 3300046492 Ga0495585_0001393 Ga0495585_0001393_9577_9948 123
140 3300046492 Ga0495585_0003005 Ga0495585_0003005_8845_9234 123
141 3300046501 Ga0495607_0055165 Ga0495607_0055165_963_1346 123
142 3300046506 Ga0495583_0000337 Ga0495583_0000337_3295_3666 123
143 3300046506 Ga0495583_0001516 Ga0495583_0001516_5519_5920 123
144 3300046506 Ga0495583_0010523 Ga0495583_0010523_1800_2171 123
145 3300046507 Ga0495606_0002364 Ga0495606_0002364_14949_15320 123
146 3300046512 Ga0495610_0000038 Ga0495610_0000038_19226_19597 123
147 3300046522 Ga0495643_0001479 Ga0495643_0001479_16259_16660 123
148 3300046522 Ga0495643_0232989 Ga0495643_0232989_122_493 123
149 3300046524 Ga0495648_0001432 Ga0495648_0001432_17313_17714 123
150 3300046524 Ga0495648_0002498 Ga0495648_0002498_7802_8173 123
151 3300046524 Ga0495648_0017212 Ga0495648_0017212_1137_1508 123
152 3300046524 Ga0495648_0025539 Ga0495648_0025539_2690_3061 123
153 3300046524 Ga0495648_0075759 Ga0495648_0075759_1350_1721 123
154 3300046525 Ga0495663_0006683 Ga0495663_0006683_1161_1532 123
155 3300046528 Ga0495642_0027937 Ga0495642_0027937_1322_1723 123
156 3300046530 Ga0495654_0007384 Ga0495654_0007384_1933_2304 123
157 3300046538 Ga0495609_0016788 Ga0495609_0016788_358_759 123
158 3300046542 Ga0495597_0001069 Ga0495597_0001069_16282_16683 123
159 3300046542 Ga0495597_0126756 Ga0495597_0126756_477_848 123
160 3300046557 Ga0495622_0001583 Ga0495622_0001583_4760_5161 123
161 3300046558 Ga0495633_0000606 Ga0495633_0000606_16656_17057 123
162 3300046558 Ga0495633_0001184 Ga0495633_0001184_15629_16006 123
163 3300046558 Ga0495633_0019897 Ga0495633_0019897_2209_2580 123
164 3300046615 Ga0495656_0014985 Ga0495656_0014985_2359_2730 123
165 3300046616 Ga0495668_0001639 Ga0495668_0001639_9221_9592 123
166 3300046616 Ga0495668_0004175 Ga0495668_0004175_3375_3776 123
167 3300046616 Ga0495668_0255950 Ga0495668_0255950_520_891 123
168 3300046660 Ga0495625_0001154 Ga0495625_0001154_16557_16958 123
169 3300046660 Ga0495625_0003372 Ga0495625_0003372_12303_12707 123
170 3300046660 Ga0495625_0048890 Ga0495625_0048890_1153_1524 123
171 3300046660 Ga0495625_0093694 Ga0495625_0093694_1186_1557 123
172 3300046664 Ga0495659_0163842 Ga0495659_0163842_140_511 123
173 3300046665 Ga0495661_0035569 Ga0495661_0035569_1496_1867 123
174 3300046692 Ga0495671_0000044 Ga0495671_0000044_19212_19583 123
175 3300046694 Ga0495649_0269372 Ga0495649_0269372_172_573 123
176 3300046794 Ga0495589_0169167 Ga0495589_0169167_118_489 123
177 3300046810 Ga0495660_0007552 Ga0495660_0007552_3034_3435 123
178 3300046810 Ga0495660_0024487 Ga0495660_0024487_1106_1477 123
179 3300047318 Ga0495636_0043216 Ga0495636_0043216_1456_1827 123
180 3300047318 Ga0495636_0092899 Ga0495636_0092899_636_1007 123
181 3300047320 Ga0495672_0000361 Ga0495672_0000361_14876_15247 123
182 3300047323 Ga0495683_0003345 Ga0495683_0003345_3173_3544 123
183 3300047443 Ga0495687_001886 Ga0495687_001886_1167_1568 123
184 3300047443 Ga0495687_004618 Ga0495687_004618_1167_1568 123
185 3300047445 Ga0495677_0040027 Ga0495677_0040027_992_1363 123
186 3300047445 Ga0495677_0117037 Ga0495677_0117037_199_570 123
187 3300047446 Ga0495679_016357 Ga0495679_016357_1010_1381 123
188 3300047469 Ga0495673_0000409 Ga0495673_0000409_30633_31004 123
189 3300047472 Ga0495686_0074531 Ga0495686_0074531_1433_1804 123
190 3300048090 Ga0495615_0004672 Ga0495615_0004672_1643_2014 123
