F460994

General Info

Members Datasets Scaffolds Average Seq Length
538 311 1076 95

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100156712|Ga0075363_1001567122
Length 84
Sequence MSYVWIAAAVMLTIAAGVTMIRLLAGPSTLDRLVALDTLVAVTMCGIVTYSMAALALISFVGSVSVARFRVPDIDTSGSDGRRP

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
191 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
192 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
304 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
309 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
310 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
311 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.96
Nodule 0.19
Rhizoplane 12.27
Rhizosphere 63.38
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100156712 3300006048 Bacteria 1287
2 JGI24739J22299_10248656 3300001989 Bacteria 521
3 JGI24737J22298_10067104 3300001990 Bacteria 1074
4 JGI24745J21846_1010110 3300002073 Bacteria 1072
5 JGI24748J21848_1059398 3300002074 Bacteria 509
6 JGI24744J21845_10010654 3300002077 Bacteria 1882
7 Ga0055540_1001186 3300003792 Bacteria 16069
8 Ga0055540_1006526 3300003792 Bacteria 4609
9 Ga0070658_11964641 3300005327 Bacteria 505
10 Ga0068869_100083254 3300005334 Bacteria 2392
11 Ga0070666_10470947 3300005335 Bacteria 909
12 Ga0070682_100054901 3300005337 Bacteria 2501
13 Ga0070682_100227400 3300005337 Bacteria 1332
14 Ga0070682_100276736 3300005337 Bacteria 1222
15 Ga0070682_101075240 3300005337 Bacteria 672
16 Ga0068868_100062658 3300005338 Bacteria 2948
17 Ga0068868_100636734 3300005338 Bacteria 948
18 Ga0070689_100515712 3300005340 Bacteria 1026
19 Ga0070691_10337624 3300005341 Bacteria 833
20 Ga0070692_10285853 3300005345 Bacteria 1001
21 Ga0070692_10361579 3300005345 Bacteria 905
22 Ga0070668_100001160 3300005347 Bacteria 18599
23 Ga0070668_100139258 3300005347 Bacteria 1954
24 Ga0070668_100414429 3300005347 Bacteria 1152
25 Ga0070668_101266421 3300005347 Bacteria 670
26 Ga0070669_100230239 3300005353 Bacteria 1469
27 Ga0070675_100256725 3300005354 Bacteria 1531
28 Ga0070675_100679130 3300005354 Bacteria 937
29 Ga0070671_100882159 3300005355 Bacteria 781
30 Ga0070674_100090684 3300005356 Bacteria 2205
31 Ga0070674_100443185 3300005356 Bacteria 1070
32 Ga0070673_100216343 3300005364 Bacteria 1656
33 Ga0070659_100178576 3300005366 Bacteria 1741
34 Ga0070667_100915676 3300005367 Bacteria 816
35 Ga0070709_10010360 3300005434 Bacteria 5160
36 Ga0070710_11166624 3300005437 Bacteria 568
37 Ga0070701_10238934 3300005438 Bacteria 1092
38 Ga0070711_100004765 3300005439 Bacteria 8038
39 Ga0070711_100346422 3300005439 Bacteria 1193
40 Ga0070705_101587501 3300005440 Bacteria 550
41 Ga0070700_100427149 3300005441 Bacteria 1003
42 Ga0070708_101412794 3300005445 Bacteria 649
43 Ga0070663_100274836 3300005455 Bacteria 1341
44 Ga0070678_100197018 3300005456 Bacteria 1660
45 Ga0070678_100200778 3300005456 Bacteria 1646
46 Ga0070678_100835650 3300005456 Bacteria 838
47 Ga0070662_100157609 3300005457 Bacteria 1773
48 Ga0070662_100504015 3300005457 Bacteria 1010
49 Ga0068867_101498211 3300005459 Bacteria 628
50 Ga0070685_10291050 3300005466 Bacteria 1097
51 Ga0070685_10499839 3300005466 Bacteria 860
52 Ga0070685_11428447 3300005466 Bacteria 531
53 Ga0068853_100050450 3300005539 Bacteria 3580
54 Ga0068853_100132387 3300005539 Bacteria 2234
55 Ga0070672_100419988 3300005543 Bacteria 1149
56 Ga0070672_101554529 3300005543 Bacteria 593
57 Ga0070686_100466004 3300005544 Bacteria 974
58 Ga0070686_100502145 3300005544 Bacteria 941
59 Ga0070686_101829475 3300005544 Bacteria 517
60 Ga0070696_100097839 3300005546 Bacteria 2098
61 Ga0070693_100342560 3300005547 Bacteria 1021
62 Ga0070693_100822543 3300005547 Bacteria 690
63 Ga0070665_100078955 3300005548 Bacteria 3298
64 Ga0070665_101064051 3300005548 Bacteria 821
65 Ga0070665_101080436 3300005548 Bacteria 814
66 Ga0070704_100600363 3300005549 Bacteria 967
67 Ga0068855_100512217 3300005563 Bacteria 1303
68 Ga0068857_102259046 3300005577 Bacteria 534
69 Ga0068854_100163394 3300005578 Bacteria 1726
70 Ga0068854_100343880 3300005578 Bacteria 1219
71 Ga0068856_101851035 3300005614 Bacteria 615
72 Ga0070702_100005931 3300005615 Bacteria 5740
73 Ga0070702_100083398 3300005615 Bacteria 1920
74 Ga0070702_100475676 3300005615 Bacteria 912
75 Ga0070702_100645376 3300005615 Bacteria 800
76 Ga0070702_100842632 3300005615 Bacteria 713
77 Ga0068852_100773350 3300005616 Bacteria 973
78 Ga0068859_102127084 3300005617 Bacteria 619
79 Ga0068864_100102501 3300005618 Bacteria 2540
80 Ga0068866_10883041 3300005718 Bacteria 627
81 Ga0068861_100015271 3300005719 Bacteria 5407
82 Ga0068861_100227280 3300005719 Bacteria 1581
83 Ga0068851_10241918 3300005834 Bacteria 1021
84 Ga0068863_100043518 3300005841 Bacteria 4262
85 Ga0068863_100070873 3300005841 Bacteria 3297
86 Ga0068863_102395399 3300005841 Bacteria 537