191 3300048903 Ga0496100_0186526 Ga0496100_0186526_267_644 123
192 3300048904 Ga0496101_0339099 Ga0496101_0339099_222_599 123
193 3300048905 Ga0496102_0041369 Ga0496102_0041369_2903_3274 123
194 3300048905 Ga0496102_0726233 Ga0496102_0726233_70_441 123
195 3300048906 Ga0496103_0007131 Ga0496103_0007131_2578_2967 123
196 3300048906 Ga0496103_0059060 Ga0496103_0059060_1392_1763 123
197 3300048906 Ga0496103_0273083 Ga0496103_0273083_244_615 123
198 3300048917 Ga0496114_0221464 Ga0496114_0221464_1098_1487 123
199 3300048925 Ga0496122_0026094 Ga0496122_0026094_1164_1535 123
200 3300048925 Ga0496122_0060258 Ga0496122_0060258_850_1221 123
201 3300048926 Ga0496123_0009443 Ga0496123_0009443_3223_3594 123
202 3300048926 Ga0496123_0165582 Ga0496123_0165582_438_809 123
203 3300048927 Ga0496124_0091986 Ga0496124_0091986_1779_2150 123
204 3300049459 Ga0495678_004661 Ga0495678_004661_6485_6886 123
205 3300049459 Ga0495678_007739 Ga0495678_007739_2778_3179 123
206 3300049679 Ga0501249_001545 Ga0501249_001545_3245_3631 123
207 3300049766 Ga0501269_000490 Ga0501269_000490_4675_5061 123
208 3300049823 Ga0501044_0290307 Ga0501044_0290307_597_1016 123
209 3300053145 Ga0500586_006822 Ga0500586_006822_1561_1932 123
210 3300053157 Ga0500624_022698 Ga0500624_022698_188_580 123
211 iso_pu_bacteria 2643221645 2644255166 123
212 iso_pu_bacteria 2857547612 2857549814 123
213 iso_pu_bacteria 2885080285 2885080295 123
214 iso_pu_bacteria 2904424332 2904430422 123
215 3300006028 Ga0070717_10466705 Ga0070717_104667052 124
216 3300025250 Ga0209026_1002599 Ga0209026_10025995 124
217 3300025263 Ga0209565_1016900 Ga0209565_10169002 124
218 3300031548 Ga0307408_100000740 Ga0307408_1000007404 124
219 3300035114 Ga0373939_0039168 Ga0373939_0039168_642_1019 124
220 3300037312 Ga0395899_0013296 Ga0395899_0013296_3637_4026 124
221 3300037418 Ga0395900_0279055 Ga0395900_0279055_827_1228 124
222 3300037418 Ga0395900_0749902 Ga0395900_0749902_270_659 124
223 3300037418 Ga0395900_0762171 Ga0395900_0762171_239_628 124
224 3300037466 Ga0395898_0629296 Ga0395898_0629296_379_768 124
225 3300037471 Ga0395905_0699236 Ga0395905_0699236_102_476 124
226 3300038443 Ga0395901_0060703 Ga0395901_0060703_164_553 124
227 3300038443 Ga0395901_0087933 Ga0395901_0087933_2808_3218 124
228 3300044683 Ga0466965_0026372 Ga0466965_0026372_187_594 124
229 3300045049 Ga0466959_0011469 Ga0466959_0011469_3967_4341 124
230 3300046471 Ga0495650_0001069 Ga0495650_0001069_11778_12161 124
231 3300046501 Ga0495607_0018170 Ga0495607_0018170_220_597 124
232 3300046506 Ga0495583_0136211 Ga0495583_0136211_532_906 124
233 3300046507 Ga0495606_0000622 Ga0495606_0000622_43040_43414 124
234 3300046507 Ga0495606_0003966 Ga0495606_0003966_11901_12284 124
235 3300046525 Ga0495663_0018634 Ga0495663_0018634_1504_1878 124
236 3300046528 Ga0495642_0005707 Ga0495642_0005707_1037_1411 124
237 3300046528 Ga0495642_0016962 Ga0495642_0016962_159_542 124
238 3300046660 Ga0495625_0015756 Ga0495625_0015756_3097_3483 124
239 3300047318 Ga0495636_0020295 Ga0495636_0020295_822_1196 124
240 3300047447 Ga0495685_013104 Ga0495685_013104_1369_1743 124
241 3300048905 Ga0496102_0000711 Ga0496102_0000711_13960_14334 124
242 3300048906 Ga0496103_0054108 Ga0496103_0054108_1937_2311 124
243 3300048919 Ga0496116_0201257 Ga0496116_0201257_272_649 124
244 3300048927 Ga0496124_0075602 Ga0496124_0075602_2332_2709 124