87 Ga0068858_100187221 3300005842 Bacteria 1955
88 Ga0068858_100361538 3300005842 Bacteria 1391
89 Ga0068858_102387013 3300005842 Bacteria 523
90 Ga0068860_100245696 3300005843 Bacteria 1741
91 Ga0068862_100435503 3300005844 Bacteria 1233
92 Ga0068862_100532595 3300005844 Bacteria 1119
93 Ga0068862_102296375 3300005844 Bacteria 551
94 Ga0081538_10138763 3300005981 Bacteria 1126
95 Ga0075365_10016337 3300006038 Bacteria 4513
96 Ga0075365_10091668 3300006038 Bacteria 2071
97 Ga0075365_10224853 3300006038 Bacteria 1317
98 Ga0075365_10494942 3300006038 Bacteria 864
99 Ga0075368_10004632 3300006042 Bacteria 4677
100 Ga0075368_10346699 3300006042 Bacteria 646
101 Ga0075363_100001192 3300006048 Bacteria 9588
102 Ga0075363_100074712 3300006048 Bacteria 1846
103 Ga0075363_100146743 3300006048 Bacteria 1330
104 Ga0075363_100157342 3300006048 Bacteria 1285
105 Ga0075363_100161770 3300006048 Bacteria 1268
106 Ga0075363_100182023 3300006048 Bacteria 1196
107 Ga0075363_100200909 3300006048 Bacteria 1139
108 Ga0075363_100280108 3300006048 Bacteria 964
109 Ga0075363_100948846 3300006048 Bacteria 528
110 Ga0075364_10006077 3300006051 Bacteria 7073
111 Ga0075364_10006335 3300006051 Bacteria 6953
112 Ga0075364_10019219 3300006051 Bacteria 4286
113 Ga0075364_10051389 3300006051 Bacteria 2692
114 Ga0075364_10071277 3300006051 Bacteria 2289
115 Ga0075364_10074355 3300006051 Bacteria 2240
116 Ga0075364_10325872 3300006051 Bacteria 1046
117 Ga0075364_10509895 3300006051 Bacteria 822
118 Ga0075364_10536422 3300006051 Bacteria 800
119 Ga0075364_10540369 3300006051 Bacteria 797
120 Ga0075364_10937467 3300006051 Bacteria 589
121 Ga0070716_100429667 3300006173 Bacteria 957
122 Ga0075362_10029626 3300006177 Bacteria 2360
123 Ga0075362_10744201 3300006177 Bacteria 513
124 Ga0075367_10003749 3300006178 Bacteria 7316
125 Ga0075367_10125990 3300006178 Bacteria 1581
126 Ga0075367_10591185 3300006178 Bacteria 705
127 Ga0075369_10001300 3300006186 Bacteria 8491
128 Ga0075369_10010812 3300006186 Bacteria 3576
129 Ga0075369_10025158 3300006186 Bacteria 2473
130 Ga0075369_10068171 3300006186 Bacteria 1563
131 Ga0075369_10194870 3300006186 Bacteria 934
132 Ga0075369_10411536 3300006186 Bacteria 638
133 Ga0075366_10063401 3300006195 Bacteria 2197
134 Ga0097621_100283547 3300006237 Bacteria 1459
135 Ga0097621_100374744 3300006237 Bacteria 1270
136 Ga0075370_10013896 3300006353 Bacteria 4285
137 Ga0075370_10196011 3300006353 Bacteria 1191
138 Ga0075370_10370244 3300006353 Bacteria 857
139 Ga0075370_10640517 3300006353 Bacteria 645
140 Ga0068871_101289943 3300006358 Bacteria 687
141 Ga0068871_101875607 3300006358 Bacteria 570
142 Ga0075428_100004705 3300006844 Bacteria 15104
143 Ga0075430_100041252 3300006846 Bacteria 3905
144 Ga0075431_100195686 3300006847 Bacteria 2070
145 Ga0068865_101523782 3300006881 Bacteria 600
146 Ga0075436_100882908 3300006914 Bacteria 668
147 Ga0097620_102127000 3300006931 Bacteria 619
148 Ga0075435_100551490 3300007076 Bacteria 998
149 Ga0099795_10498333 3300007788 Bacteria 567
150 Ga0105250_10094907 3300009092 Bacteria 1215
151 Ga0111539_11191282 3300009094 Bacteria 885
152 Ga0105245_10039100 3300009098 Bacteria 4222
153 Ga0105245_12765040 3300009098 Bacteria 543
154 Ga0105247_10171872 3300009101 Bacteria 1441
155 Ga0114129_10022080 3300009147 Bacteria 9031
156 Ga0105243_10065143 3300009148 Bacteria 2926
157 Ga0105243_10431222 3300009148 Bacteria 1232
158 Ga0105243_11005810 3300009148 Bacteria 837
159 Ga0105241_10643458 3300009174 Bacteria 962
160 Ga0105242_10017716 3300009176 Bacteria 5555
161 Ga0105242_11062912 3300009176 Bacteria 821
162 Ga0105248_10208928 3300009177 Bacteria 2199
163 Ga0105248_10639121 3300009177 Bacteria 1201
164 Ga0105248_10833230 3300009177 Bacteria 1041
165 Ga0105237_10004175 3300009545 Bacteria 16820
166 Ga0105237_10170082 3300009545 Bacteria 2179
167 Ga0105238_10518242 3300009551 Bacteria 1195
168 Ga0105249_11362782 3300009553 Bacteria 781
169 Ga0105249_11862975 3300009553 Bacteria 674
170 Ga0099796_10170641 3300010159 Bacteria 868
171 Ga0105239_10010498 3300010375 Bacteria 10352
172 Ga0105239_10142696 3300010375 Bacteria 2670
173 Ga0105239_10333968 3300010375 Bacteria 1710
174 Ga0105239_10463478 3300010375 Bacteria 1438
175 Ga0105246_10023624 3300011119 Bacteria 3980
176 Ga0105246_10315676 3300011119 Bacteria 1268
177 Ga0157373_10523177 3300013100 Bacteria 858
178 Ga0157370_11822827 3300013104 Bacteria 546
179 Ga0157369_12657539 3300013105 Bacteria 505
180 Ga0157374_10328701 3300013296 Bacteria 1516
181 Ga0157374_11789594 3300013296 Bacteria 640
182 Ga0157378_10177650 3300013297 Bacteria 2001
183 Ga0157378_12728098 3300013297 Bacteria 546
184 Ga0163162_10076054 3300013306 Bacteria 3419
185 Ga0163162_11446315 3300013306 Bacteria 782
186 Ga0163162_12634901 3300013306 Bacteria 579
187 Ga0157372_11938246 3300013307 Bacteria 677
188 Ga0157375_10036149 3300013308 Bacteria 4721