245 3300053125 Ga0500618_014938 Ga0500618_014938_74_448 124
246 3300059626 Ga0587115_068063 Ga0587115_068063_74_484 124
247 3300003771 Ga0055526_1007207 Ga0055526_10072072 125
248 3300003773 Ga0055537_1000592 Ga0055537_100059215 125
249 3300003773 Ga0055537_1020001 Ga0055537_10200012 125
250 3300003775 Ga0055524_1009571 Ga0055524_10095712 125
251 3300003775 Ga0055524_1010820 Ga0055524_10108204 125
252 3300003784 Ga0055534_1000428 Ga0055534_100042811 125
253 3300003784 Ga0055534_1031171 Ga0055534_10311712 125
254 3300003790 Ga0055528_1000298 Ga0055528_100029815 125
255 3300004625 Ga0055543_1010417 Ga0055543_10104173 125
256 3300005262 Ga0065165_1000438 Ga0065165_10004386 125
257 3300009148 Ga0105243_12667589 Ga0105243_126675892 125
258 3300015265 Ga0182005_1000005 Ga0182005_1000005443 125
259 3300017792 Ga0163161_10138739 Ga0163161_101387392 125
260 3300025263 Ga0209565_1000068 Ga0209565_100006816 125
261 3300025263 Ga0209565_1038859 Ga0209565_10388592 125
262 3300025273 Ga0209673_1000119 Ga0209673_100011916 125
263 3300025284 Ga0209130_1000057 Ga0209130_100005715 125
264 3300025291 Ga0209675_1000068 Ga0209675_100006816 125
265 3300025291 Ga0209675_1012028 Ga0209675_10120282 125
266 3300025295 Ga0209564_1000149 Ga0209564_1000149145 125
267 3300025295 Ga0209564_1002252 Ga0209564_100225215 125
268 3300025299 Ga0209256_1000744 Ga0209256_100074428 125
269 3300025299 Ga0209256_1001036 Ga0209256_100103615 125
270 3300025302 Ga0207426_1018898 Ga0207426_10188981 125
271 3300028380 Ga0268265_10980234 Ga0268265_109802341 125
272 3300031548 Ga0307408_100000709 Ga0307408_10000070911 125
273 3300031548 Ga0307408_100200611 Ga0307408_1002006112 125
274 3300032002 Ga0307416_100424559 Ga0307416_1004245592 125
275 3300032005 Ga0307411_10780488 Ga0307411_107804881 125
276 3300037471 Ga0395905_0872202 Ga0395905_0872202_371_748 125
277 3300042145 Ga0450906_038628 Ga0450906_038628_88_471 125
278 3300046460 Ga0495638_0031283 Ga0495638_0031283_1715_2092 125
279 3300046471 Ga0495650_0154073 Ga0495650_0154073_25_402 125
280 3300046474 Ga0495605_0043322 Ga0495605_0043322_374_751 125
281 3300046491 Ga0495584_0023941 Ga0495584_0023941_1666_2043 125
282 3300046501 Ga0495607_0006030 Ga0495607_0006030_4894_5271 125
283 3300046506 Ga0495583_0004976 Ga0495583_0004976_5430_5807 125
284 3300046507 Ga0495606_0005790 Ga0495606_0005790_1783_2160 125
285 3300046513 Ga0495616_0002707 Ga0495616_0002707_4555_4932 125
286 3300046522 Ga0495643_0041635 Ga0495643_0041635_626_1003 125
287 3300046524 Ga0495648_0205353 Ga0495648_0205353_534_911 125
288 3300046538 Ga0495609_0001170 Ga0495609_0001170_14562_14939 125
289 3300046538 Ga0495609_0005105 Ga0495609_0005105_3186_3563 125
290 3300046616 Ga0495668_0000330 Ga0495668_0000330_15223_15600 125
291 3300046616 Ga0495668_0014307 Ga0495668_0014307_3386_3763 125
292 3300046660 Ga0495625_0003568 Ga0495625_0003568_6551_6928 125
293 3300046664 Ga0495659_0000829 Ga0495659_0000829_6431_6808 125
294 3300046665 Ga0495661_0026411 Ga0495661_0026411_1791_2168 125
295 3300046674 Ga0495588_0069844 Ga0495588_0069844_519_896 125
296 3300046684 Ga0495669_0009011 Ga0495669_0009011_2751_3128 125
297 3300046692 Ga0495671_0066155 Ga0495671_0066155_1080_1457 125
298 3300046694 Ga0495649_0006524 Ga0495649_0006524_4762_5139 125
299 3300046810 Ga0495660_0001360 Ga0495660_0001360_3172_3549 125
300 3300047318 Ga0495636_0001011 Ga0495636_0001011_6355_6732 125
301 3300047443 Ga0495687_086268 Ga0495687_086268_387_764 125
302 3300047445 Ga0495677_0000605 Ga0495677_0000605_6908_7285 125
303 3300047446 Ga0495679_045446 Ga0495679_045446_824_1201 125
304 3300047447 Ga0495685_001094 Ga0495685_001094_6996_7373 125
305 3300047472 Ga0495686_0007324 Ga0495686_0007324_1949_2326 125
306 3300048903 Ga0496100_0291217 Ga0496100_0291217_405_782 125
307 3300048907 Ga0496104_0054128 Ga0496104_0054128_2151_2531 125
308 3300048912 Ga0496109_1537588 Ga0496109_1537588_201_578 125
309 3300048927 Ga0496124_0076905 Ga0496124_0076905_366_743 125
310 3300049127 Ga0501306_006991 Ga0501306_006991_12_389 125
311 3300049130 Ga0501310_056401 Ga0501310_056401_93_470 125
312 3300049459 Ga0495678_000001 Ga0495678_000001_14687_15064 125
313 3300049460 Ga0495682_0201355 Ga0495682_0201355_217_594 125
314 3300049665 Ga0501227_005429 Ga0501227_005429_1798_2175 125
315 3300049775 Ga0501279_002590 Ga0501279_002590_1849_2226 125
316 3300002739 JGI25158J39367_1000592 JGI25158J39367_10005924 126
317 3300002739 JGI25158J39367_1001545 JGI25158J39367_10015453 126
318 3300002773 JGI25152J39213_1000193 JGI25152J39213_100019326 126
319 3300002774 JGI25150J39212_1000878 JGI25150J39212_10008784 126
320 3300002774 JGI25150J39212_1000921 JGI25150J39212_100092111 126
321 3300002774 JGI25150J39212_1040638 JGI25150J39212_10406382 126
322 3300002987 JGI25159J45721_1001446 JGI25159J45721_10014467 126
323 3300002987 JGI25159J45721_1026431 JGI25159J45721_10264312 126
324 3300002987 JGI25159J45721_1026435 JGI25159J45721_10264352 126
325 3300003215 JGI25153J46596_10003821 JGI25153J46596_100038215 126
326 3300003354 JGI25160J50197_1033484 JGI25160J50197_10334842 126
327 3300003354 JGI25160J50197_1044591 JGI25160J50197_10445912 126
328 3300003374 JGI25161J50226_1001625 JGI25161J50226_10016253 126
329 3300003374 JGI25161J50226_1012704 JGI25161J50226_10127042 126
330 3300003374 JGI25161J50226_1012706 JGI25161J50226_10127062 126
331 3300003775 Ga0055524_1000643 Ga0055524_10006435 126
332 3300003775 Ga0055524_1054369 Ga0055524_10543692 126
333 3300003775 Ga0055524_1059183 Ga0055524_10591832 126
334 3300003775 Ga0055524_1060596 Ga0055524_10605962 126
335 3300003784 Ga0055534_1006171 Ga0055534_10061714 126
336 3300003791 Ga0055530_10003841 Ga0055530_100038413 126
337 3300003791 Ga0055530_10006135 Ga0055530_100061353 126
338 3300003791 Ga0055530_10009401 Ga0055530_100094013 126
339 3300003794 Ga0055531_10000957 Ga0055531_100009576 126
340 3300003794 Ga0055531_10039092 Ga0055531_100390922 126
341 3300004625 Ga0055543_1000252 Ga0055543_10002529 126
342 3300004625 Ga0055543_1026155 Ga0055543_10261552 126
343 3300005262 Ga0065165_1006099 Ga0065165_10060995 126
344 3300005262 Ga0065165_1048162 Ga0065165_10481622 126
345 3300005262 Ga0065165_1060579 Ga0065165_10605792 126
346 3300009148 Ga0105243_12198368 Ga0105243_121983682 126
347 3300025208 Ga0209436_100676 Ga0209436_1006769 126
348 3300025208 Ga0209436_121355 Ga0209436_1213552 126
349 3300025208 Ga0209436_121356 Ga0209436_1213562 126
350 3300025245 Ga0207425_1000017 Ga0207425_1000017384 126
351 3300025245 Ga0207425_1000207 Ga0207425_100020733 126
352 3300025245 Ga0207425_1010170 Ga0207425_10101703 126
353 3300025258 Ga0209129_1000039 Ga0209129_100003915 126
354 3300025258 Ga0209129_1000911 Ga0209129_100091112 126
355 3300025263 Ga0209565_1001439 Ga0209565_10014396 126
356 3300025263 Ga0209565_1002891 Ga0209565_10028915 126