189 Ga0163163_10629352 3300014325 Bacteria 1136
190 Ga0163163_10785435 3300014325 Bacteria 1016
191 Ga0157380_11429729 3300014326 Bacteria 743
192 Ga0182008_10632610 3300014497 Bacteria 604
193 Ga0157377_10020475 3300014745 Bacteria 3467
194 Ga0157377_10516471 3300014745 Bacteria 838
195 Ga0157377_11216641 3300014745 Bacteria 584
196 Ga0157379_10638081 3300014968 Bacteria 996
197 Ga0157376_10777741 3300014969 Bacteria 968
198 Ga0163161_10090293 3300017792 Bacteria 2267
199 Ga0163161_10154755 3300017792 Bacteria 1745
200 Ga0213876_10554113 3300021384 Unclassified 612
201 Ga0209025_1114912 3300025294 Bacteria 817
202 Ga0209051_1001623 3300025303 Bacteria 18335
203 Ga0209051_1002089 3300025303 Bacteria 15055
204 Ga0209051_1020883 3300025303 Bacteria 2804
205 Ga0207696_1037893 3300025711 Bacteria 1425
206 Ga0207692_10071151 3300025898 Bacteria 1833
207 Ga0207642_10062782 3300025899 Bacteria 1735
208 Ga0207710_10056083 3300025900 Bacteria 1777
209 Ga0207710_10156969 3300025900 Bacteria 1106
210 Ga0207688_10000860 3300025901 Bacteria 15337
211 Ga0207688_10127002 3300025901 Bacteria 1492
212 Ga0207680_10952269 3300025903 Bacteria 615
213 Ga0207647_10077544 3300025904 Bacteria 1997
214 Ga0207699_10620542 3300025906 Bacteria 788
215 Ga0207645_10350730 3300025907 Bacteria 988
216 Ga0207671_10184756 3300025914 Bacteria 1624
217 Ga0207693_10003154 3300025915 Bacteria 14175
218 Ga0207663_10054496 3300025916 Bacteria 2504
219 Ga0207663_10575012 3300025916 Bacteria 883
220 Ga0207652_11092589 3300025921 Bacteria 698
221 Ga0207681_10948551 3300025923 Bacteria 721
222 Ga0207694_10437819 3300025924 Bacteria 1090
223 Ga0207650_11241236 3300025925 Bacteria 634
224 Ga0207659_10114593 3300025926 Bacteria 2055
225 Ga0207687_11150956 3300025927 Bacteria 667
226 Ga0207644_10985047 3300025931 Bacteria 707
227 Ga0207706_10056186 3300025933 Bacteria 3471
228 Ga0207706_10423652 3300025933 Bacteria 1153
229 Ga0207709_10502203 3300025935 Bacteria 947
230 Ga0207670_10468061 3300025936 Bacteria 1019
231 Ga0207669_10109197 3300025937 Bacteria 1849
232 Ga0207669_10449246 3300025937 Bacteria 1021
233 Ga0207691_10102701 3300025940 Bacteria 2550
234 Ga0207711_10256495 3300025941 Bacteria 1607
235 Ga0207711_10788549 3300025941 Bacteria 885
236 Ga0207689_10004263 3300025942 Bacteria 13006
237 Ga0207667_10442347 3300025949 Bacteria 1322
238 Ga0207651_10318550 3300025960 Bacteria 1299
239 Ga0207712_10051518 3300025961 Bacteria 2880
240 Ga0207668_10000470 3300025972 Bacteria 25320
241 Ga0207668_10149745 3300025972 Bacteria 1805
242 Ga0207668_10685592 3300025972 Bacteria 899
243 Ga0207640_11387520 3300025981 Bacteria 629
244 Ga0207658_10751593 3300025986 Bacteria 883
245 Ga0207677_10118769 3300026023 Bacteria 1984
246 Ga0207677_10122995 3300026023 Bacteria 1955
247 Ga0207677_11993074 3300026023 Bacteria 540
248 Ga0207703_10170818 3300026035 Bacteria 1912
249 Ga0207703_11367806 3300026035 Bacteria 681
250 Ga0207703_12231660 3300026035 Bacteria 523
251 Ga0207639_10061576 3300026041 Bacteria 2899
252 Ga0207678_10020820 3300026067 Bacteria 5748
253 Ga0207678_10091636 3300026067 Bacteria 2598
254 Ga0207708_10133215 3300026075 Bacteria 1945
255 Ga0207708_11075147 3300026075 Bacteria 701
256 Ga0207641_11149634 3300026088 Bacteria 775
257 Ga0207648_11157579 3300026089 Bacteria 726
258 Ga0207648_11271852 3300026089 Bacteria 691
259 Ga0207676_10187513 3300026095 Bacteria 1817
260 Ga0207676_10468277 3300026095 Bacteria 1191
261 Ga0207675_100057805 3300026118 Bacteria 3619
262 Ga0207675_100214342 3300026118 Bacteria 1853
263 Ga0207683_10013704 3300026121 Bacteria 6912
264 Ga0207683_10263682 3300026121 Bacteria 1573
265 Ga0207683_10791274 3300026121 Bacteria 880
266 Ga0207698_10674535 3300026142 Bacteria 1026
267 Ga0209813_10001927 3300027866 Bacteria 4680
268 Ga0209813_10164486 3300027866 Bacteria 802
269 Ga0268266_10063151 3300028379 Bacteria 3197
270 Ga0268266_10273204 3300028379 Bacteria 1570
271 Ga0268265_10314896 3300028380 Bacteria 1414
272 Ga0268265_10946113 3300028380 Bacteria 848
273 Ga0268264_10104401 3300028381 Bacteria 2470
274 Ga0316578_10064501 3300031728 Bacteria 2162
275 Ga0307405_10315524 3300031731 Bacteria 1192
276 Ga0307413_10083981 3300031824 Bacteria 2051
277 Ga0307410_10028376 3300031852 Bacteria 3549
278 Ga0307410_10601779 3300031852 Bacteria 917
279 Ga0307406_10939885 3300031901 Bacteria 738
280 Ga0307407_10182108 3300031903 Bacteria 1393
281 Ga0307409_100011454 3300031995 Bacteria 5594
282 Ga0307409_101522997 3300031995 Bacteria 696
283 Ga0307416_100051301 3300032002 Bacteria 3294
284 Ga0307414_10199232 3300032004 Bacteria 1627
285 Ga0307411_10107313 3300032005 Bacteria 1989
286 Ga0307411_12245202 3300032005 Bacteria 512
287 Ga0307415_100114885 3300032126 Bacteria 2005
288 Ga0307415_100858945 3300032126 Bacteria 833
289 Ga0307415_102385129 3300032126 Bacteria 520
290 Ga0373948_0130712 3300034817 Bacteria 614
291 Ga0373940_0152737 3300035088 Bacteria 737