357 3300025263 Ga0209565_1004732 Ga0209565_10047323 126
358 3300025263 Ga0209565_1016203 Ga0209565_10162033 126
359 3300025273 Ga0209673_1059082 Ga0209673_10590822 126
360 3300025284 Ga0209130_1000491 Ga0209130_100049130 126
361 3300025284 Ga0209130_1032943 Ga0209130_10329432 126
362 3300025284 Ga0209130_1032961 Ga0209130_10329612 126
363 3300025291 Ga0209675_1001374 Ga0209675_100137416 126
364 3300025291 Ga0209675_1039098 Ga0209675_10390982 126
365 3300025291 Ga0209675_1094506 Ga0209675_10945062 126
366 3300025295 Ga0209564_1048881 Ga0209564_10488812 126
367 3300025297 Ga0209758_1000192 Ga0209758_100019215 126
368 3300025298 Ga0209050_1000762 Ga0209050_100076226 126
369 3300025298 Ga0209050_1001013 Ga0209050_10010135 126
370 3300025298 Ga0209050_1004491 Ga0209050_10044917 126
371 3300025299 Ga0209256_1000651 Ga0209256_100065126 126
372 3300025299 Ga0209256_1003328 Ga0209256_10033287 126
373 3300025302 Ga0207426_1002755 Ga0207426_10027552 126
374 3300025302 Ga0207426_1024519 Ga0207426_10245192 126
375 3300025304 Ga0209257_1000501 Ga0209257_10005019 126
376 3300025304 Ga0209257_1012545 Ga0209257_10125452 126
377 3300031548 Ga0307408_100005211 Ga0307408_1000052115 126
378 3300031548 Ga0307408_100010861 Ga0307408_1000108612 126
379 3300031838 Ga0307518_10087050 Ga0307518_100870501 126
380 3300031911 Ga0307412_10259812 Ga0307412_102598122 126
381 3300032002 Ga0307416_100004538 Ga0307416_1000045387 126
382 3300037471 Ga0395905_0522720 Ga0395905_0522720_13_393 126
383 3300044669 Ga0466981_0516460 Ga0466981_0516460_259_639 126
384 3300044765 Ga0466970_0037093 Ga0466970_0037093_1236_1616 126
385 3300046501 Ga0495607_0041408 Ga0495607_0041408_1663_2064 126
386 3300046507 Ga0495606_0128295 Ga0495606_0128295_489_890 126
387 3300046538 Ga0495609_0010200 Ga0495609_0010200_2937_3338 126
388 3300046539 Ga0495621_0002057 Ga0495621_0002057_2259_2639 126
389 3300046660 Ga0495625_0433027 Ga0495625_0433027_208_609 126
390 3300046660 Ga0495625_0627060 Ga0495625_0627060_56_442 126
391 3300046810 Ga0495660_0004559 Ga0495660_0004559_4747_5148 126
392 3300047472 Ga0495686_0014990 Ga0495686_0014990_4093_4494 126
393 3300048903 Ga0496100_0151409 Ga0496100_0151409_452_832 126
394 3300048904 Ga0496101_0041098 Ga0496101_0041098_1192_1572 126
395 3300048907 Ga0496104_0202915 Ga0496104_0202915_62_442 126
396 3300048908 Ga0496105_0227134 Ga0496105_0227134_68_448 126
397 3300048909 Ga0496106_0098362 Ga0496106_0098362_1558_1938 126
398 3300048911 Ga0496108_0035020 Ga0496108_0035020_1769_2149 126
399 3300048912 Ga0496109_0261985 Ga0496109_0261985_1063_1443 126
400 3300048913 Ga0496110_0385314 Ga0496110_0385314_555_950 126
401 3300048913 Ga0496110_1114695 Ga0496110_1114695_27_407 126
402 3300048913 Ga0496110_1126439 Ga0496110_1126439_47_427 126
403 3300048914 Ga0496111_0150857 Ga0496111_0150857_1299_1685 126
404 3300048917 Ga0496114_0657089 Ga0496114_0657089_19_399 126
405 3300048917 Ga0496114_1579978 Ga0496114_1579978_154_534 126
406 iso_pu_bacteria 2600255292 2601669691 126
407 iso_pu_bacteria 2932410948 2932415893 126
408 iso_pu_bacteria 2932416698 2932421883 126
409 3300005459 Ga0068867_101280412 Ga0068867_1012804121 127
410 3300047472 Ga0495686_0001924 Ga0495686_0001924_12938_13321 127
411 3300003771 Ga0055526_1000060 Ga0055526_100006018 128
412 3300005288 Ga0065714_10101263 Ga0065714_101012631 128
413 3300009036 Ga0105244_10002851 Ga0105244_100028518 128
414 3300014497 Ga0182008_10000724 Ga0182008_1000072417 128
415 3300015261 Ga0182006_1000004 Ga0182006_1000004539 128
416 3300015262 Ga0182007_10000017 Ga0182007_10000017162 128
417 3300015265 Ga0182005_1000030 Ga0182005_100003016 128
418 3300017792 Ga0163161_10046467 Ga0163161_100464672 128
419 3300025295 Ga0209564_1000141 Ga0209564_1000141146 128
420 3300025728 Ga0207655_1029944 Ga0207655_10299442 128
421 3300032004 Ga0307414_10068237 Ga0307414_100682373 128
422 3300046452 Ga0495617_002280 Ga0495617_002280_2630_3016 128
423 3300046471 Ga0495650_0006359 Ga0495650_0006359_3308_3697 128
424 3300046471 Ga0495650_0010363 Ga0495650_0010363_3265_3651 128
425 3300046507 Ga0495606_0000077 Ga0495606_0000077_150816_151205 128
426 3300046507 Ga0495606_0008415 Ga0495606_0008415_5236_5622 128
427 3300046512 Ga0495610_0002303 Ga0495610_0002303_9575_9964 128
428 3300046520 Ga0495637_0003796 Ga0495637_0003796_4240_4626 128
429 3300046520 Ga0495637_0005114 Ga0495637_0005114_3185_3571 128
430 3300046530 Ga0495654_0000233 Ga0495654_0000233_14786_15172 128
431 3300046530 Ga0495654_0020169 Ga0495654_0020169_215_622 128
432 3300046557 Ga0495622_0224483 Ga0495622_0224483_237_644 128
433 3300046558 Ga0495633_0007259 Ga0495633_0007259_3317_3724 128
434 3300046558 Ga0495633_0024293 Ga0495633_0024293_314_703 128
435 3300046558 Ga0495633_0147165 Ga0495633_0147165_15_404 128
436 3300046616 Ga0495668_0000064 Ga0495668_0000064_172627_173016 128
437 3300046616 Ga0495668_0006552 Ga0495668_0006552_3298_3687 128
438 3300046692 Ga0495671_0065292 Ga0495671_0065292_102_488 128
439 3300046694 Ga0495649_0067524 Ga0495649_0067524_1274_1660 128
440 3300047469 Ga0495673_0000085 Ga0495673_0000085_15735_16124 128
441 3300047469 Ga0495673_0000522 Ga0495673_0000522_24023_24409 128
442 3300047469 Ga0495673_0266590 Ga0495673_0266590_89_475 128
443 3300047470 Ga0495681_0261937 Ga0495681_0261937_216_605 128
444 3300047472 Ga0495686_0008480 Ga0495686_0008480_5728_6117 128
445 3300047472 Ga0495686_0388865 Ga0495686_0388865_229_615 128
446 3300048090 Ga0495615_0009612 Ga0495615_0009612_1046_1432 128
447 3300048914 Ga0496111_0009665 Ga0496111_0009665_2871_3278 128
448 3300048919 Ga0496116_0051421 Ga0496116_0051421_393_800 128
449 3300048920 Ga0496117_0000011 Ga0496117_0000011_594674_595081 128
450 3300048921 Ga0496118_0000010 Ga0496118_0000010_15850_16257 128
451 3300048924 Ga0496121_0006064 Ga0496121_0006064_11289_11696 128
452 3300048924 Ga0496121_0008022 Ga0496121_0008022_9751_10158 128
453 3300048925 Ga0496122_0002864 Ga0496122_0002864_18735_19142 128
454 3300048926 Ga0496123_0049429 Ga0496123_0049429_79_486 128
455 3300048927 Ga0496124_0214097 Ga0496124_0214097_113_520 128
456 3300048927 Ga0496124_0241912 Ga0496124_0241912_656_1045 128
457 3300048928 Ga0496125_0038675 Ga0496125_0038675_632_1039 128
458 3300048928 Ga0496125_0263728 Ga0496125_0263728_612_1001 128
459 3300048929 Ga0496126_0159763 Ga0496126_0159763_1442_1831 128
460 3300048929 Ga0496126_0608381 Ga0496126_0608381_211_618 128
461 3300049460 Ga0495682_0003670 Ga0495682_0003670_3220_3627 128
462 3300053118 Ga0500594_0047721 Ga0500594_0047721_533_919 128
463 3300053125 Ga0500618_000776 Ga0500618_000776_1488_1874 128
464 3300002738 JGI25154J39366_1000304 JGI25154J39366_10003048 129
465 3300003322 rootL2_10083590 rootL2_100835902 129
466 3300003322 rootL2_10083591 rootL2_100835914 129