292 Ga0373952_0115804 3300035092 Bacteria 722
293 Ga0373946_0101334 3300035171 Bacteria 1292
294 Ga0316574_0506038 3300035398 Bacteria 753
295 Ga0373947_0364668 3300035725 Bacteria 971
296 Ga0373937_0309471 3300036401 Bacteria 1494
297 Ga0316584_0036867 3300036712 Bacteria 3630
298 Ga0436364_1215586 3300037853 Bacteria 29880
299 Ga0436365_0263911 3300039437 Bacteria 1425
300 Ga0436365_1917608 3300039437 Bacteria 867
301 Ga0436363_0863129 3300039450 Unclassified 525
302 Ga0439461_0001719 3300041410 Bacteria 3417
303 Ga0439461_0148670 3300041410 Bacteria 604
304 Ga0439466_0006524 3300041411 Bacteria 4432
305 Ga0439466_0078265 3300041411 Bacteria 1045
306 Ga0439465_0005708 3300041413 Bacteria 3961
307 Ga0439465_0022346 3300041413 Bacteria 1987
308 Ga0439465_0024114 3300041413 Bacteria 1917
309 Ga0451789_0730740 3300041443 Bacteria 602
310 Ga0451793_1634259 3300041452 Bacteria 1352
311 Ga0451795_1682992 3300041456 Bacteria 1694
312 Ga0451800_0835424 3300041459 Bacteria 501
313 Ga0451802_0339971 3300041460 Bacteria 684
314 Ga0451807_0751036 3300041486 Bacteria 851
315 Ga0451839_0475666 3300041496 Bacteria 560
316 Ga0451841_0513919 3300041498 Bacteria 756
317 Ga0451841_0703981 3300041498 Bacteria 745
318 Ga0451847_0306062 3300041503 Bacteria 1030
319 Ga0451851_0615997 3300041507 Bacteria 631
320 Ga0451853_2490044 3300041512 Bacteria 1531
321 Ga0451853_3162751 3300041512 Bacteria 664
322 Ga0439431_0034726 3300041997 Bacteria 1265
323 Ga0439442_005017 3300042002 Bacteria 2643
324 Ga0439442_049817 3300042002 Bacteria 883
325 Ga0439445_0014780 3300042004 Bacteria 1905
326 Ga0439448_0104214 3300042005 Bacteria 966
327 Ga0439459_0039539 3300042438 Bacteria 997
328 Ga0439459_0102765 3300042438 Bacteria 701
329 Ga0466972_0018715 3300044658 Bacteria 3463
330 Ga0466965_0003599 3300044683 Bacteria 6821
331 Ga0466965_0060127 3300044683 Bacteria 1897
332 Ga0466961_0035343 3300044693 Bacteria 3209
333 Ga0466963_0086884 3300044694 Bacteria 2126
334 Ga0466964_0411099 3300044706 Bacteria 709
335 Ga0466971_0017048 3300044719 Bacteria 3211
336 Ga0466968_0007820 3300044735 Bacteria 4079
337 Ga0466968_0127930 3300044735 Bacteria 1154
338 Ga0466970_0534103 3300044765 Bacteria 677
339 Ga0466957_0210347 3300044842 Bacteria 1280
340 Ga0466960_0000267 3300044901 Bacteria 17993
341 Ga0466960_0163890 3300044901 Bacteria 1195
342 Ga0466959_0052995 3300045049 Bacteria 2968
343 Ga0466959_0781510 3300045049 Bacteria 638
344 Ga0466967_0010373 3300045976 Bacteria 6985
345 Ga0466967_0048416 3300045976 Bacteria 3711
346 Ga0466967_0110015 3300045976 Bacteria 2530
347 Ga0466967_0652916 3300045976 Bacteria 1040
348 Ga0466967_0924117 3300045976 Bacteria 868
349 Ga0495617_218918 3300046452 Bacteria 592
350 Ga0495629_0111592 3300046459 Bacteria 1906
351 Ga0495638_0031715 3300046460 Bacteria 3393
352 Ga0495641_0044428 3300046461 Bacteria 2050
353 Ga0495651_0906770 3300046462 Bacteria 539
354 Ga0495594_0133470 3300046499 Bacteria 1406
355 Ga0495606_0289608 3300046507 Bacteria 892
356 Ga0495608_0170381 3300046511 Bacteria 1381
357 Ga0495620_0107474 3300046515 Bacteria 1108
358 Ga0495630_0345848 3300046517 Bacteria 1138
359 Ga0495632_0182289 3300046519 Bacteria 962
360 Ga0495637_0212192 3300046520 Bacteria 708
361 Ga0495666_0117524 3300046526 Bacteria 1246
362 Ga0495665_0043322 3300046531 Bacteria 2394
363 Ga0495622_0182065 3300046557 Bacteria 942
364 Ga0495667_0615068 3300046559 Bacteria 676
365 Ga0495668_0312379 3300046616 Bacteria 862
366 Ga0495634_0142640 3300046642 Bacteria 1520
367 Ga0495625_0184046 3300046660 Bacteria 1387
368 Ga0495635_0098395 3300046663 Bacteria 2000
369 Ga0495646_0240730 3300046680 Bacteria 972
370 Ga0495658_0046280 3300046683 Bacteria 2445
371 Ga0495613_0316417 3300046689 Bacteria 1078
372 Ga0495624_0138022 3300046690 Bacteria 1494
373 Ga0495671_0289592 3300046692 Bacteria 788
374 Ga0495671_0638942 3300046692 Bacteria 506
375 Ga0495589_0520128 3300046794 Bacteria 543
376 Ga0495581_0065044 3300047315 Bacteria 2108
377 Ga0495674_0033541 3300047319 Bacteria 4649
378 Ga0495672_0041528 3300047320 Bacteria 2781
379 Ga0495672_0339061 3300047320 Bacteria 701
380 Ga0495676_0189309 3300047321 Bacteria 1436
381 Ga0495686_0004017 3300047472 Bacteria 12306
382 Ga0495686_0138884 3300047472 Bacteria 1435
383 Ga0495593_0020522 3300047673 Bacteria 3701
384 Ga0495614_0132401 3300048089 Bacteria 1104
385 Ga0496100_0000996 3300048903 Bacteria 13644
386 Ga0496100_0204975 3300048903 Bacteria 1439
387 Ga0496100_0322161 3300048903 Bacteria 1161
388 Ga0496101_0000014 3300048904 Bacteria 253487
389 Ga0496101_0133599 3300048904 Bacteria 1886
390 Ga0496101_0258366 3300048904 Bacteria 1358
391 Ga0496101_0530933 3300048904 Bacteria 930
392 Ga0496101_0546752 3300048904 Bacteria 915
393 Ga0496101_0875798 3300048904 Bacteria 707
394 Ga0496101_0899551 3300048904 Bacteria 697
395 Ga0496102_0000041 3300048905 Bacteria 196634