467 3300003763 Ga0055529_1000342 Ga0055529_100034221 129
468 3300003771 Ga0055526_1000010 Ga0055526_100001017 129
469 3300009036 Ga0105244_10000745 Ga0105244_1000074514 129
470 3300025233 Ga0209437_103987 Ga0209437_1039872 129
471 3300025246 Ga0209646_1000036 Ga0209646_100003619 129
472 3300025272 Ga0209455_1000047 Ga0209455_1000047330 129
473 3300025295 Ga0209564_1000060 Ga0209564_1000060272 129
474 3300025728 Ga0207655_1006610 Ga0207655_10066102 129
475 3300028794 Ga0307515_10476283 Ga0307515_104762832 129
476 3300039447 Ga0436361_0845374 Ga0436361_0845374_3402_3815 129
477 3300046452 Ga0495617_005103 Ga0495617_005103_2061_2453 129
478 3300046452 Ga0495617_288935 Ga0495617_288935_17_409 129
479 3300046457 Ga0495590_0015031 Ga0495590_0015031_1284_1676 129
480 3300046460 Ga0495638_0015115 Ga0495638_0015115_3216_3608 129
481 3300046474 Ga0495605_0009464 Ga0495605_0009464_124_516 129
482 3300046491 Ga0495584_0004037 Ga0495584_0004037_3422_3814 129
483 3300046491 Ga0495584_0241494 Ga0495584_0241494_445_837 129
484 3300046492 Ga0495585_0036188 Ga0495585_0036188_2144_2536 129
485 3300046501 Ga0495607_0004090 Ga0495607_0004090_3119_3538 129
486 3300046501 Ga0495607_0113829 Ga0495607_0113829_305_697 129
487 3300046501 Ga0495607_0229501 Ga0495607_0229501_207_599 129
488 3300046506 Ga0495583_0000228 Ga0495583_0000228_77725_78117 129
489 3300046507 Ga0495606_0001807 Ga0495606_0001807_15821_16225 129
490 3300046507 Ga0495606_0003880 Ga0495606_0003880_4388_4804 129
491 3300046507 Ga0495606_0010503 Ga0495606_0010503_2336_2728 129
492 3300046512 Ga0495610_0008294 Ga0495610_0008294_94_486 129
493 3300046512 Ga0495610_0012214 Ga0495610_0012214_2889_3290 129
494 3300046512 Ga0495610_0015722 Ga0495610_0015722_1183_1575 129
495 3300046512 Ga0495610_0016219 Ga0495610_0016219_3498_3887 129
496 3300046512 Ga0495610_0032672 Ga0495610_0032672_2265_2654 129
497 3300046512 Ga0495610_0204796 Ga0495610_0204796_104_529 129
498 3300046513 Ga0495616_0002449 Ga0495616_0002449_10034_10426 129
499 3300046513 Ga0495616_0007325 Ga0495616_0007325_1454_1846 129
500 3300046522 Ga0495643_0000576 Ga0495643_0000576_34755_35144 129
501 3300046523 Ga0495644_0001721 Ga0495644_0001721_2443_2835 129
502 3300046523 Ga0495644_0004311 Ga0495644_0004311_1456_1848 129
503 3300046524 Ga0495648_0002442 Ga0495648_0002442_11850_12242 129
504 3300046524 Ga0495648_0031143 Ga0495648_0031143_1497_1886 129
505 3300046538 Ga0495609_0001426 Ga0495609_0001426_4316_4708 129
506 3300046538 Ga0495609_0019685 Ga0495609_0019685_2645_3046 129
507 3300046538 Ga0495609_0086654 Ga0495609_0086654_464_853 129
508 3300046558 Ga0495633_0004862 Ga0495633_0004862_4736_5125 129
509 3300046558 Ga0495633_0006099 Ga0495633_0006099_4622_5014 129
510 3300046615 Ga0495656_0020290 Ga0495656_0020290_2076_2468 129
511 3300046648 Ga0495611_0034719 Ga0495611_0034719_113_505 129
512 3300046648 Ga0495611_0113226 Ga0495611_0113226_759_1151 129
513 3300046648 Ga0495611_0446565 Ga0495611_0446565_95_487 129
514 3300046660 Ga0495625_0002821 Ga0495625_0002821_10610_11002 129
515 3300046660 Ga0495625_0012993 Ga0495625_0012993_2360_2749 129
516 3300046664 Ga0495659_0001900 Ga0495659_0001900_4795_5187 129
517 3300046665 Ga0495661_0192129 Ga0495661_0192129_451_843 129
518 3300046665 Ga0495661_0288320 Ga0495661_0288320_23_415 129
519 3300046691 Ga0495670_0005000 Ga0495670_0005000_1465_1857 129