396 Ga0496102_0010173 3300048905 Bacteria 8088
397 Ga0496102_0017446 3300048905 Bacteria 6289
398 Ga0496102_0262245 3300048905 Bacteria 1629
399 Ga0496102_0374096 3300048905 Bacteria 1341
400 Ga0496102_1041496 3300048905 Bacteria 738
401 Ga0496103_0000058 3300048906 Bacteria 141099
402 Ga0496103_0159318 3300048906 Bacteria 1447
403 Ga0496104_0062002 3300048907 Bacteria 3545
404 Ga0496104_0240134 3300048907 Bacteria 1724
405 Ga0496104_0241955 3300048907 Bacteria 1717
406 Ga0496105_0071232 3300048908 Bacteria 2873
407 Ga0496105_0404959 3300048908 Bacteria 1082
408 Ga0496106_0046205 3300048909 Bacteria 3272
409 Ga0496106_0055461 3300048909 Bacteria 2995
410 Ga0496106_0272314 3300048909 Bacteria 1356
411 Ga0496106_0566522 3300048909 Bacteria 911
412 Ga0496107_0004758 3300048910 Bacteria 9219
413 Ga0496107_0059423 3300048910 Bacteria 2767
414 Ga0496107_0286355 3300048910 Bacteria 1226
415 Ga0496107_0438471 3300048910 Bacteria 971
416 Ga0496108_0010201 3300048911 Bacteria 7628
417 Ga0496108_0015625 3300048911 Bacteria 6192
418 Ga0496108_0591702 3300048911 Bacteria 967
419 Ga0496108_0734757 3300048911 Bacteria 854
420 Ga0496109_0001155 3300048912 Bacteria 21963
421 Ga0496109_0006803 3300048912 Bacteria 9635
422 Ga0496109_0293132 3300048912 Bacteria 1534
423 Ga0496109_1270878 3300048912 Bacteria 672
424 Ga0496110_0151869 3300048913 Bacteria 2097
425 Ga0496110_0463547 3300048913 Bacteria 1155
426 Ga0496110_0727550 3300048913 Bacteria 895
427 Ga0496110_0984729 3300048913 Bacteria 750
428 Ga0496110_1070490 3300048913 Bacteria 714
429 Ga0496111_0112583 3300048914 Bacteria 2005
430 Ga0496112_0031047 3300048915 Bacteria 5178
431 Ga0496112_0185334 3300048915 Bacteria 2045
432 Ga0496112_0197255 3300048915 Bacteria 1973
433 Ga0496112_0230636 3300048915 Bacteria 1806
434 Ga0496112_0272283 3300048915 Bacteria 1641
435 Ga0496113_0009039 3300048916 Bacteria 6525
436 Ga0496113_0030038 3300048916 Bacteria 3931
437 Ga0496113_0105902 3300048916 Bacteria 2184
438 Ga0496114_0006522 3300048917 Bacteria 9195
439 Ga0496114_0313245 3300048917 Bacteria 1386
440 Ga0496114_0633033 3300048917 Bacteria 942
441 Ga0496114_1763092 3300048917 Bacteria 507
442 Ga0496115_0006734 3300048918 Bacteria 8426
443 Ga0496115_0237949 3300048918 Bacteria 1501
444 Ga0496115_1203600 3300048918 Bacteria 569
445 Ga0496116_0000098 3300048919 Bacteria 196497
446 Ga0496117_0000096 3300048920 Bacteria 196788
447 Ga0496118_0000073 3300048921 Bacteria 196712
448 Ga0496118_0147047 3300048921 Bacteria 1482
449 Ga0496121_0001389 3300048924 Bacteria 40961
450 Ga0496122_0061064 3300048925 Bacteria 2769
451 Ga0496123_0079704 3300048926 Bacteria 1999
452 Ga0496124_0286836 3300048927 Bacteria 1197
453 Ga0496124_0748414 3300048927 Bacteria 613
454 Ga0496126_0000762 3300048929 Bacteria 58311
455 Ga0496126_0003121 3300048929 Bacteria 21370
456 Ga0496126_0724404 3300048929 Bacteria 771
457 Ga0496126_1049820 3300048929 Bacteria 608
458 Ga0501032_0002429 3300049569 Bacteria 14535
459 Ga0501034_0002167 3300049571 Bacteria 24348
460 Ga0501034_0273506 3300049571 Bacteria 1630
461 Ga0501036_0022237 3300049572 Bacteria 5334
462 Ga0501037_0001096 3300049573 Bacteria 20062
463 Ga0501038_0005406 3300049574 Bacteria 11872
464 Ga0501039_0078049 3300049575 Bacteria 2575
465 Ga0501043_0000253 3300049579 Bacteria 48525
466 Ga0501047_0570693 3300049581 Bacteria 955
467 Ga0501067_0559545 3300049583 Bacteria 640
468 Ga0501069_0882459 3300049585 Bacteria 544
469 Ga0501070_0000501 3300049586 Bacteria 35639
470 Ga0501070_0068982 3300049586 Bacteria 2927
471 Ga0501073_0314556 3300049589 Bacteria 1080
472 Ga0501073_0772372 3300049589 Bacteria 662
473 Ga0501074_0691697 3300049590 Bacteria 720
474 Ga0501077_0681766 3300049593 Bacteria 660
475 Ga0501080_0049788 3300049742 Bacteria 3900
476 Ga0501044_0144625 3300049823 Bacteria 2364
477 nmdc:mga03683_188797_c1 3300050489 Bacteria 942
478 nmdc:mga03683_526521_c1 3300050489 Bacteria 574
479 nmdc:mga03n38_136158_c1 3300050490 Bacteria 1222
480 nmdc:mga03n38_1498_c1 3300050490 Bacteria 6742
481 nmdc:mga03n38_196897_c1 3300050490 Bacteria 1041
482 nmdc:mga03n38_61734_c1 3300050490 Bacteria 1707
483 nmdc:mga03n38_63752_c1 3300050490 Bacteria 1685
484 nmdc:mga03n38_65758_c1 3300050490 Bacteria 1663
485 nmdc:mga00v17_1040875_c1 3300050491 Bacteria 514
486 nmdc:mga00v17_292898_c1 3300050491 Bacteria 1057
487 nmdc:mga00v17_293994_c1 3300050491 Bacteria 1055
488 nmdc:mga00v17_38834_c1 3300050491 Bacteria 2849
489 nmdc:mga00v17_50988_c1 3300050491 Bacteria 2516
490 nmdc:mga00v17_53088_c1 3300050491 Bacteria 2469
491 nmdc:mga00v17_6662_c1 3300050491 Bacteria 6134
492 nmdc:mga00v17_669222_c1 3300050491 Bacteria 667
493 nmdc:mga00v17_709740_c1 3300050491 Bacteria 644
494 nmdc:mga00v17_785953_c1 3300050491 Bacteria 607
495 nmdc:mga00v17_78827_c1 3300050491 Bacteria 2053
496 nmdc:mga00v17_826138_c1 3300050491 Bacteria 589
497 nmdc:mga0yw44_105481_c1 3300050492 Bacteria 1800
498 nmdc:mga0yw44_1592_c1 3300050492 Bacteria 9115
499 nmdc:mga0yw44_206990_c1 3300050492 Bacteria 1297
500 nmdc:mga0yw44_291869_c1 3300050492 Bacteria 1091
501 nmdc:mga0yw44_390325_c1 3300050492 Bacteria 940
502 nmdc:mga0yw44_7184_c1 3300050492 Bacteria 5455
503 nmdc:mga0k408_60684_c1 3300050493 Bacteria 2197
504 nmdc:mga06z11_1032871_c1 3300050494 Bacteria 501
505 nmdc:mga06z11_507_c1 3300050494 Bacteria 14374
506 nmdc:mga04h51_190451_c1 3300050495 Bacteria 802
507 nmdc:mga04h51_5034_c1 3300050495 Bacteria 3340
508 nmdc:mga07m45_440918_c1 3300050496 Bacteria 755
509 nmdc:mga07m45_443276_c1 3300050496 Bacteria 753
510 nmdc:mga07m45_64358_c1 3300050496 Bacteria 2081
511 nmdc:mga05p37_20434_c1 3300050507 Bacteria 8009
512 nmdc:mga0qj67_12750_c1 3300050509 Bacteria 6335
513 nmdc:mga0qj67_64511_c1 3300050509 Bacteria 2913
514 nmdc:mga06r32_10664_c1 3300050510 Bacteria 8287
515 nmdc:mga08y16_952262_c1 3300050511 Bacteria 841
516 nmdc:mga08x19_859990_c1 3300050514 Bacteria 644
517 nmdc:mga0sz30_10455_c1 3300050516 Bacteria 3559
518 nmdc:mga0sz30_131063_c1 3300050516 Bacteria 1105
519 nmdc:mga0sz30_4098_c1 3300050516 Bacteria 5250
520 nmdc:mga0sz30_61061_c1 3300050516 Bacteria 1610
521 nmdc:mga0sz30_71641_c1 3300050516 Bacteria 1492
522 Ga0500610_0013514 3300053079 Bacteria 3803
523 Ga0500635_0001377 3300053080 Bacteria 5831
524 Ga0500643_004996 3300053087 Bacteria 5823
525 Ga0500643_075081 3300053087 Bacteria 935
526 Ga0500644_0255632 3300053088 Bacteria 740
527 Ga0500556_0016122 3300053104 Bacteria 2319
528 Ga0500556_0054918 3300053104 Bacteria 1451
529 Ga0500593_186512 3300053117 Bacteria 764
530 Ga0500652_001829 3300053131 Bacteria 6440
531 Ga0500616_0011820 3300053153 Bacteria 5134
532 Ga0500616_0039647 3300053153 Bacteria 2538
533 Ga0500633_0314567 3300053160 Bacteria 574
534 Ga0466962_0033882 3300061719 Bacteria 2444
535 2644487353 2643221687 Bacteria 6500351
536 2842135171 2842134933 Bacteria 5847019
537 2902839456 2902837492 Bacteria 6697721
538 2929213160 2929212328 Bacteria 7708288
539 Ga0075363_100156712
540 JGI24739J22299_10248656
541 JGI24737J22298_10067104
542 JGI24745J21846_1010110
543 JGI24748J21848_1059398
544 JGI24744J21845_10010654
545 Ga0055540_1001186
546 Ga0055540_1006526
547 Ga0070658_11964641
548 Ga0068869_100083254
549 Ga0070666_10470947
550 Ga0070682_100054901
551 Ga0070682_100227400
552 Ga0070682_100276736
553 Ga0070682_101075240
554 Ga0068868_100062658
555 Ga0068868_100636734
556 Ga0070689_100515712
557 Ga0070691_10337624
558 Ga0070692_10285853
559 Ga0070692_10361579
560 Ga0070668_100001160
561 Ga0070668_100139258
562 Ga0070668_100414429
563 Ga0070668_101266421
564 Ga0070669_100230239
565 Ga0070675_100256725
566 Ga0070675_100679130
567 Ga0070671_100882159
568 Ga0070674_100090684
569 Ga0070674_100443185
570 Ga0070673_100216343
571 Ga0070659_100178576
572 Ga0070667_100915676
573 Ga0070709_10010360
574 Ga0070710_11166624
575 Ga0070701_10238934
576 Ga0070711_100004765
577 Ga0070711_100346422
578 Ga0070705_101587501
579 Ga0070700_100427149
580 Ga0070708_101412794
581 Ga0070663_100274836
582 Ga0070678_100197018
583 Ga0070678_100200778
584 Ga0070678_100835650
585 Ga0070662_100157609
586 Ga0070662_100504015
587 Ga0068867_101498211
588 Ga0070685_10291050
589 Ga0070685_10499839
590 Ga0070685_11428447
591 Ga0068853_100050450
592 Ga0068853_100132387
593 Ga0070672_100419988
594 Ga0070672_101554529
595 Ga0070686_100466004
596 Ga0070686_100502145
597 Ga0070686_101829475
598 Ga0070696_100097839
599 Ga0070693_100342560
600 Ga0070693_100822543
601 Ga0070665_100078955
602 Ga0070665_101064051
603 Ga0070665_101080436
604 Ga0070704_100600363
605 Ga0068855_100512217
606 Ga0068857_102259046
607 Ga0068854_100163394
608 Ga0068854_100343880
609 Ga0068856_101851035
610 Ga0070702_100005931
611 Ga0070702_100083398
612 Ga0070702_100475676
613 Ga0070702_100645376
614 Ga0070702_100842632
615 Ga0068852_100773350
616 Ga0068859_102127084
617 Ga0068864_100102501
618 Ga0068866_10883041
619 Ga0068861_100015271
620 Ga0068861_100227280
621 Ga0068851_10241918
622 Ga0068863_100043518
623 Ga0068863_100070873
624 Ga0068863_102395399
625 Ga0068858_100187221
626 Ga0068858_100361538
627 Ga0068858_102387013
628 Ga0068860_100245696
629 Ga0068862_100435503
630 Ga0068862_100532595
631 Ga0068862_102296375
632 Ga0081538_10138763
633 Ga0075365_10016337
634 Ga0075365_10091668
635 Ga0075365_10224853
636 Ga0075365_10494942
637 Ga0075368_10004632
638 Ga0075368_10346699
639 Ga0075363_100001192
640 Ga0075363_100074712
641 Ga0075363_100146743
642 Ga0075363_100157342
643 Ga0075363_100161770
644 Ga0075363_100182023
645 Ga0075363_100200909
646 Ga0075363_100280108
647 Ga0075363_100948846
648 Ga0075364_10006077
649 Ga0075364_10006335
650 Ga0075364_10019219
651 Ga0075364_10051389
652 Ga0075364_10071277
653 Ga0075364_10074355
654 Ga0075364_10325872
655 Ga0075364_10509895
656 Ga0075364_10536422
657 Ga0075364_10540369