520 3300046691 Ga0495670_0056958 Ga0495670_0056958_1465_1857 129
521 3300046692 Ga0495671_0017226 Ga0495671_0017226_57_449 129
522 3300046692 Ga0495671_0178322 Ga0495671_0178322_282_671 129
523 3300046694 Ga0495649_0015661 Ga0495649_0015661_3159_3548 129
524 3300047318 Ga0495636_0000384 Ga0495636_0000384_10874_11266 129
525 3300047320 Ga0495672_0000883 Ga0495672_0000883_15990_16379 129
526 3300047320 Ga0495672_0007539 Ga0495672_0007539_6340_6732 129
527 3300047323 Ga0495683_0000641 Ga0495683_0000641_15805_16197 129
528 3300047443 Ga0495687_001058 Ga0495687_001058_12906_13298 129
529 3300047445 Ga0495677_0028442 Ga0495677_0028442_1431_1823 129
530 3300047446 Ga0495679_111092 Ga0495679_111092_326_718 129
531 3300047447 Ga0495685_000089 Ga0495685_000089_15808_16200 129
532 3300047469 Ga0495673_0006016 Ga0495673_0006016_4162_4554 129
533 3300049459 Ga0495678_000454 Ga0495678_000454_32600_32989 129
534 3300049459 Ga0495678_001731 Ga0495678_001731_10318_10710 129
535 3300049460 Ga0495682_0007321 Ga0495682_0007321_57_449 129
536 3300053122 Ga0500608_206184 Ga0500608_206184_111_506 129
537 3300053125 Ga0500618_114208 Ga0500618_114208_109_510 129
538 3300053145 Ga0500586_000447 Ga0500586_000447_4681_5070 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01903

CbiX

CbiX

19

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lyh-assembly1.cif.gz_A crystal structure of putative cobalamin (vitamin b12) biosynthesis cbix protein (yp_958415.1) from marinobacter aquaeolei vt8 at 1.60 a resolution 0.8496 4 125
3lyh-assembly1.cif.gz_B crystal structure of putative cobalamin (vitamin b12) biosynthesis cbix protein (yp_958415.1) from marinobacter aquaeolei vt8 at 1.60 a resolution 0.8445 4 123
3lyh-assembly1.cif.gz_A crystal structure of putative cobalamin (vitamin b12) biosynthesis cbix protein (yp_958415.1) from marinobacter aquaeolei vt8 at 1.60 a resolution 0.8372 4 125
6jv6-assembly1.cif.gz_A crystal structure of the sirohydrochlorin chelatase sirb from bacillus subtilis subspecies spizizenii in complex with cobalt 0.8235 4 116
3lyh-assembly1.cif.gz_B crystal structure of putative cobalamin (vitamin b12) biosynthesis cbix protein (yp_958415.1) from marinobacter aquaeolei vt8 at 1.60 a resolution 0.8022 4 123
ID Description Score Start End Superfamily
3lyhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8462 4 125 3.40.50.1400
3lyhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8339 4 125 3.40.50.1400
af_I1K1J6_70_192_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8117 4 123 3.40.50.1400
af_I1K1J6_70_192_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7891 4 123 3.40.50.1400
af_P71751_45_156_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7836 4 119 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A223PC64-F1-model_v4 Cobalamin biosynthesis protein CbiX 0.9653 3 122 GO:0016829
GO:0046872
AF-A0A6N9SUT1-F1-model_v4 Cobalamin biosynthesis protein CbiX 0.9629 4 121 GO:0016829
GO:0046872
AF-F6FZP8-F1-model_v4 Sirohydrochlorin cobaltochelatase, cobalamin (Vitamin b12) biosynthesis anaerobic pathway 0.9626 2 122 GO:0016829
GO:0046872
AF-A0A653NJU8-F1-model_v4 Sirohydrochlorin cobaltochelatase (EC 4.99.1.3) 0.9617 3 122 GO:0016852
GO:0046872
AF-A0A127PVD5-F1-model_v4 CbiX family protein 0.9604 2 120 GO:0016829
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.98 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map