658 Ga0075364_10937467
659 Ga0070716_100429667
660 Ga0075362_10029626
661 Ga0075362_10744201
662 Ga0075367_10003749
663 Ga0075367_10125990
664 Ga0075367_10591185
665 Ga0075369_10001300
666 Ga0075369_10010812
667 Ga0075369_10025158
668 Ga0075369_10068171
669 Ga0075369_10194870
670 Ga0075369_10411536
671 Ga0075366_10063401
672 Ga0097621_100283547
673 Ga0097621_100374744
674 Ga0075370_10013896
675 Ga0075370_10196011
676 Ga0075370_10370244
677 Ga0075370_10640517
678 Ga0068871_101289943
679 Ga0068871_101875607
680 Ga0075428_100004705
681 Ga0075430_100041252
682 Ga0075431_100195686
683 Ga0068865_101523782
684 Ga0075436_100882908
685 Ga0097620_102127000
686 Ga0075435_100551490
687 Ga0099795_10498333
688 Ga0105250_10094907
689 Ga0111539_11191282
690 Ga0105245_10039100
691 Ga0105245_12765040
692 Ga0105247_10171872
693 Ga0114129_10022080
694 Ga0105243_10065143
695 Ga0105243_10431222
696 Ga0105243_11005810
697 Ga0105241_10643458
698 Ga0105242_10017716
699 Ga0105242_11062912
700 Ga0105248_10208928
701 Ga0105248_10639121
702 Ga0105248_10833230
703 Ga0105237_10004175
704 Ga0105237_10170082
705 Ga0105238_10518242
706 Ga0105249_11362782
707 Ga0105249_11862975
708 Ga0099796_10170641
709 Ga0105239_10010498
710 Ga0105239_10142696
711 Ga0105239_10333968
712 Ga0105239_10463478
713 Ga0105246_10023624
714 Ga0105246_10315676
715 Ga0157373_10523177
716 Ga0157370_11822827
717 Ga0157369_12657539
718 Ga0157374_10328701
719 Ga0157374_11789594
720 Ga0157378_10177650
721 Ga0157378_12728098
722 Ga0163162_10076054
723 Ga0163162_11446315
724 Ga0163162_12634901
725 Ga0157372_11938246
726 Ga0157375_10036149
727 Ga0163163_10629352
728 Ga0163163_10785435
729 Ga0157380_11429729
730 Ga0182008_10632610
731 Ga0157377_10020475
732 Ga0157377_10516471
733 Ga0157377_11216641
734 Ga0157379_10638081
735 Ga0157376_10777741
736 Ga0163161_10090293
737 Ga0163161_10154755
738 Ga0213876_10554113
739 Ga0209025_1114912
740 Ga0209051_1001623
741 Ga0209051_1002089
742 Ga0209051_1020883
743 Ga0207696_1037893
744 Ga0207692_10071151
745 Ga0207642_10062782
746 Ga0207710_10056083
747 Ga0207710_10156969
748 Ga0207688_10000860
749 Ga0207688_10127002
750 Ga0207680_10952269
751 Ga0207647_10077544
752 Ga0207699_10620542
753 Ga0207645_10350730
754 Ga0207671_10184756
755 Ga0207693_10003154
756 Ga0207663_10054496
757 Ga0207663_10575012
758 Ga0207652_11092589
759 Ga0207681_10948551
760 Ga0207694_10437819
761 Ga0207650_11241236
762 Ga0207659_10114593
763 Ga0207687_11150956
764 Ga0207644_10985047
765 Ga0207706_10056186
766 Ga0207706_10423652
767 Ga0207709_10502203
768 Ga0207670_10468061
769 Ga0207669_10109197
770 Ga0207669_10449246
771 Ga0207691_10102701
772 Ga0207711_10256495
773 Ga0207711_10788549
774 Ga0207689_10004263
775 Ga0207667_10442347
776 Ga0207651_10318550
777 Ga0207712_10051518
778 Ga0207668_10000470
779 Ga0207668_10149745
780 Ga0207668_10685592
781 Ga0207640_11387520
782 Ga0207658_10751593
783 Ga0207677_10118769
784 Ga0207677_10122995
785 Ga0207677_11993074
786 Ga0207703_10170818
787 Ga0207703_11367806
788 Ga0207703_12231660
789 Ga0207639_10061576
790 Ga0207678_10020820
791 Ga0207678_10091636
792 Ga0207708_10133215
793 Ga0207708_11075147
794 Ga0207641_11149634
795 Ga0207648_11157579
796 Ga0207648_11271852
797 Ga0207676_10187513
798 Ga0207676_10468277
799 Ga0207675_100057805
800 Ga0207675_100214342
801 Ga0207683_10013704
802 Ga0207683_10263682
803 Ga0207683_10791274
804 Ga0207698_10674535
805 Ga0209813_10001927
806 Ga0209813_10164486
807 Ga0268266_10063151
808 Ga0268266_10273204
809 Ga0268265_10314896
810 Ga0268265_10946113
811 Ga0268264_10104401
812 Ga0316578_10064501
813 Ga0307405_10315524
814 Ga0307413_10083981
815 Ga0307410_10028376
816 Ga0307410_10601779
817 Ga0307406_10939885
818 Ga0307407_10182108
819 Ga0307409_100011454
820 Ga0307409_101522997
821 Ga0307416_100051301
822 Ga0307414_10199232
823 Ga0307411_10107313
824 Ga0307411_12245202
825 Ga0307415_100114885
826 Ga0307415_100858945
827 Ga0307415_102385129
828 Ga0373948_0130712
829 Ga0373940_0152737
830 Ga0373952_0115804
831 Ga0373946_0101334
832 Ga0316574_0506038
833 Ga0373947_0364668
834 Ga0373937_0309471
835 Ga0316584_0036867
836 Ga0436364_1215586
837 Ga0436365_0263911
838 Ga0436365_1917608
839 Ga0436363_0863129
840 Ga0439461_0001719
841 Ga0439461_0148670
842 Ga0439466_0006524
843 Ga0439466_0078265
844 Ga0439465_0005708
845 Ga0439465_0022346
846 Ga0439465_0024114
847 Ga0451789_0730740
848 Ga0451793_1634259
849 Ga0451795_1682992
850 Ga0451800_0835424
851 Ga0451802_0339971
852 Ga0451807_0751036
853 Ga0451839_0475666
854 Ga0451841_0513919
855 Ga0451841_0703981
856 Ga0451847_0306062
857 Ga0451851_0615997
858 Ga0451853_2490044
859 Ga0451853_3162751
860 Ga0439431_0034726
861 Ga0439442_005017
862 Ga0439442_049817
863 Ga0439445_0014780
864 Ga0439448_0104214
865 Ga0439459_0039539
866 Ga0439459_0102765
867 Ga0466972_0018715
868 Ga0466965_0003599
869 Ga0466965_0060127
870 Ga0466961_0035343
871 Ga0466963_0086884
872 Ga0466964_0411099
873 Ga0466971_0017048
874 Ga0466968_0007820
875 Ga0466968_0127930
876 Ga0466970_0534103
877 Ga0466957_0210347
878 Ga0466960_0000267
879 Ga0466960_0163890
880 Ga0466959_0052995
881 Ga0466959_0781510
882 Ga0466967_0010373
883 Ga0466967_0048416
884 Ga0466967_0110015
885 Ga0466967_0652916
886 Ga0466967_0924117
887 Ga0495617_218918
888 Ga0495629_0111592
889 Ga0495638_0031715
890 Ga0495641_0044428
891 Ga0495651_0906770
892 Ga0495594_0133470
893 Ga0495606_0289608
894 Ga0495608_0170381
895 Ga0495620_0107474
896 Ga0495630_0345848
897 Ga0495632_0182289
898 Ga0495637_0212192
899 Ga0495666_0117524
900 Ga0495665_0043322
901 Ga0495622_0182065
902 Ga0495667_0615068
903 Ga0495668_0312379
904 Ga0495634_0142640
905 Ga0495625_0184046
906 Ga0495635_0098395
907 Ga0495646_0240730
908 Ga0495658_0046280
909 Ga0495613_0316417
910 Ga0495624_0138022
911 Ga0495671_0289592
912 Ga0495671_0638942
913 Ga0495589_0520128
914 Ga0495581_0065044
915 Ga0495674_0033541
916 Ga0495672_0041528
917 Ga0495672_0339061
918 Ga0495676_0189309
919 Ga0495686_0004017
920 Ga0495686_0138884
921 Ga0495593_0020522
922 Ga0495614_0132401
923 Ga0496100_0000996
924 Ga0496100_0204975
925 Ga0496100_0322161
926 Ga0496101_0000014
927 Ga0496101_0133599
928 Ga0496101_0258366
929 Ga0496101_0530933
930 Ga0496101_0546752
931 Ga0496101_0875798
932 Ga0496101_0899551
933 Ga0496102_0000041
934 Ga0496102_0010173
935 Ga0496102_0017446
936 Ga0496102_0262245
937 Ga0496102_0374096
938 Ga0496102_1041496
939 Ga0496103_0000058
940 Ga0496103_0159318
941 Ga0496104_0062002
942 Ga0496104_0240134
943 Ga0496104_0241955
944 Ga0496105_0071232
945 Ga0496105_0404959
946 Ga0496106_0046205
947 Ga0496106_0055461
948 Ga0496106_0272314
949 Ga0496106_0566522
950 Ga0496107_0004758
951 Ga0496107_0059423
952 Ga0496107_0286355
953 Ga0496107_0438471
954 Ga0496108_0010201
955 Ga0496108_0015625
956 Ga0496108_0591702
957 Ga0496108_0734757
958 Ga0496109_0001155
959 Ga0496109_0006803
960 Ga0496109_0293132
961 Ga0496109_1270878
962 Ga0496110_0151869
963 Ga0496110_0463547
964 Ga0496110_0727550
965 Ga0496110_0984729
966 Ga0496110_1070490
967 Ga0496111_0112583
968 Ga0496112_0031047
969 Ga0496112_0185334
970 Ga0496112_0197255
971 Ga0496112_0230636
972 Ga0496112_0272283
973 Ga0496113_0009039
974 Ga0496113_0030038
975 Ga0496113_0105902
976 Ga0496114_0006522
977 Ga0496114_0313245
978 Ga0496114_0633033
979 Ga0496114_1763092
980 Ga0496115_0006734
981 Ga0496115_0237949
982 Ga0496115_1203600
983 Ga0496116_0000098
984 Ga0496117_0000096
985 Ga0496118_0000073
986 Ga0496118_0147047
987 Ga0496121_0001389
988 Ga0496122_0061064
989 Ga0496123_0079704
990 Ga0496124_0286836
991 Ga0496124_0748414
992 Ga0496126_0000762
993 Ga0496126_0003121
994 Ga0496126_0724404
995 Ga0496126_1049820
996 Ga0501032_0002429
997 Ga0501034_0002167
998 Ga0501034_0273506
999 Ga0501036_0022237
1000 Ga0501037_0001096
1001 Ga0501038_0005406
1002 Ga0501039_0078049
1003 Ga0501043_0000253
1004 Ga0501047_0570693
1005 Ga0501067_0559545
1006 Ga0501069_0882459
1007 Ga0501070_0000501
1008 Ga0501070_0068982
1009 Ga0501073_0314556
1010 Ga0501073_0772372
1011 Ga0501074_0691697
1012 Ga0501077_0681766
1013 Ga0501080_0049788
1014 Ga0501044_0144625
1015 nmdc:mga03683_188797_c1
1016 nmdc:mga03683_526521_c1
1017 nmdc:mga03n38_136158_c1
1018 nmdc:mga03n38_1498_c1
1019 nmdc:mga03n38_196897_c1
1020 nmdc:mga03n38_61734_c1
1021 nmdc:mga03n38_63752_c1
1022 nmdc:mga03n38_65758_c1
1023 nmdc:mga00v17_1040875_c1
1024 nmdc:mga00v17_292898_c1
1025 nmdc:mga00v17_293994_c1
1026 nmdc:mga00v17_38834_c1
1027 nmdc:mga00v17_50988_c1
1028 nmdc:mga00v17_53088_c1
1029 nmdc:mga00v17_6662_c1
1030 nmdc:mga00v17_669222_c1
1031 nmdc:mga00v17_709740_c1
1032 nmdc:mga00v17_785953_c1
1033 nmdc:mga00v17_78827_c1
1034 nmdc:mga00v17_826138_c1
1035 nmdc:mga0yw44_105481_c1
1036 nmdc:mga0yw44_1592_c1
1037 nmdc:mga0yw44_206990_c1
1038 nmdc:mga0yw44_291869_c1
1039 nmdc:mga0yw44_390325_c1
1040 nmdc:mga0yw44_7184_c1
1041 nmdc:mga0k408_60684_c1
1042 nmdc:mga06z11_1032871_c1
1043 nmdc:mga06z11_507_c1
1044 nmdc:mga04h51_190451_c1
1045 nmdc:mga04h51_5034_c1
1046 nmdc:mga07m45_440918_c1
1047 nmdc:mga07m45_443276_c1
1048 nmdc:mga07m45_64358_c1
1049 nmdc:mga05p37_20434_c1
1050 nmdc:mga0qj67_12750_c1
1051 nmdc:mga0qj67_64511_c1
1052 nmdc:mga06r32_10664_c1
1053 nmdc:mga08y16_952262_c1
1054 nmdc:mga08x19_859990_c1
1055 nmdc:mga0sz30_10455_c1
1056 nmdc:mga0sz30_131063_c1
1057 nmdc:mga0sz30_4098_c1
1058 nmdc:mga0sz30_61061_c1
1059 nmdc:mga0sz30_71641_c1
1060 Ga0500610_0013514
1061 Ga0500635_0001377
1062 Ga0500643_004996
1063 Ga0500643_075081
1064 Ga0500644_0255632
1065 Ga0500556_0016122
1066 Ga0500556_0054918
1067 Ga0500593_186512
1068 Ga0500652_001829
1069 Ga0500616_0011820
1070 Ga0500616_0039647
1071 Ga0500633_0314567
1072 Ga0466962_0033882
1073 2644487353
1074 2842135171
1075 2902839456
1076 2929213160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map